CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP011126	Candidatus Coxiella mudrowiae strain CRt chromosome, complete genome	1 crisprs	DEDDh,cas3	1	1	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP011126_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011126_1

1203341-1203459

Orphan

Consensus_repeat	Method
AGAAATAGATAAAATAGATAAAAT	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP011126_1

>merge|NZ_CP011126|1|1203341-1203459|CRISPRCasFinder
ATCAATAGATATAATAGACGAAACGTGAAGCCTATGGTTGGCGGAATGAAAGCCCAAAAAGAAATAGATAAAATAGATAAAATAGATAAAATAGATAAAATAGATAAAATAGATAAAAT

>NZ_CP011126|1|1|1203341-1203459|CRISPRCasFinder
ATCAATAGATATAATAGACGAAAC	GTGAAGCCTATGGTTGGCGGAATGAA
AGCCCAAAAAGAAATAGATAAAAT	AGATAAAATAGATAAAATAGA
TAAAATAGATAAAATAGATAAAAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011126.1\|WP_048875400.1\|1198834_1199173_+\|histidine-triad-nucleotide-binding-protein	unknown	unknown	gnl\|CDD\|238607
NZ_CP011126.1\|WP_157870867.1\|1212733_1216150_-\|DNA-polymerase-III-subunit-alpha	unknown	unknown	gnl\|CDD\|235554
NZ_CP011126.1\|WP_048875401.1\|1199238_1199796_+\|GTP-cyclohydrolase-I-FolE	unknown	unknown	gnl\|CDD\|236472
NZ_CP011126.1\|WP_048875397.1\|1195692_1196076_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011126.1\|WP_048875396.1\|1194861_1195095_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237999
NZ_CP011126.1\|WP_048875804.1\|1223875_1225345_-\|IMP-dehydrogenase	unknown	unknown	gnl\|CDD\|235507
NZ_CP011126.1\|WP_048875407.1\|1211780_1212653_-\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|307170
NZ_CP011126.1\|WP_048875398.1\|1196265_1197261_+\|HlyD-family-secretion-protein	unknown	unknown	gnl\|CDD\|224482
NZ_CP011126.1\|WP_157870866.1\|1205358_1205568_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011126.1\|WP_082160444.1\|1200772_1200988_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|365803
NZ_CP011126.1\|WP_157870864.1\|1200264_1200513_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011126.1\|WP_048875412.1\|1222236_1223811_-\|glutamine-hydrolyzing-GMP-synthase	unknown	unknown	gnl\|CDD\|234614
NZ_CP011126.1\|WP_048875409.1\|1216234_1217347_-\|D-alanine--D-alanine-ligase	unknown	unknown	gnl\|CDD\|234993
NZ_CP011126.1\|WP_157870959.1\|1193712_1193880_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|99811
NZ_CP011126.1\|WP_157870960.1\|1220945_1221119_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|235599
NZ_CP011126.1\|WP_048875403.1\|1200926_1201310_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|179699
NZ_CP011126.1\|WP_157870868.1\|1217533_1217689_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011126.1\|WP_048875406.1\|1210647_1211748_-\|FUSC-family-protein	unknown	unknown	gnl\|CDD\|377393
NZ_CP011126.1\|WP_048875399.1\|1197282_1198821_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP011126.1\|WP_157870865.1\|1204959_1205289_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|275263

