CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP011929	Marinobacter sp. CP1 chromosome, complete genome	1 crisprs	DEDDh,csa3,RT,WYL,DinG,cas3	0	1	10	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP011929_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011929_1

4276241-4276322

Orphan

Consensus_repeat	Method
ACAACGGCGTTTCCGGAAACTCCCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP011929_1

>merge|NZ_CP011929|1|4276241-4276322|CRISPRCasFinder
ACAACGGCGTTTCCGGAAACTCCCGATCAATCGGCAACACCACCTACCACAACTTCGACAACGGCGTTTCCGGCAACTCCCG

>NZ_CP011929|1|1|4276241-4276322|CRISPRCasFinder
ACAACGGCGTTTCCGGAAACTCCCG	ATCAATCGGCAACACCACCTACCACAACTTCG
ACAACGGCGTTTCCGGCAACTCCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011929.1\|WP_053115182.1\|4278127_4278469_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011929.1\|WP_053113971.1\|4273957_4275283_-\|IS1182-family-transposase	unknown	unknown	gnl\|CDD\|372705
NZ_CP011929.1\|WP_053115579.1\|4280634_4280898_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011929.1\|WP_157807853.1\|4277463_4277601_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011929.1\|WP_053115175.1\|4268384_4269200_+\|CoA-ester-lyase	unknown	unknown	gnl\|CDD\|225184
NZ_CP011929.1\|WP_053115174.1\|4267154_4268351_+\|CoA-transferase	unknown	unknown	gnl\|CDD\|224717
NZ_CP011929.1\|WP_053115185.1\|4279573_4280530_+\|recombinase-RecT	unknown	unknown	gnl\|CDD\|236628
NZ_CP011929.1\|WP_053115179.1\|4275467_4275719_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011929.1\|WP_053115172.1\|4265127_4265964_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226300
NZ_CP011929.1\|WP_053115176.1\|4269277_4270954_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|236235
NZ_CP011929.1\|WP_158499468.1\|4270946_4272011_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293811
NZ_CP011929.1\|WP_053115184.1\|4279195_4279516_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225922
NZ_CP011929.1\|WP_053115177.1\|4272093_4273257_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173847
NZ_CP011929.1\|WP_053115173.1\|4265964_4267128_+\|acyl-CoA/acyl-ACP-dehydrogenase	unknown	unknown	gnl\|CDD\|224871
NZ_CP011929.1\|WP_053115181.1\|4277891_4278128_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011929.1\|WP_075267723.1\|4278471_4278936_+\|single-stranded-DNA-binding-protein	unknown	unknown	gnl\|CDD\|273179
NZ_CP011929.1\|WP_053115183.1\|4278963_4279209_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011929.1\|WP_053115186.1\|4280969_4281974_+\|endonuclease	unknown	unknown	gnl\|CDD\|200235
NZ_CP011929.1\|WP_053115171.1\|4264055_4264964_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176113
NZ_CP011929.1\|WP_041335779.1\|4277132_4277423_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP011929.1\|WP_053113971.1\|4273957_4275283_-\|IS1182-family-transposase	gnl\|CDD\|372705	pfam13751, DDE_Tnp_1_6, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis.	1.15903e-17
NZ_CP011929.1\|WP_053115175.1\|4268384_4269200_+\|CoA-ester-lyase	gnl\|CDD\|225184	COG2301, CitE, Citrate lyase beta subunit [Carbohydrate transport and metabolism].	6.68568e-70
NZ_CP011929.1\|WP_053115174.1\|4267154_4268351_+\|CoA-transferase	gnl\|CDD\|224717	COG1804, CaiB, Predicted acyl-CoA transferases/carnitine dehydratase [Energy production and conversion].	1.21246e-141
NZ_CP011929.1\|WP_053115185.1\|4279573_4280530_+\|recombinase-RecT	gnl\|CDD\|236628	PRK09846, recT, recombination protein RecT.	4.23663e-22
NZ_CP011929.1\|WP_053115184.1\|4279195_4279516_-\|hypothetical-protein	gnl\|CDD\|225922	COG3387, SGA1, Glucoamylase and related glycosyl hydrolases [Carbohydrate transport and metabolism].	0.00432995
NZ_CP011929.1\|WP_053115172.1\|4265127_4265964_+\|hypothetical-protein	gnl\|CDD\|226300	COG3777, COG3777, Uncharacterized conserved protein [Function unknown].	4.82642e-97
NZ_CP011929.1\|WP_053115176.1\|4269277_4270954_+\|AMP-binding-protein	gnl\|CDD\|236235	PRK08314, PRK08314, long-chain-fatty-acid--CoA ligase; Validated.	0
NZ_CP011929.1\|WP_158499468.1\|4270946_4272011_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293811	cd07725, TTHA1429-like_MBL-fold, uncharacterized Thermus thermophilus TTHA1429 and related proteins; MBL-fold metallo hydrolase domain. Includes the MBL-fold metallo hydrolase domain of uncharacterized Thermus thermophilus TTHA1429 and related proteins. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	6.51924e-37
NZ_CP011929.1\|WP_053115177.1\|4272093_4273257_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173847	cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases. Short chain acyl-CoA dehydrogenase (SCAD). SCAD is a mitochondrial beta-oxidation enzyme. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of SCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. This subgroup also contains the eukaryotic short/branched chain acyl-CoA dehydrogenase(SBCAD), the bacterial butyryl-CoA dehydorgenase(BCAD) and 2-methylbutyryl-CoA dehydrogenase, which is involved in isoleucine catabolism. These enzymes are homotetramers.	2.47904e-135
NZ_CP011929.1\|WP_053115173.1\|4265964_4267128_+\|acyl-CoA/acyl-ACP-dehydrogenase	gnl\|CDD\|224871	COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid metabolism].	1.28931e-109
NZ_CP011929.1\|WP_075267723.1\|4278471_4278936_+\|single-stranded-DNA-binding-protein	gnl\|CDD\|273179	TIGR00621, Single-stranded_DNA-binding_protein, single stranded DNA-binding protein (ssb). All proteins in this family for which functions are known are single-stranded DNA binding proteins that function in many processes including transcription, repair, replication and recombination. Members encoded between genes for ribosomal proteins S6 and S18 should be annotated as primosomal protein N (PriB). Forms in gamma-protoeobacteria are much shorter and poorly recognized by this model. Additional members of this family include phage proteins. Eukaryotic members are organellar proteins. [DNA metabolism, DNA replication, recombination, and repair].	2.72912e-35
NZ_CP011929.1\|WP_053115186.1\|4280969_4281974_+\|endonuclease	gnl\|CDD\|200235	TIGR03033, hypothetical_protein, putative phage-type endonuclease. Members of this protein family are found often in phage genomes and in prokaryotic genomes in uncharacterized regions that resemble integrated prophage regions.	2.83386e-36
NZ_CP011929.1\|WP_053115171.1\|4264055_4264964_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176113	cd08421, PBP2_LTTR_like_1, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor. The genes controlled by the LTTRs have diverse functional roles including amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to a name a few. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.00265e-78

>NZ_CP011929.1|WP_053115179.1|4275467_4275719_+|hypothetical-protein
MVGNIVVNAILAGILFAAYSWTPWASLALATLSALAFSHIFIFDRAFLEEIAKQGIDRLSLLIGAGISYVGVIVSIVALLVKQ
>NZ_CP011929.1|WP_053113971.1|4273957_4275283_-|IS1182-family-transposase
MGTTFRPYSPDQELLLPPSLNEWLPEGHLAYFISDVVEELDLSAFYARYEGSGRRNSPFDPRMMLKVLIYAYATGVFSSRKIARKLEEDVALRVLAAGNFPRHRTICDFRKQHLAAFKAVFIQVVRIAQEAELVTLGTLAIDGTKVRANASKHKAMSYDRMREEEARLSKEVDELCGQARRVDESEDQQFGPDQRGDELPEELQHRQGRLDKIRAAKEKLEADQKTQDEAKGRHPDDDRRSPKGGRNFKRDYGVPEDKAQSNFTDPQSRIMKTNDGFQQCYNGQLAVDGEFQIIVGNRQGNNPSDNGCLVPLLGEVKETLGSYPGQCLADAGYRKEEDLQALETKGIDGYVSLRREGKKTGDINASRYPATARMEEKLTTAEGRAVYAQRKHMVEAVNGWIKNVLGFRQFGLRGLQAVQGEWDLVCLSLNLRRMSSLMRLA
>NZ_CP011929.1|WP_053115177.1|4272093_4273257_+|acyl-CoA-dehydrogenase
MALDEETLNQFVESVRRYVRDRLIPLEMQVAEEDQIPEDVIAEMKEMGLFGISIPSEFGGLGLSMSEEVAIIQEMGYTSPVFRSMFGTNVGIGSQGIVMDGTPEQKEKYLPKLATGELIGSFALTEPDAGSDAGSVRTSARRDGDDFIINGTKRYITNAPRAGIFTVMARTGTREEGARGVSAFLVDAKLPGISLGKPDQKMGQKGAHTCDVIFEDVRVPANALIGGKEGQGFKTAMKVLDRGRLHISALSVGTAKRLIDESVSYASGRKQFGTEIANFQLVQAMLADSQAEYYAGKCMVEAAAKSFDAGEAVSMNASSCKLFCTEMVGRVADRAVQVHGGAGYISEYCVERFFRDVRLFRLYEGTSQIQQLVIAKHLIRNAEHSPG
>NZ_CP011929.1|WP_158499468.1|4270946_4272011_+|MBL-fold-metallo-hydrolase
MPDADMNPKTADRVPEAAELVEVAHNVYWSRIPLPGKLNHINVWLIRDEDGFSVVDTGMCTPPAEAAWKSLLESLPERKPVRRVFVTHLHPDHVGMAGWLLERDAEEFWMTRMEYLTCRVMVAQSHDETVPEDFIAFHRAVGWPDSAIDGYYDHYRNYGRRISRLPRSYQRLEEGQHHVIGGHRWRVVVGNGHSPEHACLYCEESKLLISGDQVLPGISSNVSVTPLEPTANPMADWLASLRKLKAEIPDDVLVLPAHQQCFTGLHDRIETLIADQERAVTNLRADLGREPKRVIDVFAVLFGRDISEEDFMVFNLATGEALACLNYLIERNEVHFMTDAKGVRWYRSVGTQEQ
>NZ_CP011929.1|WP_053115176.1|4269277_4270954_+|AMP-binding-protein
MKAGRNTYWPKGLPRTLELPKTSLYYNLEVAATRYPDKPAVVFYDSVLSYSELRQQVRALAGYLQLECGVCPGDRVALYSQNSPQYVIGYYAILRAQGVVVPINPMNLSEELKYCVSDSGARTALVSQELYGNAQPLLASGDLDHVIVHAYSDYLTAATDLAVPSAVTEPRQEHTDPGVILWRDVLSRELAPSAFTGEHDDLAIIGYTSGTTGHPKGCVHSHSTVMAAVAASAVWRGGSPAFSALAIAPLFHFLGMQGGMNGPIFNGATSVLMQRWDRDVAVKLIERHHVSLWSAPPSMIVDFFSNPDLANHDVSSLSKLMGGGAAMPEAISRKLAEEFNIVYNEAYGLTETAAFILGNPIERGKRQCLGIASFGVDARIVDPATFEDLPQGETGEIILHGPQVMLEYWNNAQATAKSILERDGKRFLRTGDLGYMDEEGYFFMVDRLKRMINASGFKVWPAEVESIMYGHPEIHEACVIAVPDPKRGETAKAMVVLKPTAPENLTEDDIIEWCKKHMAAYKVPTAVSIIDELPKSGTGKIMWRQLQEEARMEGANRA
>NZ_CP011929.1|WP_053115175.1|4268384_4269200_+|CoA-ester-lyase
MTGKDLKTMLFVPASRPERIPKAIASGAGAVIVDLEDAVPADAKNPARDALDAFLADHHGESIYVRINARGTAEFEADMALCARHSKVVGIMLSKAESAEDVQAVANSGKTVIPLIESARGLVALNEIASVPGVERLSYGGLDLSDDLGIEGNTGGAETVMDQCRYQLLVSSRAAGLLAPIDTVFPVFDDEDAVLSRARRARNMGFAGMLCIHPKQIPQVQAGFSPDPDQVAWARKVMEAARSGGAAFKVEGQMVDAPVIAMARTILERAS
>NZ_CP011929.1|WP_053115174.1|4267154_4268351_+|CoA-transferase
MAANKAPLPLEGVTVISLEQAIAAPLCTRQLAEQGARVVKVERLGTGDFARDYDTRVKGLSSHFVWVNRSKESLALNLKTAEGQEILHQLLADADVFVQNLAPGATARMGLSFSELSAQYTSLIVCDVSGYGEGGPYRNKKAYDLLIQSESGFLSVTGTPGTGGMAKAGCSVADIAAGMYASNAILSALLLRGRTGEGSHIDVSLLESLVEWMGYPMYYSFDGAQPPPRAGASHSTIYPYGPFPVGDGKTVMLGLQNDREWRVFCERVLERSELAGDARFSDNARRSANRDQLGALIGTIFSEMTLDEVLTRLDEAGIANASVNDMSQVWQHPQLAARDRWLEVATPVGPVPALKAPGLWFPEAVSAVPYLGEHSSLILEQLGYSRDKIDQLKSAGVI
>NZ_CP011929.1|WP_053115173.1|4265964_4267128_+|acyl-CoA/acyl-ACP-dehydrogenase
MTSPSLEKYEDIREGVRGLCAEFDAAYWRGVDERKAFPEEFVEAMTRAGWLAAMIPEEYGGSGLGVSEASVILEEVNLAGGNSGTVHGQMYNMFTLLRHGSEEQKQKYLPRIAAGELRLQSMAVTEPTTGTDTTKIKTTAVRQGDKYVVNGQKVWISRVQHSDLMILLARTTPLAEVKRKSEGMSIFIVDLHDAIGNGLIVQPIANMVNHETNELFFDNLEIPAENLIGEEGKGFRYILDGLNAERALIAAECIGDGRWFIDKARKYASEREVFGRPIGKNQGIQFPIAKAHINVEAADLMRWRACEEYDTGRNAGASANMAKYLAAESSWEAANVCLQTHGGFGFANEYDVERKFRETRLYQVAPISTNLILSYVAEHLLELPRSF
>NZ_CP011929.1|WP_053115172.1|4265127_4265964_+|hypothetical-protein
MMLSSPEDWIGKQESCEDRLDPSHACRIAAMLDRPFPQEGDALAALWHWAFFQIPVPPAATGQDGHIAPGGFLPKSEGNTRMWAGGRVNFHQPLAIGQSAERQSRIEAVNEKNGRSGKLLFVTVAHEYHQNGELCLSEEQDIVYRAPSAPRLSLDKPVSEPQWSQSVTPSPLLLFRYSAVTFNGHRIHYDHPYTTKEEGYPDLVVQGPLIATLMVQAFVDANPDLKPVRLSYRGLRPLTVNKPFRVEGRIDGDGTALLWAANEDGPAHEAELQFEEKK
>NZ_CP011929.1|WP_053115171.1|4264055_4264964_-|LysR-family-transcriptional-regulator
MHFDIPDLRLFIHVAEANSLTGGARRASLSTAAASMRIKSLEGQLGSRLFYRDSQGVELTPAGHDLLVHARAIMRQVDYIKDEFSQYAEGKSGHLRIFANTTAVSDFMPDVLARFLVNRPGVTIDLQERLTHDIIRGVVDGSTDLGVVAGPVNANKKLDIIPFSVDRLVVVAPKGHELATRQTLSFRETLEYPHIGLREGSTLFNFLKDQASETGSILQMRIQVFGFESACRMVSRGVGIGILPRSIARRYADFLDIVTIDLEDDWAERERSLIVRELDALPRCGKELVEEIRSLASLSLTD
>NZ_CP011929.1|WP_041335779.1|4277132_4277423_+|hypothetical-protein
MFTAKEKLFIRNSELHARWRAAMLSVNASSMAPTSVALWELLINGDLLRLAIYLVLTTVIVSLNIICAGKIAHYKQSVERIRMRLDHPPNRSERLE
>NZ_CP011929.1|WP_157807853.1|4277463_4277601_+|hypothetical-protein
MELSMLIFMTCFAAVVVSSVLIAAHIDSKNEQLLIAEVEREEKNL
>NZ_CP011929.1|WP_053115181.1|4277891_4278128_+|hypothetical-protein
MNRSEHDANRHLSHFVNHVDEIIQQAIEKADKGRFVVATSEAGNVLLLPHFNASLRQDLTWVYDTEFGYVFSPEKRSA
>NZ_CP011929.1|WP_053115182.1|4278127_4278469_+|hypothetical-protein
MELVLGLSAILVLMFGGRILLFLVDLGFETGDRFLAACERRLTLYTKALLRGMVFAIRWVFHRFYKPEPEQMTIRSIIDSPAELQHMRNQHLLQSGKRAPVEIEYSQPKLKRE
>NZ_CP011929.1|WP_075267723.1|4278471_4278936_+|single-stranded-DNA-binding-protein
MLNKAQLIGRLGQKDVRSTPNGMQVVSYSIATTKSLKDRETGEWKENTEWHRCVSFNKTAEHIGMNVEPGDLLFLEGELRTRKWQTQSGEDRYTTEIVVNDFPRKLPKYFSKNGSQQAAPTPQPQHQAHASPSQPGHLEQPPVEAYGFDDDYPF
>NZ_CP011929.1|WP_053115183.1|4278963_4279209_+|hypothetical-protein
MGLLPLTGEPHLLHGDDIMGFSRKEVYYWLETASNEQLQAHLRNSQEMLVLLTDREQIKSLKWLRSRIIEEINARKEAKQP
>NZ_CP011929.1|WP_053115184.1|4279195_4279516_-|hypothetical-protein
MQTNHYIVDDEGNFRFTSVGLEEEGPLLARAGIDPTSIKTYEAYIQARKTAGPYFMDYLRDETDRMLEGKPDTVEWQAIRSIAFGSDEEQKALIEKMKRKRSFKAV
>NZ_CP011929.1|WP_053115185.1|4279573_4280530_+|recombinase-RecT
MNQAPQAVQPAQWHQIIESSKDKFNSSSLDFKQEQIFATQQLMNNSYLLDVAKKNLSSLRLAMYNVAAVGLTLNPNQGLAFLVPRRLRRNEDAKVMLDISYRGLIAIGVETGAIRWAKAELVYEKDQFSYKGPAEKPDHVCDPFSTDRGSIRGGYCIAELPSGGVLVEAMSKADMDKIRDVSEAFKKGFGPWVDWAEQMMLKSIVKRASKWWPISNPRMAQALRILNEENGEGLAILANQHKPVTPSALPAPPPREELSAQLLNTVKNLVDRAKNQNAFEACKEVMVERIKDPSELAYALDELDKAKAQPVPSSAVNQ
>NZ_CP011929.1|WP_053115579.1|4280634_4280898_+|hypothetical-protein
MFYFDSLEKIRDYDSFRVKAVYLSHSEPQRNDTRPNFYSVIGHLRPGVQFQYPEFPVADFPCESYARMFAELCEQYIKDFPAMSQTA
>NZ_CP011929.1|WP_053115186.1|4280969_4281974_+|endonuclease
MPKMTVVDLNQRSEEWLKWRALGITATDIPVILGLSPYKTPWQLWAEKIGRINPPDLSGNPNIQRGVALEDKARQLAESRYGEFLLPMCGECAKWDVLRASFDGVDTQDQPYEFKAPSKTVWDDLEANGVESTAFKLYEAQVQAQLTVAGQSIGRLIFYREDGADQDFEIRLTPERENQIIEAAKHFWQLVQTEQPPELDPDRDWFIPESGTEKFKWEAHAEAWRMQQEQIKSLKDKLKALEKDQKDVQKALINLMGPFRHADVGGVKVTRFEKSGSVDYLKYLQDNFPDLDLSTELENYRKPSREEVRFTRSEDELVNRDMGEVITPVKAAYF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP011929_1	1.1\|4276266\|32\|NZ_CP011929\|CRISPRCasFinder	4276266-4276297	32	NZ_CP020899	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence	365101-365132	8	0.75
NZ_CP011929_1	1.1\|4276266\|32\|NZ_CP011929\|CRISPRCasFinder	4276266-4276297	32	NZ_CP013525	Rhizobium phaseoli strain R744 plasmid pRphaR744c, complete sequence	334504-334535	8	0.75
NZ_CP011929_1	1.1\|4276266\|32\|NZ_CP011929\|CRISPRCasFinder	4276266-4276297	32	NZ_CP013554	Rhizobium phaseoli strain N931 plasmid pRphaN931b, complete sequence	359053-359084	8	0.75
NZ_CP011929_1	1.1\|4276266\|32\|NZ_CP011929\|CRISPRCasFinder	4276266-4276297	32	NZ_CP020951	Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence	403866-403897	8	0.75
NZ_CP011929_1	1.1\|4276266\|32\|NZ_CP011929\|CRISPRCasFinder	4276266-4276297	32	NZ_CP013588	Rhizobium phaseoli strain N161 plasmid pRphaN161c, complete sequence	334215-334246	8	0.75
NZ_CP011929_1	1.1\|4276266\|32\|NZ_CP011929\|CRISPRCasFinder	4276266-4276297	32	NZ_CP013560	Rhizobium phaseoli strain N841 plasmid pRphaN841c, complete sequence	336490-336521	8	0.75
NZ_CP011929_1	1.1\|4276266\|32\|NZ_CP011929\|CRISPRCasFinder	4276266-4276297	32	NZ_CP013577	Rhizobium phaseoli strain N671 plasmid pRphaN671c, complete sequence	338362-338393	8	0.75
NZ_CP011929_1	1.1\|4276266\|32\|NZ_CP011929\|CRISPRCasFinder	4276266-4276297	32	NZ_CP013549	Rhizobium phaseoli strain R611 plasmid pRetR611b, complete sequence	338732-338763	8	0.75
NZ_CP011929_1	1.1\|4276266\|32\|NZ_CP011929\|CRISPRCasFinder	4276266-4276297	32	NZ_CP013534	Rhizobium phaseoli strain R650 plasmid pRphaR650b, complete sequence	338732-338763	8	0.75
NZ_CP011929_1	1.1\|4276266\|32\|NZ_CP011929\|CRISPRCasFinder	4276266-4276297	32	NZ_CP013539	Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence	344014-344045	8	0.75
NZ_CP011929_1	1.1\|4276266\|32\|NZ_CP011929\|CRISPRCasFinder	4276266-4276297	32	NZ_CP013545	Rhizobium phaseoli strain R620 plasmid pRphaR620c, complete sequence	338724-338755	8	0.75
NZ_CP011929_1	1.1\|4276266\|32\|NZ_CP011929\|CRISPRCasFinder	4276266-4276297	32	NZ_CP013565	Rhizobium phaseoli strain N831 plasmid pRphaN831b, complete sequence	359053-359084	8	0.75
NZ_CP011929_1	1.1\|4276266\|32\|NZ_CP011929\|CRISPRCasFinder	4276266-4276297	32	NZ_CP013571	Rhizobium phaseoli strain N771 plasmid pRphaN771c, complete sequence	338362-338393	8	0.75
NZ_CP011929_1	1.1\|4276266\|32\|NZ_CP011929\|CRISPRCasFinder	4276266-4276297	32	NZ_CP054029	Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence	204310-204341	8	0.75
NZ_CP011929_1	1.1\|4276266\|32\|NZ_CP011929\|CRISPRCasFinder	4276266-4276297	32	NC_010998	Rhizobium etli CIAT 652 plasmid pA, complete sequence	341067-341098	8	0.75
NZ_CP011929_1	1.1\|4276266\|32\|NZ_CP011929\|CRISPRCasFinder	4276266-4276297	32	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	153169-153200	9	0.719
NZ_CP011929_1	1.1\|4276266\|32\|NZ_CP011929\|CRISPRCasFinder	4276266-4276297	32	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	153169-153200	9	0.719
NZ_CP011929_1	1.1\|4276266\|32\|NZ_CP011929\|CRISPRCasFinder	4276266-4276297	32	MT366580	Vibrio phage HY01, complete genome	29975-30006	9	0.719