Protein	Function_ID	Function_description	E-value
NZ_CP011126.1\|WP_048875400.1\|1198834_1199173_+\|histidine-triad-nucleotide-binding-protein	gnl\|CDD\|238607	cd01276, PKCI_related, Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides. The members of this subgroup have a conserved HxHxHxx motif (x is a hydrophobic residue) that is a signature for this family. No enzymatic activity has been reported however, for PKCI and its related members.	9.36508e-50
NZ_CP011126.1\|WP_157870867.1\|1212733_1216150_-\|DNA-polymerase-III-subunit-alpha	gnl\|CDD\|235554	PRK05673, dnaE, DNA polymerase III subunit alpha; Validated.	0
NZ_CP011126.1\|WP_048875401.1\|1199238_1199796_+\|GTP-cyclohydrolase-I-FolE	gnl\|CDD\|236472	PRK09347, folE, GTP cyclohydrolase I; Provisional.	1.65666e-103
NZ_CP011126.1\|WP_048875396.1\|1194861_1195095_-\|hypothetical-protein	gnl\|CDD\|237999	cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor. In all cases binding of the effector leads to conformational changes and the ability to activate transcription. Cyclic nucleotide-binding domain similar to CAP are also present in cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) and vertebrate cyclic nucleotide-gated ion-channels. Cyclic nucleotide-monophosphate binding domain; proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues; the best studied is the prokaryotic catabolite gene activator, CAP, where such a domain is known to be composed of three alpha-helices and a distinctive eight-stranded, antiparallel beta-barrel structure; three conserved glycine residues are thought to be essential for maintenance of the structural integrity of the beta-barrel; CooA is a homodimeric transcription factor that belongs to CAP family; cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) contain two tandem copies of the cyclic nucleotide-binding domain; cAPK's are composed of two different subunits, a catalytic chain and a regulatory chain, which contains both copies of the domain; cGPK's are single chain enzymes that include the two copies of the domain in their N-terminal section; also found in vertebrate cyclic nucleotide-gated ion-channels.	1.08118e-05
NZ_CP011126.1\|WP_048875804.1\|1223875_1225345_-\|IMP-dehydrogenase	gnl\|CDD\|235507	PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed.	0
NZ_CP011126.1\|WP_048875407.1\|1211780_1212653_-\|DMT-family-transporter	gnl\|CDD\|307170	pfam00892, EamA, EamA-like transporter family. This family includes many hypothetical membrane proteins of unknown function. Many of the proteins contain two copies of the aligned region. The family used to be known as DUF6. Members of this family usually carry 5+5 transmembrane domains, and this domain attempts to model five of these.	5.45092e-07
NZ_CP011126.1\|WP_048875398.1\|1196265_1197261_+\|HlyD-family-secretion-protein	gnl\|CDD\|224482	COG1566, EmrA, Multidrug resistance efflux pump [Defense mechanisms].	1.60757e-94
NZ_CP011126.1\|WP_082160444.1\|1200772_1200988_+\|AAA-family-ATPase	gnl\|CDD\|365803	pfam00004, AAA, ATPase family associated with various cellular activities (AAA). AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes.	1.05707e-11
NZ_CP011126.1\|WP_048875399.1\|1197282_1198821_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	4.10963e-110
NZ_CP011126.1\|WP_048875412.1\|1222236_1223811_-\|glutamine-hydrolyzing-GMP-synthase	gnl\|CDD\|234614	PRK00074, guaA, GMP synthase; Reviewed.	0
NZ_CP011126.1\|WP_048875409.1\|1216234_1217347_-\|D-alanine--D-alanine-ligase	gnl\|CDD\|234993	PRK01966, ddl, D-alanine--D-alanine ligase.	1.41322e-151
NZ_CP011126.1\|WP_157870959.1\|1193712_1193880_-\|hypothetical-protein	gnl\|CDD\|99811	cd06215, FNR_iron_sulfur_binding_1, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal portion of the FAD/NAD binding domain contains most of the NADP(H) binding residues and the N-terminal sub-domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. In this ferredoxin like sub-group, the FAD/NAD sub-domains is typically fused to a C-terminal iron-sulfur binding domain. Iron-sulfur proteins play an important role in electron transfer processes and in various enzymatic reactions. The family includes plant and algal ferredoxins which act as electron carriers in photosynthesis and ferredoxins which participate in redox chains from bacteria to mammals. Ferredoxin reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.	3.07437e-07
NZ_CP011126.1\|WP_157870960.1\|1220945_1221119_-\|hypothetical-protein	gnl\|CDD\|235599	PRK05769, PRK05769, acetyl ornithine aminotransferase family protein.	9.99618e-05
NZ_CP011126.1\|WP_048875403.1\|1200926_1201310_+\|hypothetical-protein	gnl\|CDD\|179699	PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional.	2.49002e-09
NZ_CP011126.1\|WP_157870865.1\|1204959_1205289_-\|hypothetical-protein	gnl\|CDD\|275263	TIGR04470, hypothetical_protein_ALIPUT_00462, radical SAM mobile pair protein B. Members of this family are the downstream member (B) of a pair of tandem-encoded radical SAM enzymes. Most of these radical SAM gene pairs have an additional upstream regulatory gene in the MarR family. Examples of high sequence identity (over 96 percent) from cassettes in several Treponema species of the oral cavity to those in multiple Firmicutes in the gut microbiome suggest recent lateral gene transfer, as might be expected for antibiotic resistance genes. The function is unknown.	8.00219e-09
NZ_CP011126.1\|WP_048875406.1\|1210647_1211748_-\|FUSC-family-protein	gnl\|CDD\|377393	pfam04632, FUSC, Fusaric acid resistance protein family. This family includes a conserved region found in two proteins associated with fusaric acid resistance, FusC from Burkholderia cepacia and fdt-2 from Klebsiella oxytoca. These proteins are likely to be membrane transporter proteins.	1.23583e-18