1. spacer 1.1|4276266|32|NZ_CP011929|CRISPRCasFinder matches to NZ_CP020899 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5c, complete sequence) position: , mismatch: 8, identity: 0.75

atcaatcggcaacaccacctaccacaacttcg	CRISPR spacer
gacgatcggcaacacctccttccacaagctct	Protospacer
. *.************ *** ****** .**

2. spacer 1.1|4276266|32|NZ_CP011929|CRISPRCasFinder matches to NZ_CP013525 (Rhizobium phaseoli strain R744 plasmid pRphaR744c, complete sequence) position: , mismatch: 8, identity: 0.75

atcaatcggcaacaccacctaccacaacttcg	CRISPR spacer
gacgatcggcaacacctccttccacaagctct	Protospacer
. *.************ *** ****** .**

3. spacer 1.1|4276266|32|NZ_CP011929|CRISPRCasFinder matches to NZ_CP013554 (Rhizobium phaseoli strain N931 plasmid pRphaN931b, complete sequence) position: , mismatch: 8, identity: 0.75

atcaatcggcaacaccacctaccacaacttcg	CRISPR spacer
gacgatcggcaacacctccttccacaagctct	Protospacer
. *.************ *** ****** .**

4. spacer 1.1|4276266|32|NZ_CP011929|CRISPRCasFinder matches to NZ_CP020951 (Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence) position: , mismatch: 8, identity: 0.75

atcaatcggcaacaccacctaccacaacttcg	CRISPR spacer
gacgatcggcaacacctccttccacaagctct	Protospacer
. *.************ *** ****** .**

5. spacer 1.1|4276266|32|NZ_CP011929|CRISPRCasFinder matches to NZ_CP013588 (Rhizobium phaseoli strain N161 plasmid pRphaN161c, complete sequence) position: , mismatch: 8, identity: 0.75

atcaatcggcaacaccacctaccacaacttcg	CRISPR spacer
gacgatcggcaacacctccttccacaagctct	Protospacer
. *.************ *** ****** .**

6. spacer 1.1|4276266|32|NZ_CP011929|CRISPRCasFinder matches to NZ_CP013560 (Rhizobium phaseoli strain N841 plasmid pRphaN841c, complete sequence) position: , mismatch: 8, identity: 0.75

atcaatcggcaacaccacctaccacaacttcg	CRISPR spacer
gacgatcggcaacacctccttccacaagctct	Protospacer
. *.************ *** ****** .**

7. spacer 1.1|4276266|32|NZ_CP011929|CRISPRCasFinder matches to NZ_CP013577 (Rhizobium phaseoli strain N671 plasmid pRphaN671c, complete sequence) position: , mismatch: 8, identity: 0.75

atcaatcggcaacaccacctaccacaacttcg	CRISPR spacer
gacgatcggcaacacctccttccacaagctct	Protospacer
. *.************ *** ****** .**

8. spacer 1.1|4276266|32|NZ_CP011929|CRISPRCasFinder matches to NZ_CP013549 (Rhizobium phaseoli strain R611 plasmid pRetR611b, complete sequence) position: , mismatch: 8, identity: 0.75

atcaatcggcaacaccacctaccacaacttcg	CRISPR spacer
gacgatcggcaacacctccttccacaagctct	Protospacer
. *.************ *** ****** .**

9. spacer 1.1|4276266|32|NZ_CP011929|CRISPRCasFinder matches to NZ_CP013534 (Rhizobium phaseoli strain R650 plasmid pRphaR650b, complete sequence) position: , mismatch: 8, identity: 0.75

atcaatcggcaacaccacctaccacaacttcg	CRISPR spacer
gacgatcggcaacacctccttccacaagctct	Protospacer
. *.************ *** ****** .**

10. spacer 1.1|4276266|32|NZ_CP011929|CRISPRCasFinder matches to NZ_CP013539 (Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence) position: , mismatch: 8, identity: 0.75

atcaatcggcaacaccacctaccacaacttcg	CRISPR spacer
gacgatcggcaacacctccttccacaagctct	Protospacer
. *.************ *** ****** .**

11. spacer 1.1|4276266|32|NZ_CP011929|CRISPRCasFinder matches to NZ_CP013545 (Rhizobium phaseoli strain R620 plasmid pRphaR620c, complete sequence) position: , mismatch: 8, identity: 0.75

atcaatcggcaacaccacctaccacaacttcg	CRISPR spacer
gacgatcggcaacacctccttccacaagctct	Protospacer
. *.************ *** ****** .**

12. spacer 1.1|4276266|32|NZ_CP011929|CRISPRCasFinder matches to NZ_CP013565 (Rhizobium phaseoli strain N831 plasmid pRphaN831b, complete sequence) position: , mismatch: 8, identity: 0.75

atcaatcggcaacaccacctaccacaacttcg	CRISPR spacer
gacgatcggcaacacctccttccacaagctct	Protospacer
. *.************ *** ****** .**

13. spacer 1.1|4276266|32|NZ_CP011929|CRISPRCasFinder matches to NZ_CP013571 (Rhizobium phaseoli strain N771 plasmid pRphaN771c, complete sequence) position: , mismatch: 8, identity: 0.75

atcaatcggcaacaccacctaccacaacttcg	CRISPR spacer
gacgatcggcaacacctccttccacaagctct	Protospacer
. *.************ *** ****** .**

14. spacer 1.1|4276266|32|NZ_CP011929|CRISPRCasFinder matches to NZ_CP054029 (Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence) position: , mismatch: 8, identity: 0.75

atcaatcggcaacaccacctaccacaacttcg	CRISPR spacer
gacgatcggcaacacctccttccacaagctct	Protospacer
. *.************ *** ****** .**

15. spacer 1.1|4276266|32|NZ_CP011929|CRISPRCasFinder matches to NC_010998 (Rhizobium etli CIAT 652 plasmid pA, complete sequence) position: , mismatch: 8, identity: 0.75

atcaatcggcaacaccacctaccacaacttcg	CRISPR spacer
gacgatcggcaacacctccttccacaagctct	Protospacer
. *.************ *** ****** .**

16. spacer 1.1|4276266|32|NZ_CP011929|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 9, identity: 0.719

atcaatcggcaacaccacctaccacaacttcg	CRISPR spacer
gaccatcggcaacacctccttccacaagctgt	Protospacer
. * ************ *** ****** .*

17. spacer 1.1|4276266|32|NZ_CP011929|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 9, identity: 0.719

atcaatcggcaacaccacctaccacaacttcg	CRISPR spacer
gaccatcggcaacacctccttccacaagctgt	Protospacer
. * ************ *** ****** .*

18. spacer 1.1|4276266|32|NZ_CP011929|CRISPRCasFinder matches to MT366580 (Vibrio phage HY01, complete genome) position: , mismatch: 9, identity: 0.719

atcaatcggcaacaccacctaccacaacttcg	CRISPR spacer
aggcatcggcaaaaccaccgaccacaaaaaca	Protospacer
*   ******** ****** *******   *.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

76053 : 88725

Hokovirus(25.0%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053112189.1\|76053_77862_-\|tRNA	aspartate--tRNA ligase	A0A1V0SFI4	Hokovirus	1.2e-14	26.8
WP_008169141.1\|78070_78688_+	HTH-type transcriptional repressor FabR	NA	NA	NA	NA
WP_094182508.1\|78701_79142_-	HIT family protein	NA	NA	NA	NA
WP_053112193.1\|79159_80503_-	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	1.3e-77	37.6
WP_053112195.1\|80533_81529_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	3.0e-55	38.0
WP_014577399.1\|81538_82042_-\|tRNA	tRNA adenosine(34) deaminase TadA	A0A0B5J096	Pandoravirus	5.8e-07	44.0
WP_053112197.1\|82062_83640_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	9.4e-19	31.4
WP_008169151.1\|83702_85166_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	2.0e-92	40.1
WP_053112199.1\|85358_86747_+	exodeoxyribonuclease VII large subunit	M1NLU2	Moumouvirus	2.2e-27	39.2
WP_053112201.1\|86850_88725_+	propionyl-CoA synthetase	A0A2H4PQU7	Staphylococcus_phage	1.9e-66	34.9

DBSCAN-SWA_2

1116002 : 1168102

Acidithiobacillus_phage(15.38%)

tRNA,integrase,transposase

attL 1144998:1145013|attR 1169736:1169751

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053112987.1\|1116002_1117322_+\|tRNA	tRNA 5-hydroxyuridine modification protein YegQ	Q6DW11	Phage_TP	9.6e-118	60.9
WP_008169346.1\|1117798_1119247_+	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_008169344.1\|1119454_1120228_+	Fe-S cluster assembly ATPase SufC	A0A2R8FG22	Brazilian_cedratvirus	1.0e-10	28.1
WP_053112988.1\|1120240_1121527_+	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_008169340.1\|1121533_1122787_+	cysteine desulfurase	Q2XUY6	environmental_halophage	6.2e-98	43.4
WP_008169339.1\|1122800_1123154_+	iron-sulfur cluster assembly accessory protein	NA	NA	NA	NA
WP_008169336.1\|1123193_1123736_+	putative Fe-S cluster assembly protein SufT	NA	NA	NA	NA
WP_008169334.1\|1123736_1124207_+	SufE family protein	NA	NA	NA	NA
WP_053112989.1\|1124219_1125425_-	hypothetical protein	NA	NA	NA	NA
WP_053112990.1\|1125461_1126010_-	hypothetical protein	NA	NA	NA	NA
WP_053112991.1\|1126257_1127559_+	conjugal transfer protein TraF	NA	NA	NA	NA
WP_053112992.1\|1127694_1128816_+\|tRNA	tRNA nucleotidyltransferase	A0A292GDU1	Xanthomonas_phage	8.1e-57	41.1
WP_053112993.1\|1128825_1129572_+	pteridine reductase	NA	NA	NA	NA
WP_053112994.1\|1129697_1130876_+	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
WP_008169325.1\|1130881_1131346_+\|tRNA	tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL	NA	NA	NA	NA
WP_008169324.1\|1131395_1131899_-	protein-export chaperone SecB	NA	NA	NA	NA
WP_008169323.1\|1132043_1132460_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_008169322.1\|1132607_1134155_+	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
WP_014578244.1\|1134175_1135309_+	peptidoglycan DD-metalloendopeptidase family protein	NA	NA	NA	NA
WP_008169320.1\|1135406_1136813_+	S41 family peptidase	A0A0R6PIZ1	Moraxella_phage	2.3e-29	28.2
WP_008169319.1\|1136809_1137625_+	divergent polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_008169318.1\|1137621_1138395_-	imidazole glycerol phosphate synthase subunit HisF	NA	NA	NA	NA
WP_008169315.1\|1138404_1139142_-	1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase	NA	NA	NA	NA
WP_053115467.1\|1139135_1139777_-	imidazole glycerol phosphate synthase subunit HisH	NA	NA	NA	NA
WP_007153401.1\|1139848_1140442_-	imidazoleglycerol-phosphate dehydratase HisB	NA	NA	NA	NA
WP_008169307.1\|1140580_1141042_-	SRPBCC family protein	NA	NA	NA	NA
WP_053112995.1\|1141235_1143401_+	AsmA family protein	NA	NA	NA	NA
WP_008169303.1\|1143400_1144468_+	A/G-specific adenine glycosylase	NA	NA	NA	NA
WP_008169302.1\|1144543_1144816_+	oxidative damage protection protein	NA	NA	NA	NA
1144998:1145013	attL	NA	NA	NA	NA
WP_053112996.1\|1145454_1146195_-	ATP-binding protein	U5N3V8	Enterobacteria_phage	2.2e-42	40.3
WP_082220543.1\|1146181_1147687_-\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	3.2e-24	31.0
WP_053112998.1\|1148045_1148336_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A2H4JBF4	uncultured_Caudovirales_phage	2.9e-19	56.0
WP_053112999.1\|1148325_1148574_-	plasmid stabilization protein	NA	NA	NA	NA
WP_053113000.1\|1149197_1149611_-	hypothetical protein	NA	NA	NA	NA
WP_053113001.1\|1149739_1150138_-	GFA family protein	NA	NA	NA	NA
WP_041336316.1\|1151215_1152517_+\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_053113002.1\|1153168_1153519_-	hypothetical protein	NA	NA	NA	NA
WP_053113004.1\|1154015_1155341_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	8.4e-29	31.0
WP_053113005.1\|1155837_1156380_-	diguanylate cyclase	NA	NA	NA	NA
WP_053113006.1\|1156488_1156806_-	hypothetical protein	NA	NA	NA	NA
WP_053113007.1\|1157607_1158576_+\|integrase	integron integrase	A0A1P8DJJ6	Virus_Rctr41k	1.3e-55	37.9
WP_158499456.1\|1158694_1158892_-	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_053115469.1\|1159140_1160664_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	7.1e-157	55.1
WP_053113009.1\|1160678_1161434_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	1.4e-76	59.6
WP_094182501.1\|1161922_1163064_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	4.2e-45	40.7
WP_075267589.1\|1163812_1163983_-	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_053113012.1\|1164098_1166369_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_053113013.1\|1166361_1166580_-	hypothetical protein	NA	NA	NA	NA
WP_075267591.1\|1166628_1166781_-	hypothetical protein	NA	NA	NA	NA
WP_053113014.1\|1167049_1168102_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
1169736:1169751	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1225092 : 1293706

Cafeteria_roenbergensis_virus(13.33%)