>NZ_CP011126.1|WP_048875403.1|1200926_1201310_+|hypothetical-protein
MAQLMLLIYLDPPLKRLRRFDKIIKVPLPNHENRRALVEFYLSFTCYNTRSINDEFMEEFASDLEGYSSQYIKHLVNKAQIFGVKSHATAINRNQILKAIRRKSIRRFKEHNTNATQSLQDIYAPRR
>NZ_CP011126.1|WP_082160444.1|1200772_1200988_+|AAA-family-ATPase
MTTKYYYSIDEIDAIGSHLNSNGDSGANRRVLSELLIQMDGGFRKNENFFLIGATNAPNIFRPSIKASKKI
>NZ_CP011126.1|WP_157870864.1|1200264_1200513_+|hypothetical-protein
MLEMLEMLEMLEMLEMLEMLEMLEMLERSVHLHLPLQIKKQMHLKVPFQRLKVRPQKRLLKINPNIHTPIKNIKTLEVLANR
>NZ_CP011126.1|WP_048875401.1|1199238_1199796_+|GTP-cyclohydrolase-I-FolE
MTNTTTEKHVEAILTNLGEDIRREGLRETPHRFQKALESLTSGYQDKLHEIVNNAIFESDMDEIVIVKNIELYSLCEHHLLPFIGKCHVAYLPNGKIIGLSKIARIVDMYAKRLQVQENLTKQIAESIAKVTDAKGVGVIIEAKHLCMMMRGVEKQNSDMTTSMMLGTFRKDERTRAEFLSLIRN
>NZ_CP011126.1|WP_048875400.1|1198834_1199173_+|histidine-triad-nucleotide-binding-protein
MECTFCKIAKGELGELIYEDDQVVAFNDITPQAPTHILIIPRRHISTINDTSQADEQLLGHVITTAIQLARDNNMADAGYRLVLNCNRGGGQVVYHIHLHLLGGRQMNWPPG
>NZ_CP011126.1|WP_048875399.1|1197282_1198821_+|DHA2-family-efflux-MFS-transporter-permease-subunit
MKTAILINNNNLYSRRWLVIATIMIVAILEVLDSTIVNVALPYIMPSLGANQNQITWVSTSYIVSSAIMLPLTGFFSSRIGQKQLLLTNITGFMVASVLCGIAQSLSEIVIFRVFQGLFGASLIPLSQSILRETFPLEEQGKAMSIWGIGIMAAPVCGPTLGGFITEHMSWRWIFYINLPVCLLGLASTLMVIPETERRYQRIDWLGLILMVIGVGALQIFLDKGNENDWLNSNLILILLVMAIFCTIYFIIRSLTHSSPVVKLKIFKDRNFRISCLVLALFSGSLFSLITLEPILLERLFNYPALTAGWTMAPLGIASSVSMIFVPQLMKYINIKIILTTGIVFCIYGALRFTHINLNSSIQEFLANNAFLGFGMGFLMVPLTTYSLATLPKKDITEGAGLYSYSRMLGTSIGISLLSTLVSRTTQINWNTFSSHITIYNPNLHQLVASQQLTFLHPVEVNRLGLIAQQQASMLGFLDGFRVIAIIFILLIPLLLTLKTIELRSDTSVASH
>NZ_CP011126.1|WP_048875398.1|1196265_1197261_+|HlyD-family-secretion-protein
MIKKIIKVVLPFSLIAILLISGYFYWRHEKRYPSTDDAYIQGNVINIAPKISGTIAKVYVRNHQHVQKNQPLFDIDPAPFTIELIKSSAQLDETKQKIQAADMAVQSAKAVVAERKAELIHARLVTHRILALMKKQFVSRADGDLAIKNLDVAKAALTAAKNQLQELIEKRGEIDDKNAQLRLAKAAIKKSRLDLEYTHVVAPADGFIANFNLRRGDNVNSYQVLFALIEDKVWWATANFKETQLENIRSGQSATIKIDMYPDQVFLGHVASISEDSGTSFSLLPPENTSGNWVKVTQRFPVKIIITDRKPNYPLRLGASSTVTIDTTAVH
>NZ_CP011126.1|WP_048875397.1|1195692_1196076_-|hypothetical-protein
MGIDVWRFRTSVLFEYYRYDLLDSQNHQVGVLLADAVLLNEAEAQLVEKIAKATKKQVRGGLQTGPWESSELVECVILLGSRVAYLINSAKQSQIIRSYSPADLLQNTALKVQTWSDLKTAIKLMRE
>NZ_CP011126.1|WP_048875396.1|1194861_1195095_-|hypothetical-protein
MIKKGNEIVLACIEVGDYFGEQALLTEKPIRRNVSARALNKVVKTFTISHSVFQTVSQNQLKIKGIIKRTGAATINI