tRNA,protease,transposase,integrase

attL 1227733:1227750|attR 1296668:1296685

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053113039.1\|1225092_1226034_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_008171536.1\|1226030_1226453_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_053113040.1\|1226478_1229022_-	translation initiation factor IF-2	E3T4N3	Cafeteria_roenbergensis_virus	2.5e-21	24.2
1227733:1227750	attL	NA	NA	NA	NA
WP_014578293.1\|1229040_1230534_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_008171533.1\|1230589_1231051_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_008171532.1\|1231463_1231844_-	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_075267595.1\|1231868_1232627_-	triose-phosphate isomerase	NA	NA	NA	NA
WP_008171529.1\|1232702_1234046_-	phosphoglucosamine mutase	NA	NA	NA	NA
WP_008171527.1\|1234045_1234876_-	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	1.1e-18	30.1
WP_014578296.1\|1234972_1236907_-\|protease	ATP-dependent zinc metalloprotease FtsH	M4QMW8	Micromonas_pusilla_virus	3.8e-115	48.4
WP_008171523.1\|1237302_1237614_+	ribosome assembly RNA-binding protein YhbY	NA	NA	NA	NA
WP_075267597.1\|1237690_1238170_-	transcription elongation factor GreA	NA	NA	NA	NA
WP_053113042.1\|1238174_1241393_-	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
WP_039881889.1\|1241473_1242619_-	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	1.7e-49	34.3
WP_053113043.1\|1242798_1243599_-	4-hydroxy-tetrahydrodipicolinate reductase	NA	NA	NA	NA
WP_014578300.1\|1243625_1244753_-	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	5.5e-29	34.3
WP_014578301.1\|1244831_1246757_-	molecular chaperone DnaK	G8DDB7	Micromonas_pusilla_virus	1.8e-149	53.2
WP_008171515.1\|1246849_1247449_-	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_053115472.1\|1247704_1249384_+	DNA repair protein RecN	NA	NA	NA	NA
WP_008171512.1\|1249488_1249899_-	ferric iron uptake transcriptional regulator	NA	NA	NA	NA
WP_053113044.1\|1250021_1250348_+	outer membrane protein assembly factor BamE	NA	NA	NA	NA
WP_082220612.1\|1250341_1250629_-	RnfH family protein	NA	NA	NA	NA
WP_008171509.1\|1250628_1251075_-	type II toxin-antitoxin system RatA family toxin	NA	NA	NA	NA
WP_053113046.1\|1251147_1252773_-	sodium-dependent transporter	NA	NA	NA	NA
WP_008171507.1\|1252973_1253453_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	1.3e-24	41.8
WP_053113047.1\|1253593_1255012_+	wax ester/triacylglycerol synthase family O-acyltransferase	NA	NA	NA	NA
WP_053113048.1\|1255646_1256879_+\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	1.5e-93	45.5
WP_053113049.1\|1256910_1257129_+	hypothetical protein	NA	NA	NA	NA
WP_053113050.1\|1257144_1257759_+	hypothetical protein	NA	NA	NA	NA
WP_053113051.1\|1257826_1258096_+	hypothetical protein	NA	NA	NA	NA
WP_141201818.1\|1258097_1258298_-	hypothetical protein	NA	NA	NA	NA
WP_141201818.1\|1258871_1259072_-	hypothetical protein	NA	NA	NA	NA
WP_053113053.1\|1259260_1259461_+	AlpA family transcriptional regulator	NA	NA	NA	NA
WP_053113054.1\|1259453_1259858_+	hypothetical protein	NA	NA	NA	NA
WP_053113055.1\|1259850_1260771_+	hypothetical protein	A0A1B0VML8	Pseudomonas_phage	3.8e-52	43.4
WP_158499457.1\|1260947_1262246_+	DUF3987 domain-containing protein	NA	NA	NA	NA
WP_144422718.1\|1267360_1267717_-	hypothetical protein	NA	NA	NA	NA
WP_053113063.1\|1268305_1268893_-	toll/interleukin-1 receptor domain-containing protein	NA	NA	NA	NA
WP_144422719.1\|1268902_1270330_-	hypothetical protein	NA	NA	NA	NA
WP_158499458.1\|1270326_1270680_-	hypothetical protein	NA	NA	NA	NA
WP_053113065.1\|1271212_1271761_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_053113066.1\|1271805_1272444_-	hypothetical protein	NA	NA	NA	NA
WP_053115474.1\|1272468_1273683_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	7.9e-50	49.5
WP_053113067.1\|1273709_1274243_-	transcriptional regulator	NA	NA	NA	NA
WP_053113068.1\|1274242_1277443_-	type I restriction endonuclease subunit R	NA	NA	NA	NA
WP_053113069.1\|1277467_1279312_-	DUF262 domain-containing protein	NA	NA	NA	NA
WP_053113070.1\|1279308_1280094_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_053113071.1\|1280299_1281616_+\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_053113073.1\|1282200_1284198_-	type I restriction-modification system subunit M	A0A220A2U5	Liberibacter_phage	5.9e-26	26.5
WP_026948197.1\|1284228_1284468_-	hypothetical protein	NA	NA	NA	NA
WP_075267610.1\|1284563_1285511_-	hypothetical protein	NA	NA	NA	NA
WP_053113075.1\|1286274_1287006_+	hypothetical protein	NA	NA	NA	NA
WP_053113076.1\|1287007_1287574_+	hypothetical protein	NA	NA	NA	NA
WP_085986445.1\|1287960_1289113_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	5.6e-53	46.2
WP_008173682.1\|1289741_1291292_+	hypothetical protein	A0A2H4J5Y0	uncultured_Caudovirales_phage	2.5e-24	28.7
WP_053113077.1\|1291585_1292326_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	1.2e-56	49.4
WP_053113078.1\|1292335_1293706_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	9.1e-95	38.7
1296668:1296685	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1612931 : 1689469

Bacillus_phage(27.27%)

tRNA,protease,plate,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008173009.1\|1612931_1613660_+\|tRNA	tRNA/rRNA methyltransferase	NA	NA	NA	NA
WP_053115489.1\|1613785_1615057_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_053113222.1\|1615074_1615908_-	polyphosphate kinase	NA	NA	NA	NA
WP_053113223.1\|1616037_1616847_+	TatD family hydrolase	NA	NA	NA	NA
WP_053113224.1\|1616843_1618052_+	HD-GYP domain-containing protein	NA	NA	NA	NA
WP_053113225.1\|1618103_1620383_-	PhnD/SsuA/transferrin family substrate-binding protein	G3MA91	Bacillus_virus	1.7e-21	32.7
WP_053113226.1\|1620379_1621339_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_014578602.1\|1621442_1622351_-	lysine exporter LysO family protein	NA	NA	NA	NA
WP_053113227.1\|1622378_1622747_-	hypothetical protein	NA	NA	NA	NA
WP_053113228.1\|1622759_1623080_-	DUF2288 domain-containing protein	NA	NA	NA	NA
WP_053113229.1\|1623175_1623577_-	response regulator	W8CYM9	Bacillus_phage	1.1e-08	30.2
WP_082220616.1\|1623581_1624730_-	response regulator	NA	NA	NA	NA
WP_053113230.1\|1624746_1626456_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.5e-17	32.7
WP_053113231.1\|1626563_1628357_+	HAMP domain-containing protein	A0A1V0SGX0	Hokovirus	5.1e-21	32.3
WP_082220617.1\|1628400_1630407_+	GAF domain-containing protein	A0A1V0SGX0	Hokovirus	2.4e-19	32.8
WP_008173036.1\|1630447_1630987_-	bacterioferritin	NA	NA	NA	NA
WP_053113232.1\|1631065_1633825_-	aconitate hydratase AcnA	NA	NA	NA	NA
WP_053113233.1\|1634085_1635606_-	chemotaxis protein	NA	NA	NA	NA
WP_053115492.1\|1635602_1636124_-	SCO family protein	NA	NA	NA	NA
WP_053113234.1\|1636359_1638183_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.9e-32	24.9
WP_053113235.1\|1638327_1639782_+	hypothetical protein	NA	NA	NA	NA
WP_053113236.1\|1639902_1641351_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_014578618.1\|1641673_1642114_+	OmpA family protein	NA	NA	NA	NA
WP_053113237.1\|1642421_1643075_+	DUF2202 domain-containing protein	NA	NA	NA	NA
WP_041645712.1\|1643140_1643542_-	glutathione metabolism protein	NA	NA	NA	NA
WP_008175780.1\|1643544_1643787_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_053113238.1\|1643882_1644581_-	1-acylglycerol-3-phosphate O-acyltransferase	NA	NA	NA	NA
WP_053113239.1\|1644629_1645220_-	class GN sortase	NA	NA	NA	NA
WP_053113240.1\|1645216_1647331_-	marine proteobacterial sortase target protein	A0A2K9L4P5	Tupanvirus	5.8e-16	24.1
WP_014578623.1\|1647524_1648226_+	proteobacterial dedicated sortase system response regulator	NA	NA	NA	NA
WP_053113241.1\|1648229_1650260_+	histidine kinase	NA	NA	NA	NA
WP_053113242.1\|1650278_1651586_+	DUF3422 domain-containing protein	NA	NA	NA	NA
WP_053113243.1\|1651586_1652378_-	ATP-binding protein	NA	NA	NA	NA
WP_008175765.1\|1652461_1652905_+	methylglyoxal synthase	NA	NA	NA	NA
WP_053113244.1\|1655939_1656911_+	cysteine synthase A	A0A1X9I5F1	Streptococcus_phage	5.1e-68	47.4
WP_053113245.1\|1656949_1657528_-	porin family protein	NA	NA	NA	NA
WP_008175757.1\|1657694_1658048_-	hypothetical protein	NA	NA	NA	NA
WP_053113246.1\|1658389_1659271_-	hypothetical protein	NA	NA	NA	NA
WP_039882122.1\|1659236_1660292_-	hypothetical protein	NA	NA	NA	NA
WP_053113247.1\|1660456_1661722_-	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
WP_008175748.1\|1661822_1662080_-	YdcH family protein	NA	NA	NA	NA
WP_053113248.1\|1662195_1663050_-	DNA ligase	F2Y2Y2	Organic_Lake_phycodnavirus	1.1e-34	34.9
WP_008175744.1\|1663127_1663556_-	DUF4124 domain-containing protein	NA	NA	NA	NA
WP_053113249.1\|1663597_1664473_-	hypothetical protein	NA	NA	NA	NA
WP_053113251.1\|1665211_1666570_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_008175739.1\|1668901_1669768_-	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_053113252.1\|1669767_1671846_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	5.7e-32	26.5
WP_053113253.1\|1671963_1675557_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_053113254.1\|1675589_1677026_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_100169515.1\|1677060_1677693_-	type VI secretion system-associated protein TagO	NA	NA	NA	NA
WP_053115493.1\|1677704_1679276_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_008175725.1\|1679454_1682088_-	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	2.1e-95	30.3
WP_008175723.1\|1682098_1682926_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_053113255.1\|1682929_1684264_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_008175720.1\|1684263_1684797_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_008175718.1\|1684793_1686110_-	type VI secretion system-associated FHA domain protein TagH	NA	NA	NA	NA
WP_008175716.1\|1686130_1687147_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_008175714.1\|1687110_1688883_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_008175712.1\|1689028_1689469_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA

DBSCAN-SWA_5

2907124 : 2950946

Acidithiobacillus_phage(50.0%)

tRNA,protease,integrase,transposase

attL 2907474:2907491|attR 2949826:2949843

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008170810.1\|2907124_2907655_-\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
2907474:2907491	attL	NA	NA	NA	NA
WP_053114361.1\|2907745_2908384_-	SPOR domain-containing protein	NA	NA	NA	NA
WP_053114363.1\|2908389_2910075_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
WP_094182549.1\|2910206_2912381_-	primosomal protein N'	NA	NA	NA	NA
WP_008170804.1\|2912644_2912866_+	50S ribosomal protein L31	NA	NA	NA	NA
WP_053114367.1\|2913117_2914383_+	malate dehydrogenase	NA	NA	NA	NA
WP_053114369.1\|2914448_2916977_-	penicillin-binding protein 1A	NA	NA	NA	NA
WP_053114371.1\|2917172_2918234_+	pilus assembly protein PilM	NA	NA	NA	NA
WP_053114373.1\|2918233_2918797_+	PilN domain-containing protein	NA	NA	NA	NA
WP_008170795.1\|2918796_2919408_+	type 4a pilus biogenesis protein PilO	NA	NA	NA	NA
WP_008170793.1\|2919410_2919959_+	pilus assembly protein PilP	NA	NA	NA	NA
WP_053114375.1\|2919970_2922094_+	type IV pilus secretin PilQ	NA	NA	NA	NA
WP_008170790.1\|2922230_2922797_+	shikimate kinase AroK	NA	NA	NA	NA
WP_053114378.1\|2922789_2923884_+	3-dehydroquinate synthase	NA	NA	NA	NA
WP_053114380.1\|2923939_2925433_+	AAA family ATPase	NA	NA	NA	NA
WP_053114382.1\|2925644_2930093_+	glutamate synthase large subunit	NA	NA	NA	NA
WP_053114383.1\|2930165_2931584_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_008170779.1\|2931710_2932775_+	uroporphyrinogen decarboxylase	NA	NA	NA	NA
WP_008170777.1\|2933027_2933396_+	PilZ domain-containing protein	NA	NA	NA	NA
WP_053114385.1\|2933566_2934943_-	DNA repair protein RadA	NA	NA	NA	NA
WP_008172057.1\|2935115_2936150_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_053114387.1\|2936488_2938177_-	energy-dependent translational throttle protein EttA	A0A2K9L3Z8	Tupanvirus	4.2e-41	26.6
WP_053114389.1\|2938324_2939596_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_053114391.1\|2939592_2941182_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_053114393.1\|2941178_2943380_+	hypothetical protein	NA	NA	NA	NA
WP_053114395.1\|2943382_2943781_+	hypothetical protein	NA	NA	NA	NA
WP_053114397.1\|2944608_2946150_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	4.1e-144	50.4
WP_008170042.1\|2946161_2946917_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	4.7e-69	54.5
WP_053114399.1\|2947292_2949278_+	SAM-dependent DNA methyltransferase	A0A220A2U5	Liberibacter_phage	5.5e-32	25.6
WP_053114401.1\|2949274_2949499_+	hypothetical protein	NA	NA	NA	NA
WP_053114403.1\|2949644_2950946_-\|transposase	IS1380 family transposase	NA	NA	NA	NA
2949826:2949843	attR	NA	NA	NA	NA

DBSCAN-SWA_6

2956416 : 3007354

Acidithiobacillus_phage(16.67%)

integrase,transposase

attL 2949065:2949080|attR 3013442:3013457

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2949065:2949080	attL	NA	NA	NA	NA
WP_053115534.1\|2956416_2957940_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	1.9e-157	55.7
WP_011784510.1\|2957954_2958710_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	5.2e-76	58.8
WP_053114409.1\|2959109_2959928_+	phosphonate ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	6.4e-11	25.8
WP_026949876.1\|2959924_2960788_+	phosphate/phosphite/phosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_053114411.1\|2960798_2961629_+	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_053114412.1\|2961638_2962649_+	2-hydroxyacid dehydrogenase	A0A1M7XU89	Cedratvirus	1.4e-20	31.0
WP_011783503.1\|2962642_2963503_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_094182553.1\|2963417_2963909_-	reverse transcriptase	A0A0U4J920	Pseudomonas_phage	2.1e-09	41.0
WP_053112091.1\|2964295_2965621_+\|transposase	IS1182 family transposase	Q9MBP7	Staphylococcus_prophage	1.0e-13	24.1
WP_053114413.1\|2966243_2966543_-	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_053114414.1\|2968617_2969763_+	acyl-CoA/acyl-ACP dehydrogenase	NA	NA	NA	NA
WP_053114415.1\|2969801_2970590_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_053114417.1\|2970629_2971406_+	SDR family NAD(P)-dependent oxidoreductase	A0A0M4JSW6	Mollivirus	1.5e-06	23.8
WP_053114419.1\|2971498_2972560_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_053114421.1\|2972638_2974201_+	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	2.9e-28	27.0
WP_053114423.1\|2974283_2975522_+	thiolase family protein	NA	NA	NA	NA
WP_144422723.1\|2976873_2978124_+	hypothetical protein	NA	NA	NA	NA
WP_053114427.1\|2978125_2979646_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_053114429.1\|2979785_2980919_+	CoA transferase	NA	NA	NA	NA
WP_082220566.1\|2980954_2981125_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_053114431.1\|2981217_2981592_+\|transposase	transposase	A0A0P0ZBP6	Stx2-converting_phage	6.3e-06	32.1
WP_075267659.1\|2981588_2981771_+\|transposase	transposase	NA	NA	NA	NA
WP_082220567.1\|2981771_2981924_+	hypothetical protein	NA	NA	NA	NA
WP_053114433.1\|2981999_2983565_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.6e-124	49.4
WP_094182488.1\|2984354_2984585_+	ATP-binding protein	NA	NA	NA	NA
WP_053114437.1\|2984734_2985541_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.0e-13	28.8
WP_053114438.1\|2985537_2986260_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_053114441.1\|2986360_2987578_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_053114443.1\|2987682_2988570_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_053114444.1\|2988572_2989568_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_053114447.1\|2989985_2990771_+	hypothetical protein	NA	NA	NA	NA
WP_053114403.1\|2990862_2992164_+\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_053114449.1\|2992450_2992708_+	hypothetical protein	NA	NA	NA	NA
WP_053114452.1\|2994506_2995604_+	TRAP transporter substrate-binding protein	NA	NA	NA	NA
WP_053114454.1\|2995687_2996236_+	TRAP transporter small permease subunit	NA	NA	NA	NA
WP_053114456.1\|2996267_2997632_+	TRAP transporter large permease subunit	NA	NA	NA	NA
WP_053115536.1\|2999195_2999744_+	HNH endonuclease	A0A1S6L216	Vibrio_phage	4.4e-32	41.9
WP_053114458.1\|3000102_3000738_+	hypothetical protein	NA	NA	NA	NA
WP_141201891.1\|3000770_3001247_+	hypothetical protein	NA	NA	NA	NA
WP_053114465.1\|3001538_3002174_-	hypothetical protein	NA	NA	NA	NA
WP_053114467.1\|3002166_3005985_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_053114469.1\|3005974_3007354_-\|integrase	site-specific integrase	NA	NA	NA	NA
3013442:3013457	attR	NA	NA	NA	NA

DBSCAN-SWA_7

3634950 : 3702099

Stenotrophomonas_phage(15.38%)

integrase,protease,transposase

attL 3657605:3657625|attR 3702292:3702312

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053114838.1\|3634950_3636300_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_053114839.1\|3636344_3638663_+	outer membrane protein assembly factor BamA	NA	NA	NA	NA
WP_008170367.1\|3638708_3639206_+	OmpH family outer membrane protein	NA	NA	NA	NA
WP_014576637.1\|3639253_3640279_+	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
WP_008170365.1\|3640290_3640728_+	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_008170364.1\|3640727_3641519_+	acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase	NA	NA	NA	NA
WP_053114840.1\|3641537_3642719_+	lipid-A-disaccharide synthase	NA	NA	NA	NA
WP_053114841.1\|3642718_3643405_+	ribonuclease HII	R4THQ2	Phaeocystis_globosa_virus	2.4e-19	33.8
WP_075267683.1\|3644045_3644309_+	fibronectin type III domain-containing protein	NA	NA	NA	NA
WP_053114842.1\|3644340_3646908_-	CHASE2 domain-containing protein	NA	NA	NA	NA
WP_053114843.1\|3646941_3648579_-	peptidoglycan-binding protein LysM	NA	NA	NA	NA
WP_053114844.1\|3648571_3649306_-	response regulator transcription factor	NA	NA	NA	NA
WP_053115556.1\|3649417_3651601_-	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	4.1e-41	28.2
WP_008171407.1\|3651878_3652235_+	BolA/IbaG family iron-sulfur metabolism protein	NA	NA	NA	NA
WP_008171409.1\|3652231_3652855_+	threonylcarbamoyl-AMP synthase	NA	NA	NA	NA
WP_053114845.1\|3652876_3653542_-	hypothetical protein	NA	NA	NA	NA
WP_053114846.1\|3653826_3655452_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	5.8e-24	31.3
WP_053114847.1\|3655479_3656127_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_053114848.1\|3656163_3656742_-	DUF3365 domain-containing protein	NA	NA	NA	NA
WP_053114849.1\|3656839_3657514_-	hypothetical protein	NA	NA	NA	NA
3657605:3657625	attL	NA	NA	NA	NA
WP_053114850.1\|3657910_3658267_+	hypothetical protein	NA	NA	NA	NA
WP_053114851.1\|3658448_3659063_+	hypothetical protein	NA	NA	NA	NA
WP_141201889.1\|3659118_3659712_+	hypothetical protein	NA	NA	NA	NA
WP_053114853.1\|3659708_3660278_+	hypothetical protein	NA	NA	NA	NA
WP_053115557.1\|3661049_3661973_+	NAD-dependent epimerase/dehydratase family protein	A0A067XQ95	Caulobacter_phage	3.0e-09	25.5
WP_053114854.1\|3661972_3664324_+	glycosyltransferase	NA	NA	NA	NA
WP_075267685.1\|3664320_3665352_+	hypothetical protein	NA	NA	NA	NA
WP_053114856.1\|3665344_3667021_+	methyltransferase	NA	NA	NA	NA
WP_053114857.1\|3667017_3667695_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_053114858.1\|3667908_3668259_+	hypothetical protein	NA	NA	NA	NA
WP_053114859.1\|3668290_3669253_+	DUF932 domain-containing protein	A0A0H4INH5	Stenotrophomonas_phage	2.1e-61	43.2
WP_053114403.1\|3669414_3670716_-\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_053114860.1\|3670912_3671914_+	YqaJ viral recombinase family protein	A0A139ZPJ9	Marinitoga_camini_virus	2.0e-46	45.0
WP_053114861.1\|3671976_3672864_+	hypothetical protein	NA	NA	NA	NA
WP_053114862.1\|3673150_3673513_+	hypothetical protein	NA	NA	NA	NA
WP_053114863.1\|3673873_3674557_+	hypothetical protein	NA	NA	NA	NA
WP_053114864.1\|3674631_3675786_+	hypothetical protein	NA	NA	NA	NA
WP_053113920.1\|3675845_3677147_+\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_158499464.1\|3677242_3677401_+	hypothetical protein	NA	NA	NA	NA
WP_053114865.1\|3677387_3679163_+	ATP-binding protein	NA	NA	NA	NA
WP_053114866.1\|3679224_3682080_-	ATP-binding protein	NA	NA	NA	NA
WP_053113071.1\|3682778_3684095_+\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_053114868.1\|3684237_3686601_-	DUF1156 domain-containing protein	K9MDJ7	Sulfolobus_virus	1.6e-25	22.4
WP_053114869.1\|3686610_3687246_-	TIGR02646 family protein	NA	NA	NA	NA
WP_053114870.1\|3687247_3688612_-	AAA family ATPase	C7BGE8	Burkholderia_phage	8.4e-08	21.8
WP_053114871.1\|3688608_3692181_-	DUF3883 domain-containing protein	A0A1B1IUI1	uncultured_Mediterranean_phage	2.3e-52	28.7
WP_053115558.1\|3692193_3692382_-	helix-turn-helix domain-containing protein	A0A1B1IUF9	uncultured_Mediterranean_phage	3.0e-17	62.7
WP_053114872.1\|3692548_3693487_-	hypothetical protein	NA	NA	NA	NA
WP_053113251.1\|3693790_3695149_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_053114873.1\|3695148_3695823_-	molecular chaperone DnaJ	NA	NA	NA	NA
WP_053114875.1\|3696565_3696775_-	AlpA family transcriptional regulator	A0A1V0E8E5	Vibrio_phage	4.0e-10	49.2
WP_053114876.1\|3696952_3697864_-	protein rep	NA	NA	NA	NA
WP_082220624.1\|3698045_3698411_-	AlpA family phage regulatory protein	A0A1V0E8E5	Vibrio_phage	1.6e-06	41.2
WP_144422725.1\|3698630_3699947_-	hypothetical protein	NA	NA	NA	NA
WP_053114879.1\|3700126_3700903_+	hypothetical protein	NA	NA	NA	NA
WP_082220580.1\|3700872_3702099_-\|integrase	tyrosine-type recombinase/integrase	B7SYF8	Stenotrophomonas_phage	6.3e-87	45.7
3702292:3702312	attR	NA	NA	NA	NA