>NZ_CP011126.1|WP_157870959.1|1193712_1193880_-|hypothetical-protein
MEQKIRSFDEGQLVVLEANINGLMITRPYTLISVSENKDFYEITVKHEKFEIFSP
>NZ_CP011126.1|WP_157870865.1|1204959_1205289_-|hypothetical-protein
MNMSAELDFETKIFYKVNAAQLHTREINKPSYICKSLILGANTDPYQPVERNLKVTRSILEVLNAYNHPVSIITKNSMIERDIDLLTAMVKRRLTTVGVSVTSLSNELK
>NZ_CP011126.1|WP_157870866.1|1205358_1205568_-|hypothetical-protein
MLRNIMITKNRGAISNPEEQFEKEKYEKFDDGCDSNAEDESLSPLETTLFKDNAKTVITRNDSPDIGFE
>NZ_CP011126.1|WP_048875406.1|1210647_1211748_-|FUSC-family-protein
MNAFFNKLTDSVKRLSGERIVGSFKTALACLIGILIGKTFHLAMPQWILITIFVVMATNIRIGGAIRKSYFRLLGTIIGAFLAGVALFFIGDHPNIIHFLLILLIGVFAYLASSSTDIAQFGLLGATTMVMILDARAPTLKTAVDRTLEIFIGILIAIVVSRFVFPRHAKKLLRVSITNTLQQFQELFEFFVTKELTLDSLKEQEKIENNVINEILKQSTLLQETINEDPRVKKKRFIYQAIFLLERKLLRSIYMLVQTILAESAQIRSFSQNKQLFELHRRILDLFDFLSALSSKQTPKITLLPKEEIHAVIDKVIRLLFQSTGGTYRIINVHAFEFCLEHLVGVLYELEKWLSKLDSKEHLSEH
>NZ_CP011126.1|WP_048875407.1|1211780_1212653_-|DMT-family-transporter
MNQFAQVHSALFSLTLLWGLTFPLIKEAVSVIPPSIFIVLRLAIASLIFLPFILAYRKKMSFTMIKWTVVLGFFESATYVFQSIGLETVSSANSEFLTDFSVVVVSFLTLVFLRKKLQWFDFAAALLCLVGIFIQIDADVFTLTSGDFWTLACAFFYSCYIVALQAFSKKIKAKDTTLALSYKIAFSLFLSLLTFSYENMGVIFSWFVVIPVLFFLIFVTCLVFYLQFWYQRYVSMRKAVLIYAFEPIFSRIFGYLLNSEKIYLNNIRGLLILITFLLSGLASFKKLQLV
>NZ_CP011126.1|WP_157870867.1|1212733_1216150_-|DNA-polymerase-III-subunit-alpha
MMSLFIHLKVHSEYSIVDSVIRVDQLLQRIVDLKMPAVALTDEVNLFALIKFYRGALNKGVKPIIGAELILAEGEELFRFSVLCKNQIGFRHLIQLLSRAYVEGRQREKALIRWEWLMEAKEGLIVLSGGRQGDIGQALLQNRNVLAEERLARWLKYFPDRFYLELQRTQRDQEEEYIHSAVTLALAYDVPVVATNDVRFLHQEDFEAHEARVCIQQGYLLDDPSRPRGYSNQQYLKSTEEMKILFSDIPEALENTLEIAKRCNVQVSLDEVFLPKFPVPDNRTEEDFFHEQAKRGLEERLGKSKIKNIYEERLEREIDVIIKMGFSGYFLIVADFIAWAKKSDIPVGPGRGSGAGSLVAYSLGITELDPLEHELLFERFLNLERVSMPDFDIDFCMEGRDRVIDYVAECYGHDAVAQIITYGTMAARAVLRDVGRVLGLPYGYVDKIAKLVPFELGMTLKKAMDQEGILAKCYAEDDEIKNLIDLAMKLEGLARNAGKHAGGVVIAPTKLTDFVPLYSEPNNDHLVTQFDKDDVEAAGLVKFDFLGLRTLTIIKWAVQSVNAKRKAQNEPLLDISTIPLDDKKTYELLKSCATTAVFQLESRGMKDLIRRLKPDNFSDIMALVALFRPGPLQSGMVDTFIACKHGEQSVHYLHPDLEPVLRSTYGVILYQEQVMQIAQVLAGYSLGAADVLRHAMGKKKPEEMAKQREVFIKGSTSRGLKADLANQIFDLMEKFSGYGFNKSHSAAYALIAYQTAWLKALYPAEFMAAVLSSDMDNTDKVVSFINECRDMGLELLPPSINRGQYPFTVNVKGQIEYGLGAIKGVGEAAVLHIVACREEEGEFKGLFDFCHRVDLRKVNRRVLEPLIKSGSMDVFGGSRASLIKSLDKALQSAEQKNRNAQLGQNDLFGNEPDTKQDENYEDTPEWNDNERLRGEKETLGFYVTGHPLQACEKEIKTIGAVPIGQLVASKKNSVVIAGMVLAISNLITRSGKRMAILTLEDRTGIIEVTLFSELYQQVAGDLDKNTILIVRGMVGKDDFTGGLKIVADLIYTLDKMREQAKRLLIRVTAKEEVNRLLTELPLLVKGNLKGQCPIAIAYQGETASAELMLGETWKVKPSEELLSQLSQLCGKEKVELEY