DBSCAN-SWA_8

4136036 : 4184435

Acidithiobacillus_phage(44.44%)

transposase,integrase

attL 4127014:4127028|attR 4160845:4160859

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4127014:4127028	attL	NA	NA	NA	NA
WP_141201856.1\|4136036_4136579_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_053113071.1\|4136758_4138075_+\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_141201850.1\|4138291_4138774_-	hypothetical protein	NA	NA	NA	NA
WP_053115083.1\|4139110_4140058_-	AEC family transporter	NA	NA	NA	NA
WP_053115084.1\|4140210_4142544_-	xanthine dehydrogenase family protein molybdopterin-binding subunit	NA	NA	NA	NA
WP_008174459.1\|4142540_4143002_-	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_014576954.1\|4143163_4143568_+	DUF1330 domain-containing protein	NA	NA	NA	NA
WP_053115085.1\|4143579_4143909_-	branched-chain amino acid transporter	NA	NA	NA	NA
WP_053115086.1\|4143901_4144606_-	AzlC family ABC transporter permease	NA	NA	NA	NA
WP_053115087.1\|4144774_4146394_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	7.1e-14	26.5
WP_008174466.1\|4146478_4146730_+	hypothetical protein	NA	NA	NA	NA
WP_008174467.1\|4146829_4147492_+	UvrY/SirA/GacA family response regulator transcription factor	NA	NA	NA	NA
WP_053115088.1\|4147475_4149338_+	excinuclease ABC subunit UvrC	NA	NA	NA	NA
WP_053115089.1\|4149345_4149924_+	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_141201851.1\|4149856_4150510_-	ABC transporter	NA	NA	NA	NA
WP_053115091.1\|4150506_4151445_-	MCE family protein	NA	NA	NA	NA
WP_053115092.1\|4151447_4152287_-	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	9.4e-10	31.1
WP_053115093.1\|4152283_4153450_-	ABC transporter permease	NA	NA	NA	NA
WP_008170042.1\|4154321_4155077_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	4.7e-69	54.5
WP_053114397.1\|4155088_4156630_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	4.1e-144	50.4
WP_141201828.1\|4156834_4157059_-	hypothetical protein	NA	NA	NA	NA
WP_141201829.1\|4157134_4157383_-	hypothetical protein	NA	NA	NA	NA
WP_094182505.1\|4157577_4158585_-	hypothetical protein	NA	NA	NA	NA
WP_141201830.1\|4158847_4159108_-	hypothetical protein	NA	NA	NA	NA
WP_053115096.1\|4159372_4160368_+	WYL domain-containing protein	NA	NA	NA	NA
WP_053115097.1\|4160479_4162591_+	ATP-binding protein	A0A0N9NKC6	Sulfolobales_Virus_YNP2	6.5e-07	28.2
4160845:4160859	attR	NA	NA	NA	NA
WP_082220625.1\|4162984_4163563_+	hypothetical protein	NA	NA	NA	NA
WP_053115098.1\|4163606_4164362_-	hypothetical protein	NA	NA	NA	NA
WP_082220587.1\|4165066_4165666_+	outer membrane beta-barrel protein	NA	NA	NA	NA
WP_141201831.1\|4165791_4166259_+	hypothetical protein	NA	NA	NA	NA
WP_053115102.1\|4166482_4169383_+	DEAD/DEAH box helicase	A0A1B1IUI1	uncultured_Mediterranean_phage	4.8e-29	29.5
WP_053115103.1\|4169414_4174394_+	class I SAM-dependent DNA methyltransferase	NA	NA	NA	NA
WP_144422727.1\|4174390_4175803_+	S1 RNA-binding domain-containing protein	NA	NA	NA	NA
WP_094182504.1\|4175938_4176439_+	hypothetical protein	NA	NA	NA	NA
WP_053115106.1\|4176450_4176942_+	hypothetical protein	NA	NA	NA	NA
WP_053115107.1\|4176954_4178274_+	hypothetical protein	NA	NA	NA	NA
WP_053115534.1\|4178459_4179983_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	1.9e-157	55.7
WP_011784510.1\|4179997_4180753_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	5.2e-76	58.8
WP_053115108.1\|4180739_4181486_+	hypothetical protein	NA	NA	NA	NA
WP_041336316.1\|4181632_4182934_-\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_053112091.1\|4183109_4184435_+\|transposase	IS1182 family transposase	Q9MBP7	Staphylococcus_prophage	1.0e-13	24.1