>NZ_CP011126.1|WP_048875409.1|1216234_1217347_-|D-alanine--D-alanine-ligase
MEKKLTVSVLCGGRSPEHEISIQSARNIVVALSPDRYKVSVVYIDQSGKWYLIDDKENFLTQGPQNLVSAEKAVPITIALGEQIRPWRVLNGEKHFYGLDCVFPMIHGTQGEDGVLQGLLELLNLPYVGANVQSSAICIEKDITKSLLRAAKVPVVDWHTLWPFDRLEGVYERLIDQWETTELFMKAVSLGSSVAIFPVKSAIEFQKRAENIFCYDDRLIVEPRIYGREIECAVLGNGHPKASLPAEIISNHDFYSYEAKYLDPNGATTTTSVNLPEEIIGKIQQIAIDAFKIVRCSGMARVDFFVTPQNQIMVNEINTIPGFTNISMYPKMWEATGLSYSALLDRLIELALERHQNQQKLIRRYPINKQ
>NZ_CP011126.1|WP_157870868.1|1217533_1217689_+|hypothetical-protein
MNKVTILYKIKSLRKTSNDFICEVVICEVDITAEKIINNIIKNSYLERNPL
>NZ_CP011126.1|WP_157870960.1|1220945_1221119_-|hypothetical-protein
MDFSLGVMITNAGYDHEQIKQVIIDQLNTEVFTSYSFPMEAMARLVKNFIFCDTFRL
>NZ_CP011126.1|WP_048875412.1|1222236_1223811_-|glutamine-hydrolyzing-GMP-synthase
MPKDIHYHRILILDFGSQYTQLITRQVREIGVYCELMSCEVDEQTIRNYNPHGIILSGGPETVTLSYTLRAPSIVFEIGCPVLGICYGMQTMVYQLGGKVDMTAKAEFGHVEVRILKSDLLFENIDDRISSEGIPLLDVWMSHSDIVTKLPPGFEATASTDNSPYAAMADFKRRFFGLQFHPEVTHTPQGHRILIQFVKDICQCRATWITKNIIEESIHEIRNKVGSGRVIVGLSGGVDSAVTAAIVHEAIGDQLVCVLVDTGLLRLNEADEVLRVFKKHMGVRVICVSAKERFLKALEGVLDPEEKRKIAGEQFIRVFETEARKLDVNWLGQGTIYPDVIESAKTKTAKGHVIKTHHNVGGLPLKMDLQLIEPLRELFKDEVRKLGLELGLPYDLVYRHPFPGPGLAIRILGEIKAEYIDILQRADAIFIEELKKHDYYHKVSQAFVVFMPIKSVGVKGDTRHYSYLVALRAMETVDFMTARWAELPYEFLTSVGQRIINEIKEISRVVYDITNKPPATIEWE
>NZ_CP011126.1|WP_048875804.1|1223875_1225345_-|IMP-dehydrogenase
MRINQEALTFDDVLLLPGYSEVLPKDVSLTTRLTRNITLNIPLLSAAMDTVTEARLAIALAEAGGVGILHKNMSPERQASEVRKVKKFESGVVFHPITVSPASTIGELKKITSEYNISGLPVVEGEQLVGIITNRDIRFESDMEQKVANLMTPKERLITIKEGATREEIINLFRPHRVEKLLVINERFELRGLITVKDILRSQQNPNACKTASGQLRVGAAIGTENETPDRVAALVAEDVDILVVDTAHGHSKGVIDRVKWVKKHYPDVPVIAGNIATASAARALTDAGVDAVKVGMGPGSICITRIVAGIGVPQITAISQVASELKNDDVFIIADGGIRFSGDLCKAIGAGAHAVMIGGLFAGTEEAPGEEVLYQGRSYKSYRGMGSARAMFGAYGSSDRYFQEAQEKQEKYVPEGIEGRVPYKGPLRGVIHQLTGGLRSGMGYTGCKTIEEMRTKTQFVRVTSAGVRESHAHDVTVTKESPNYSVEE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP011126_1	1.2\|1203415\|21\|NZ_CP011126\|CRISPRCasFinder	1203415-1203435	21	NZ_CP011126.1	1203442-1203462	0	1.0
NZ_CP011126_1	1.2\|1203415\|21\|NZ_CP011126\|CRISPRCasFinder	1203415-1203435	21	NZ_CP011126.1	1203451-1203471	0	1.0

1. spacer 1.2|1203415|21|NZ_CP011126|CRISPRCasFinder matches to position: 1203442-1203462, mismatch: 0, identity: 1.0

agataaaatagataaaataga	CRISPR spacer
agataaaatagataaaataga	Protospacer
*********************

2. spacer 1.2|1203415|21|NZ_CP011126|CRISPRCasFinder matches to position: 1203451-1203471, mismatch: 0, identity: 1.0

agataaaatagataaaataga	CRISPR spacer
agataaaatagataaaataga	Protospacer
*********************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP011126_1	1.2\|1203415\|21\|NZ_CP011126\|CRISPRCasFinder	1203415-1203435	21	MN693295	Marine virus AFVG_25M553, complete genome	15640-15660	0	1.0
NZ_CP011126_1	1.2\|1203415\|21\|NZ_CP011126\|CRISPRCasFinder	1203415-1203435	21	MN693074	Marine virus AFVG_25M380, complete genome	28341-28361	0	1.0
NZ_CP011126_1	1.2\|1203415\|21\|NZ_CP011126\|CRISPRCasFinder	1203415-1203435	21	MN692972	Marine virus AFVG_117M68, complete genome	23221-23241	1	0.952
NZ_CP011126_1	1.2\|1203415\|21\|NZ_CP011126\|CRISPRCasFinder	1203415-1203435	21	MN694054	Marine virus AFVG_250M255, complete genome	20977-20997	1	0.952
NZ_CP011126_1	1.2\|1203415\|21\|NZ_CP011126\|CRISPRCasFinder	1203415-1203435	21	MN694075	Marine virus AFVG_250M257, complete genome	24541-24561	1	0.952
NZ_CP011126_1	1.2\|1203415\|21\|NZ_CP011126\|CRISPRCasFinder	1203415-1203435	21	MN693697	Marine virus AFVG_250M256, complete genome	2698-2718	1	0.952
NZ_CP011126_1	1.2\|1203415\|21\|NZ_CP011126\|CRISPRCasFinder	1203415-1203435	21	MN693016	Marine virus AFVG_117M69, complete genome	3740-3760	1	0.952
NZ_CP011126_1	1.2\|1203415\|21\|NZ_CP011126\|CRISPRCasFinder	1203415-1203435	21	NC_007392	Spiroplasma citri plasmid pSci6	986-1006	1	0.952
NZ_CP011126_1	1.2\|1203415\|21\|NZ_CP011126\|CRISPRCasFinder	1203415-1203435	21	NZ_CP047431	Spiroplasma citri strain BLH-13 plasmid pSciBLH13-3, complete sequence	34599-34619	1	0.952
NZ_CP011126_1	1.2\|1203415\|21\|NZ_CP011126\|CRISPRCasFinder	1203415-1203435	21	NZ_CP031116	Rubrobacter indicoceani strain SCSIO 08198 plasmid unnamed1, complete sequence	92204-92224	1	0.952
NZ_CP011126_1	1.2\|1203415\|21\|NZ_CP011126\|CRISPRCasFinder	1203415-1203435	21	NZ_CP046369	Spiroplasma citri strain BR12 plasmid pScpBR12-1, complete sequence	54455-54475	1	0.952
NZ_CP011126_1	1.2\|1203415\|21\|NZ_CP011126\|CRISPRCasFinder	1203415-1203435	21	NZ_CP042474	Spiroplasma citri strain CC-2 plasmid pScpCC2-2, complete sequence	14915-14935	1	0.952
NZ_CP011126_1	1.2\|1203415\|21\|NZ_CP011126\|CRISPRCasFinder	1203415-1203435	21	JN638751	Bacillus phage G, complete genome	92136-92156	1	0.952
NZ_CP011126_1	1.2\|1203415\|21\|NZ_CP011126\|CRISPRCasFinder	1203415-1203435	21	NC_015906	Borreliella bissettii DN127 plasmid cp32-quad, complete sequence	30010-30030	1	0.952
NZ_CP011126_1	1.2\|1203415\|21\|NZ_CP011126\|CRISPRCasFinder	1203415-1203435	21	NZ_CP046372	Spiroplasma citri strain LB 319 plasmid pScpLB319-1, complete sequence	52929-52949	1	0.952
NZ_CP011126_1	1.2\|1203415\|21\|NZ_CP011126\|CRISPRCasFinder	1203415-1203435	21	NZ_CP047440	Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-3, complete sequence	21948-21968	1	0.952
NZ_CP011126_1	1.2\|1203415\|21\|NZ_CP011126\|CRISPRCasFinder	1203415-1203435	21	NZ_CP047427	Spiroplasma citri strain C189 plasmid pScpC189-1, complete sequence	13859-13879	1	0.952
NZ_CP011126_1	1.2\|1203415\|21\|NZ_CP011126\|CRISPRCasFinder	1203415-1203435	21	NZ_CP053310	Spiroplasma citri strain C5 plasmid pScpC5-6, complete sequence	31605-31625	1	0.952
NZ_CP011126_1	1.2\|1203415\|21\|NZ_CP011126\|CRISPRCasFinder	1203415-1203435	21	NZ_LR135205	Enterococcus faecium isolate E7171 plasmid 3	12663-12683	2	0.905

1. spacer 1.2|1203415|21|NZ_CP011126|CRISPRCasFinder matches to MN693295 (Marine virus AFVG_25M553, complete genome) position: , mismatch: 0, identity: 1.0

agataaaatagataaaataga	CRISPR spacer
agataaaatagataaaataga	Protospacer
*********************