DBSCAN-SWA_9

4273957 : 4376698

Shigella_phage(20.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053113971.1\|4273957_4275283_-\|transposase	IS1182 family transposase	Q9MBP7	Staphylococcus_prophage	6.9e-15	24.6
WP_053115179.1\|4275467_4275719_+	hypothetical protein	NA	NA	NA	NA
WP_075267814.1\|4276068_4276416_+	hypothetical protein	NA	NA	NA	NA
WP_041335779.1\|4277132_4277423_+	hypothetical protein	NA	NA	NA	NA
WP_157807853.1\|4277463_4277601_+	hypothetical protein	NA	NA	NA	NA
WP_053115181.1\|4277891_4278128_+	hypothetical protein	NA	NA	NA	NA
WP_053115182.1\|4278127_4278469_+	hypothetical protein	NA	NA	NA	NA
WP_075267723.1\|4278471_4278936_+	single-stranded DNA-binding protein	A0A088FRR2	Escherichia_phage	9.8e-25	44.3
WP_053115183.1\|4278963_4279209_+	hypothetical protein	NA	NA	NA	NA
WP_053115184.1\|4279195_4279516_-	hypothetical protein	NA	NA	NA	NA
WP_053115185.1\|4279573_4280530_+	recombinase RecT	F1C5B8	Cronobacter_phage	1.4e-38	35.1
WP_053115579.1\|4280634_4280898_+	hypothetical protein	NA	NA	NA	NA
WP_053115186.1\|4280969_4281974_+	endonuclease	U6C712	Ralstonia_phage	1.0e-10	33.3
WP_053115187.1\|4282276_4283236_+	AAA domain-containing protein	J9Q733	Salmonella_phage	1.9e-22	31.4
WP_053115188.1\|4283238_4283979_+	hypothetical protein	NA	NA	NA	NA
WP_053115189.1\|4284069_4284984_+	DUF3150 domain-containing protein	NA	NA	NA	NA
WP_053115190.1\|4284994_4286767_+	VWA domain-containing protein	NA	NA	NA	NA
WP_158499469.1\|4287217_4287385_+	hypothetical protein	NA	NA	NA	NA
WP_082220595.1\|4287427_4288543_+	hypothetical protein	NA	NA	NA	NA
WP_053115193.1\|4288636_4288999_+	hypothetical protein	NA	NA	NA	NA
WP_041335747.1\|4289258_4289810_+	hypothetical protein	NA	NA	NA	NA
WP_041335744.1\|4290067_4290343_+	hypothetical protein	NA	NA	NA	NA
WP_041335742.1\|4290346_4290649_+	hypothetical protein	NA	NA	NA	NA
WP_041335738.1\|4290660_4291080_+	hypothetical protein	NA	NA	NA	NA
WP_053115194.1\|4291089_4291683_+	hypothetical protein	NA	NA	NA	NA
WP_041335736.1\|4291685_4292177_+	hypothetical protein	NA	NA	NA	NA
WP_041336848.1\|4292215_4293010_+	hypothetical protein	NA	NA	NA	NA
WP_052479582.1\|4293414_4293933_-	RES family NAD+ phosphorylase	NA	NA	NA	NA
WP_052479581.1\|4293929_4294463_-	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_053115195.1\|4294824_4295385_+	recombinase family protein	E5FFF9	Burkholderia_phage	6.0e-45	50.5
WP_075267727.1\|4295661_4296624_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.1e-41	34.1
WP_141201869.1\|4296643_4298848_+	adenine specific DNA methyltransferase	NA	NA	NA	NA
WP_094182537.1\|4298909_4300116_+\|transposase	IS3 family transposase	Q9ZXG3	Shigella_phage	3.0e-57	44.9
WP_141201868.1\|4300121_4300883_+	hypothetical protein	NA	NA	NA	NA
WP_144422721.1\|4300948_4302080_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	7.2e-21	31.1
WP_158499470.1\|4302134_4302533_+	hypothetical protein	NA	NA	NA	NA
WP_144422721.1\|4304771_4305904_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	7.2e-21	31.1
WP_158499471.1\|4306119_4306608_-	hypothetical protein	NA	NA	NA	NA
WP_008170042.1\|4307657_4308413_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	4.7e-69	54.5
WP_053115202.1\|4309366_4310401_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_053115203.1\|4311547_4311901_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	3.3e-25	57.7
WP_053115204.1\|4311948_4312227_-\|transposase	IS3 family transposase	U5P4I9	Shigella_phage	4.0e-18	61.2
WP_053115205.1\|4312264_4313011_-	DsbA family protein	NA	NA	NA	NA
WP_041335718.1\|4313495_4313792_+	hypothetical protein	NA	NA	NA	NA
WP_075196044.1\|4313788_4314403_+	hypothetical protein	NA	NA	NA	NA
WP_052479578.1\|4314515_4314833_+	hypothetical protein	NA	NA	NA	NA
WP_041335715.1\|4315445_4315892_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_053115580.1\|4316162_4317161_+	lipid A deacylase LpxR family protein	NA	NA	NA	NA
WP_053115581.1\|4317217_4318471_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_053115208.1\|4318467_4321635_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	4.2e-42	22.2
WP_053115582.1\|4321624_4323061_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_053115209.1\|4323044_4323515_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_041654905.1\|4323751_4324372_+	glutathione S-transferase	NA	NA	NA	NA
WP_053115210.1\|4324435_4325104_+	cupin	NA	NA	NA	NA
WP_008170337.1\|4325147_4325714_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_053115211.1\|4325858_4326665_+	dienelactone hydrolase family protein	NA	NA	NA	NA
WP_053115212.1\|4326749_4327841_+	aldo/keto reductase	NA	NA	NA	NA
WP_158499472.1\|4327980_4328595_+	MipA/OmpV family protein	NA	NA	NA	NA
WP_041336904.1\|4329446_4329749_+	DUF1778 domain-containing protein	NA	NA	NA	NA
WP_075267733.1\|4329720_4330269_+	acetyltransferase	NA	NA	NA	NA
WP_141201823.1\|4330872_4332264_-	diguanylate cyclase	NA	NA	NA	NA
WP_053115217.1\|4332929_4333325_-	ectoine synthase	NA	NA	NA	NA
WP_053115218.1\|4333542_4335174_-	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_082220626.1\|4335166_4336345_-	HlyD family secretion protein	NA	NA	NA	NA
WP_053115220.1\|4336367_4336841_-	transcriptional regulator SlyA	NA	NA	NA	NA
WP_053115221.1\|4336989_4337424_+	universal stress protein	NA	NA	NA	NA
WP_053115222.1\|4337627_4338614_+	aldo/keto reductase	NA	NA	NA	NA
WP_053115223.1\|4338610_4339423_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_053115224.1\|4339536_4339755_+	hypothetical protein	NA	NA	NA	NA
WP_053115225.1\|4339900_4340740_-	universal stress protein	NA	NA	NA	NA
WP_053115226.1\|4341457_4342189_-	hypothetical protein	A0A0C5K882	ANMV-1_virus	1.2e-08	29.8
WP_053115227.1\|4342852_4343890_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_075267737.1\|4344059_4344356_+\|transposase	transposase	NA	NA	NA	NA
WP_053115228.1\|4344352_4344688_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_075267739.1\|4345239_4347054_-	GGDEF domain-containing protein	NA	NA	NA	NA
WP_053115229.1\|4347349_4348963_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	7.6e-16	38.6
WP_041336099.1\|4349756_4350719_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_053115231.1\|4350972_4351305_+	hypothetical protein	NA	NA	NA	NA
WP_053115232.1\|4351307_4351997_-	hypothetical protein	NA	NA	NA	NA
WP_085986438.1\|4353328_4354491_-\|transposase	IS3 family transposase	Q716C2	Shigella_phage	1.2e-87	52.6
WP_008172247.1\|4354655_4355144_+	hypothetical protein	NA	NA	NA	NA
WP_008172249.1\|4355809_4356676_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_008172251.1\|4356836_4357946_+	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_008172254.1\|4358034_4358286_-	hypothetical protein	NA	NA	NA	NA
WP_053115234.1\|4358578_4359604_+	lipid A deacylase LpxR family protein	NA	NA	NA	NA
WP_008172259.1\|4359722_4360046_+	thioredoxin	A0A1J0GW78	Streptomyces_phage	1.7e-15	43.2
WP_053115235.1\|4360180_4361131_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_053115236.1\|4361145_4362033_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_053115237.1\|4362199_4363363_+	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_053115238.1\|4363427_4364159_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_008172268.1\|4364247_4365147_+	EamA family transporter	NA	NA	NA	NA
WP_008172270.1\|4365163_4365496_+\|tRNA	tRNA-binding protein	NA	NA	NA	NA
WP_053115239.1\|4365772_4366948_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_053115240.1\|4366958_4370150_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	5.6e-71	22.6
WP_053115241.1\|4370142_4371546_+	TolC family protein	NA	NA	NA	NA
WP_053115242.1\|4371690_4372773_-	alkene reductase	NA	NA	NA	NA
WP_000349485.1\|4373947_4374262_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000098298.1\|4374373_4375408_+	permease	NA	NA	NA	NA
WP_022960607.1\|4375420_4376698_+\|transposase	ISL3 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.6e-85	40.6

DBSCAN-SWA_10

4384716 : 4445277

Staphylococcus_phage(16.67%)

holin,transposase,integrase

attL 4386206:4386221|attR 4401727:4401742

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053115246.1\|4384716_4388361_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
4386206:4386221	attL	NA	NA	NA	NA
WP_053115247.1\|4388350_4389730_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_041336913.1\|4390072_4390312_+	hypothetical protein	NA	NA	NA	NA
WP_141201864.1\|4390557_4391028_+	hypothetical protein	NA	NA	NA	NA
WP_053115248.1\|4391078_4392656_-	hypothetical protein	NA	NA	NA	NA
WP_075195142.1\|4393321_4393669_-	carboxypeptidase regulatory-like domain-containing protein	NA	NA	NA	NA
WP_041336255.1\|4393678_4393960_-	carboxypeptidase regulatory-like domain-containing protein	NA	NA	NA	NA
WP_158499473.1\|4394122_4394434_+	diguanylate cyclase	NA	NA	NA	NA
WP_053115250.1\|4394696_4395194_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_053115251.1\|4395277_4396417_-	cyclohexanecarboxyl-CoA dehydrogenase	NA	NA	NA	NA
WP_053115252.1\|4396473_4397256_-	dihydroxynaphthoic acid synthetase	NA	NA	NA	NA
WP_053115253.1\|4397288_4398056_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_053115254.1\|4398092_4399757_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	1.6e-32	26.0
WP_053115255.1\|4399967_4400744_+	enoyl-CoA hydratase	NA	NA	NA	NA
WP_053115256.1\|4400990_4404029_-	efflux RND transporter permease subunit	S5VL66	Leptospira_phage	6.9e-10	18.8
4401727:4401742	attR	NA	NA	NA	NA
WP_053115257.1\|4404025_4405078_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_053115258.1\|4405115_4406018_-	alpha/beta hydrolase	A0A223FN69	NY_014_poxvirus	1.2e-07	32.1
WP_008170315.1\|4406007_4406499_-	PaaI family thioesterase	NA	NA	NA	NA
WP_053115259.1\|4406495_4406981_-	PaaI family thioesterase	NA	NA	NA	NA
WP_041336251.1\|4407239_4407854_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_041336253.1\|4407905_4408577_-	OmpW family protein	NA	NA	NA	NA
WP_075267727.1\|4409068_4410031_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.1e-41	34.1
WP_094182521.1\|4411214_4412301_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.4e-44	37.0
WP_008170042.1\|4412681_4413437_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	4.7e-69	54.5
WP_053114397.1\|4413448_4414990_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	4.1e-144	50.4
WP_158499474.1\|4415060_4415204_-	hypothetical protein	NA	NA	NA	NA
WP_053115261.1\|4415292_4416891_-\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	4.8e-55	30.4
WP_053115262.1\|4416918_4418373_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_011783984.1\|4418424_4418943_-	rubredoxin	NA	NA	NA	NA
WP_053115583.1\|4419080_4420298_-	alkane 1-monooxygenase	A0A1V0SBK9	Catovirus	4.7e-42	33.1
WP_053115263.1\|4420526_4423145_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_053115264.1\|4423177_4424338_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_082220627.1\|4424811_4425870_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_053115266.1\|4425866_4428644_+	ribosome-associated ATPase/putative transporter RbbA	A0A2H4PQG7	Staphylococcus_phage	2.5e-22	31.3
WP_053115267.1\|4428647_4429769_+	ABC transporter permease	NA	NA	NA	NA
WP_041336241.1\|4430162_4430558_+	ectoine synthase	NA	NA	NA	NA
WP_141201860.1\|4430983_4431454_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_007153487.1\|4431599_4431908_+\|transposase	IS3 family transposase	Q716C1	Shigella_phage	8.7e-22	52.5
WP_141201861.1\|4431823_4432495_+\|transposase	IS3 family transposase	Q716C2	Shigella_phage	6.1e-52	49.0
WP_041336316.1\|4433467_4434769_-\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_053115271.1\|4436007_4436442_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_053115272.1\|4436441_4436678_-	type II toxin-antitoxin system prevent-host-death family antitoxin	NA	NA	NA	NA
WP_053115273.1\|4436817_4437972_-	hypothetical protein	NA	NA	NA	NA
WP_053115274.1\|4437955_4441279_-	AAA family ATPase	NA	NA	NA	NA
WP_008174489.1\|4441275_4442019_-	DUF4194 domain-containing protein	NA	NA	NA	NA
WP_053115275.1\|4442025_4443522_-	DUF3375 domain-containing protein	NA	NA	NA	NA
WP_053113251.1\|4443918_4445277_-\|transposase	IS1182 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr_ID: NZ_CP011929.1|WP_052479578.1|4314515_4314833_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP011929.1|WP_052479578.1|4314515_4314833_+|hypothetical-protein

4314515_4314833_+

105 aa aa

hit_Aca_id	identity	query_coverage	hit_coverage
gnl\|BL_ORD_ID\|93	0.44761904761904764	1	0.7222222222222222

4273957-4376698

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP011929

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information