2. spacer 1.2|1203415|21|NZ_CP011126|CRISPRCasFinder matches to MN693074 (Marine virus AFVG_25M380, complete genome) position: , mismatch: 0, identity: 1.0

agataaaatagataaaataga	CRISPR spacer
agataaaatagataaaataga	Protospacer
*********************

3. spacer 1.2|1203415|21|NZ_CP011126|CRISPRCasFinder matches to MN692972 (Marine virus AFVG_117M68, complete genome) position: , mismatch: 1, identity: 0.952

agataaaatagataaaataga	CRISPR spacer
ggataaaatagataaaataga	Protospacer
.********************

4. spacer 1.2|1203415|21|NZ_CP011126|CRISPRCasFinder matches to MN694054 (Marine virus AFVG_250M255, complete genome) position: , mismatch: 1, identity: 0.952

agataaaatagataaaataga	CRISPR spacer
ggataaaatagataaaataga	Protospacer
.********************

5. spacer 1.2|1203415|21|NZ_CP011126|CRISPRCasFinder matches to MN694075 (Marine virus AFVG_250M257, complete genome) position: , mismatch: 1, identity: 0.952

agataaaatagataaaataga	CRISPR spacer
ggataaaatagataaaataga	Protospacer
.********************

6. spacer 1.2|1203415|21|NZ_CP011126|CRISPRCasFinder matches to MN693697 (Marine virus AFVG_250M256, complete genome) position: , mismatch: 1, identity: 0.952

agataaaatagataaaataga	CRISPR spacer
ggataaaatagataaaataga	Protospacer
.********************

7. spacer 1.2|1203415|21|NZ_CP011126|CRISPRCasFinder matches to MN693016 (Marine virus AFVG_117M69, complete genome) position: , mismatch: 1, identity: 0.952

agataaaatagataaaataga	CRISPR spacer
ggataaaatagataaaataga	Protospacer
.********************

8. spacer 1.2|1203415|21|NZ_CP011126|CRISPRCasFinder matches to NC_007392 (Spiroplasma citri plasmid pSci6) position: , mismatch: 1, identity: 0.952

agataaaatagataaaataga	CRISPR spacer
agataaaatagataaaataaa	Protospacer
*******************.*

9. spacer 1.2|1203415|21|NZ_CP011126|CRISPRCasFinder matches to NZ_CP047431 (Spiroplasma citri strain BLH-13 plasmid pSciBLH13-3, complete sequence) position: , mismatch: 1, identity: 0.952

agataaaatagataaaataga	CRISPR spacer
agataaaatagataaaataaa	Protospacer
*******************.*

10. spacer 1.2|1203415|21|NZ_CP011126|CRISPRCasFinder matches to NZ_CP031116 (Rubrobacter indicoceani strain SCSIO 08198 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

agataaaatagataaaataga	CRISPR spacer
agataaaatagagaaaataga	Protospacer
************ ********

11. spacer 1.2|1203415|21|NZ_CP011126|CRISPRCasFinder matches to NZ_CP046369 (Spiroplasma citri strain BR12 plasmid pScpBR12-1, complete sequence) position: , mismatch: 1, identity: 0.952

agataaaatagataaaataga	CRISPR spacer
agataaaatagataaaataaa	Protospacer
*******************.*

12. spacer 1.2|1203415|21|NZ_CP011126|CRISPRCasFinder matches to NZ_CP042474 (Spiroplasma citri strain CC-2 plasmid pScpCC2-2, complete sequence) position: , mismatch: 1, identity: 0.952

agataaaatagataaaataga	CRISPR spacer
agataaaatagataaaataaa	Protospacer
*******************.*

13. spacer 1.2|1203415|21|NZ_CP011126|CRISPRCasFinder matches to JN638751 (Bacillus phage G, complete genome) position: , mismatch: 1, identity: 0.952

agataaaatagataaaataga	CRISPR spacer
agataaaatagataaaattga	Protospacer
****************** **

14. spacer 1.2|1203415|21|NZ_CP011126|CRISPRCasFinder matches to NC_015906 (Borreliella bissettii DN127 plasmid cp32-quad, complete sequence) position: , mismatch: 1, identity: 0.952

agataaaatagataaaataga	CRISPR spacer
agataaaatagataaaataaa	Protospacer
*******************.*

15. spacer 1.2|1203415|21|NZ_CP011126|CRISPRCasFinder matches to NZ_CP046372 (Spiroplasma citri strain LB 319 plasmid pScpLB319-1, complete sequence) position: , mismatch: 1, identity: 0.952

agataaaatagataaaataga	CRISPR spacer
agataaaatagataaaataaa	Protospacer
*******************.*

16. spacer 1.2|1203415|21|NZ_CP011126|CRISPRCasFinder matches to NZ_CP047440 (Spiroplasma citri strain BLH-MB plasmid pSciBLHMB-3, complete sequence) position: , mismatch: 1, identity: 0.952

agataaaatagataaaataga	CRISPR spacer
agataaaatagataaaataaa	Protospacer
*******************.*

17. spacer 1.2|1203415|21|NZ_CP011126|CRISPRCasFinder matches to NZ_CP047427 (Spiroplasma citri strain C189 plasmid pScpC189-1, complete sequence) position: , mismatch: 1, identity: 0.952

agataaaatagataaaataga	CRISPR spacer
agataaaatagataaaataaa	Protospacer
*******************.*

18. spacer 1.2|1203415|21|NZ_CP011126|CRISPRCasFinder matches to NZ_CP053310 (Spiroplasma citri strain C5 plasmid pScpC5-6, complete sequence) position: , mismatch: 1, identity: 0.952

agataaaatagataaaataga	CRISPR spacer
agataaaatagataaaataaa	Protospacer
*******************.*

19. spacer 1.2|1203415|21|NZ_CP011126|CRISPRCasFinder matches to NZ_LR135205 (Enterococcus faecium isolate E7171 plasmid 3) position: , mismatch: 2, identity: 0.905

agataaaatagataaaataga	CRISPR spacer
tcataaaatagataaaataga	Protospacer
  *******************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

231535 : 241024

Acanthamoeba_polyphaga_lentillevirus(14.29%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048874879.1\|231535_233173_-\|tRNA	methionine--tRNA ligase	J3E7X8	Acanthamoeba_polyphaga_lentillevirus	1.3e-58	29.0
WP_048874880.1\|233309_234197_+	Mrp/NBP35 family ATP-binding protein	NA	NA	NA	NA
WP_048874881.1\|234196_234763_+	dCTP deaminase	S5VM63	Pseudomonas_phage	3.4e-72	74.3
WP_048874882.1\|235010_236678_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	2.1e-154	53.0
WP_048874883.1\|236825_237683_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	5.8e-55	43.5
WP_048874884.1\|237777_239052_+	phosphopyruvate hydratase	W6LP63	Streptococcus_phage	1.6e-133	58.5
WP_048874885.1\|239070_239343_+	cell division protein FtsB	NA	NA	NA	NA
WP_082160394.1\|239517_240294_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	8.2e-85	61.2
WP_048875754.1\|240352_241024_+	peptidoglycan DD-metalloendopeptidase family protein	A0A292GJG6	Xanthomonas_phage	1.6e-15	45.2

DBSCAN-SWA_2

1090973 : 1100694

Klosneuvirus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048875329.1\|1090973_1093592_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	2.1e-84	40.3
WP_048875330.1\|1093588_1094038_-	regulatory protein RecX	NA	NA	NA	NA
WP_048875331.1\|1094034_1095069_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	2.5e-113	63.9
WP_048875332.1\|1095183_1095672_-	CinA family protein	B5TK85	Pseudomonas_phage	5.4e-26	43.4
WP_048875333.1\|1095765_1098342_+	DNA mismatch repair protein MutS	A0A1V0SJ67	Klosneuvirus	3.7e-41	23.3
WP_048875334.1\|1099242_1099752_+	MFS transporter	A0A0P0IY73	Acinetobacter_phage	2.3e-19	36.1
WP_048875335.1\|1099714_1100071_+	hypothetical protein	NA	NA	NA	NA
WP_162198821.1\|1100090_1100195_+	hypothetical protein	NA	NA	NA	NA
WP_082160441.1\|1100184_1100694_+	hypothetical protein	A0A0P0IY73	Acinetobacter_phage	6.7e-11	33.5

DBSCAN-SWA_3

1419698 : 1427248

uncultured_Mediterranean_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048875534.1\|1419698_1420466_-	exodeoxyribonuclease III	E3T4M6	Cafeteria_roenbergensis_virus	1.7e-34	35.1
WP_048875535.1\|1420564_1421191_+	orotate phosphoribosyltransferase	NA	NA	NA	NA
WP_157870892.1\|1421187_1422606_-	phosphomannomutase/phosphoglucomutase	A0A127AWJ1	Bacillus_phage	1.3e-51	30.1
WP_048875536.1\|1422583_1423042_-	dUTP diphosphatase	Q2NP83	Xanthomonas_phage	5.3e-47	56.7
WP_082160465.1\|1423396_1423669_+	hypothetical protein	NA	NA	NA	NA
WP_082160466.1\|1423656_1423920_+	hypothetical protein	NA	NA	NA	NA
WP_048875537.1\|1424066_1424303_+	50S ribosomal protein L28	NA	NA	NA	NA
WP_048875538.1\|1424323_1424536_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_048875539.1\|1424587_1424836_-	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	1.9e-14	48.4
WP_048875540.1\|1424847_1425333_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	3.7e-27	43.7
WP_048875541.1\|1425425_1425929_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	S4W084	Pandoravirus	3.5e-12	35.0
WP_048875542.1\|1425931_1427248_-	polynucleotide adenylyltransferase PcnB	A0A1B1IVF3	uncultured_Mediterranean_phage	1.1e-23	33.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage