CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP016272	Lactiplantibacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp2, complete sequence	0 crisprs	NA	0	0	0
NZ_CP016270	Lactiplantibacillus plantarum subsp. plantarum strain CGMCC 1.557 chromosome, complete genome	2 crisprs	DEDDh,cas3,csa3,RT,WYL,cas9,cas1,cas2,csn2,DinG	2	26	6
NZ_CP016271	Lactiplantibacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence	0 crisprs	csa3	0	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP016270_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016270_1

320315-323619

Orphan

Consensus_repeat	Method
AGNGANTCNGANTCNGANAGTGA	CRT

48 spacers

The CRISPR arrays of NZ_CP016270_1

>merge|NZ_CP016270|1|320315-323619|CRT
AGTGATTCCGACTCTGACAGTGATTCGGATTCCGACAGTGATTCGGATTCCGACAGTGATTCTGACTCAGACAGCGACTCGGATTCTGATAGTGATTCGGATTCTGATAGTGATTCGGATTCCGACAGTGACTCGGATTCTGATAGTGATTCGGATAGCGACAGCGACTCAGATTCCGACAGTGATTCCGACTCTGACAGTGATTCGGATTCCGATAGCGACTCGGACTCGGACAGCGACTCCGACTCCGATAGCGACTCCGATTCTGACAGTGACTCGGACTCGGACAGCGATTCAGATAGCGACAGTGATTCCGACTCGGATAGTGATTCGGATAGCGACAGCGACTCGGATAGCGATAGTGACTCAGATTCCGACAGTGATTCCGACTCTGACAGTGACTCAGATTCCGATAGTGATTCCGACTCTGACAGTGATTCAGATAGCGACAGTGATTCAGATAGCGACAGTGATTCCGACTCCGACAGCGATTCCGACTCGGATAGTGACTCAGATTCCGATAGTGATTCGGACAGCGACAGTGACTCAGATTCGGACAGTGATTCCGACTCCGACAGTGACTCCGACTCTGATAGTGATTCCGATTCGGATAGTGACTCCGACAGCGATTCCGACTCAGATTCGGATAGTGATTCGGATTCAGACAGTGACTCAGACTCCGACAGTGATTCGGACTCGGACAGCGACTCGGATTCGGATAGTGACTCCGACAGTGATTCAGATAGCGACAGTGACTCAGACTCCGACAGTGATTCAGATAGCGACAGTGACTCCGACTCGGACAGTGATTCCGATTCGGATAGCGACTCCGATTCTGACAGTGACTCCGATTCTGACTCGGATAGTGATTCAGATTCCGATAGTGATTCCGATTCGGATAGTGACTCAGACTCAGACAGTGATTCCGACTCCGATAGTGATTCGGATTCTGACAGCGATTCAGACTCAGACAGTGACTCGGACTCCGACAGTGATTCGGATAGCGACAGTGATTCGGATAGCGACAGTGACTCAGATTCCGACAGTGACTCAGACTCAGACAGTGATTCTGACTCCGACTCGGATAGTGATTCTGATTCTGACAGTGATTCAGACTCAGACAGTGACTCGGATTCGGACAGCGACAGTGACTCCGACTCGGATAGTGATTCTGACTCAGACAGTGACTCCGACTCGGATAGTGATTCGGATTCCGATAGTGATTCCGATTCGGACAGTGACTCCGATTCCGATAGTGATTCTGACAGCGATTCCGACTCCGACAGTGACTCCGACTCGGATAGTGATTCGGATTCCGACAGCGACTCCGATTCGGATAGTGACTCGGATTCCGACAGTGATTCCGATTCGGATAGTGATTCAGATAGCGACAGTGATTCCGATTCTGACAGTGACTCGGATTCCGACAGTGATTCTGACTCAGACAGTGATTCGGATAGCGACAGCGATTCCGACAGTGACTCAGATTCCGATAGTGATTCTGACTCTGATAGCGACTCGGATTCCGACAGTGATTCGGATAGCGACAGCGATTCAGATAGCGACAGTGATTCAGATTCCGACAGCGATTCGGATTCGGATAGTGATTCAGATTCAGACAGTGATTCGGATTCCGATAGTGATTCGGACTCAGACAGTGATTCGGATAGCGACAGTGACTCAGATTCAGACAGTGATTCTGACTCAGACAGTGATTCGGATAGCGACAGTGACTCAGACTCCGATAGCGATTCCGACTCGGACAGCGACAGTGATTCCGACTCTGATAGTGACTCCGACTCTGATAGTGATTCGGATTCCGACAGTGATTCGGACTCTGATAGTGATTCAGATAGCGACAGCGATTCAGACTCTGATAGCGATTCCGATTCCGATAGTGACTCAGACTCAGACAGTGATTCCGACTCCGATAGCGACTCCGATTCCGATAGTGATTCGGATTCCGACAGCGATTCAGATAGCGACAGTGATTCCGACTCCGACAGTGACTCCGATTCCGATAGTGATTCTGACTCTGATAGTGATTCCGACTCCGACAGTGACTCCGATTCCGATAGTGATTCTGACTCTGATAGTGATTCAGATTCCGACAGTGACTCAGACTCTGATAGTGATTCCGACTCTGATAGCGACTCCGATTCCGACAGCGATTCCGACTCAGACAGTGATTCCGATTCGGACAGTGACAGTGACTCAGACTCAGATAGTGATTCCGATTCTGACAGTGATTCGGATAGCGACAGTGATTCCGATTCTGACAGTGATTCCGACTCAGACTCCGACAGCGATTCAGACTCAGATAGTGACTCCGATTCCGACAGCGATTCAGACTCTGATAGCGATTCCAATTCTGACAGTGATTCGGATAGCGACAGCGACTCAGACTCGGACAGTGACTCAGATAGCGACAGCGATTCGGATTCCGATAGTGATTCCGACTCAGACAGTGATTCCGATTCCGACAGCGATTCGGATTCCGATAGTGATTCCGACTCAGACAGTGATTCCGATTCCGACAGCGATTCGGATTCGGATAGTGATTCCGATTCCGACTCGGACAGCGACAGTGACTCAGATTCCGACAGCGATTCCGACTCCGATTCGGACTCGGATAGTGATTCTGATTCCGACAGTGACTCCGACTCGGATAGTGATTCGGATTCAGACAGTGATTCCGACTCGGATAGTGACTCGGATTCCGATAGTGATTCGGACTCGGATAGTGATTCCGACTCTGATAGCGATTCAGATTCGGACAGTGATTCCGATTCAGACTCAGACTCGGACAGTGACTCAGATAGCGACAGCGATTCGGATTCCGATAGTGATTCCGACTCAGACAGTGATTCCGATTCCGACAGCGACTCGGATTCCGATAGCGATTCCGACTCGGACAGCGACTCAGACTCTGACAGTGATTCGGATAGCGACAGTGACTCGGATTCCGATAGTGACTCCGATTCGGACTCTGACAGCGATTCGGACTCTGACAGTGATTCGGATAGCGACAGTGACTCGGATTCGGATAGTGATTCCGACTCAGACAGCGATTCCGATAGTGACTCCGATTCAGACTCGGATAGTGATTCGGATTCGGACAGCGATTCGGATTCCGACAGCGATTCGGACTCTGACAGTGATTCCGACTCGGATAGTGATTCGGATTCGGACAGCGACTCAGATTCGGACAGTGATTCGGATTCGGATAGCGATTCGGATTCCGACAGCGACTCGGATTCCGACAGTGATTCCGACTCGGATAGTGATTCGGATTCCGACAGTGA

>NZ_CP016270|1|1|320315-323619|CRT
AGTGATTCCGACTCTGACAGTGA	TTCGGATTCCGACAGTGATTCGGATTCCGACAGTGATTCTGACTCAGACAGCGACTCGGATTCTGAT
AGTGATTCGGATTCTGATAGTGA	TTCGGATTCCGACAGTGACTCGGATTCTGATAGTGATTCGGATAGCGACAGCGACTCAGATTCCGACAGTGATTCCGACTCTGAC
AGTGATTCGGATTCCGATAGCGA	CTCGGACTCGGACAGCGACTCCGACTCCGATAGCGACTCCGATTCTGACAGTGACTCGGACTCGGACAGCGATTCAGATAGCGAC
AGTGATTCCGACTCGGATAGTGA	TTCGGATAGCGACAGCGACTCGGATAGCGATAGTGACTCAGATTCCGAC
AGTGATTCCGACTCTGACAGTGA	CTCAGATTCCGATAGTGATTCCGACTCTGACAGTGATTCAGATAGCGACAGTGATTCAGATAGCGAC
AGTGATTCCGACTCCGACAGCGA	TTCCGACTCGGATAGTGACTCAGATTCCGATAGTGATTCGGACAGCGACAGTGACTCAGATTCGGAC
AGTGATTCCGACTCCGACAGTGA	CTCCGACTCTGATAGTGATTCCGATTCGGATAGTGACTCCGACAGCGATTCCGACTCAGATTCGGATAGTGATTCGGATTCAGAC
AGTGACTCAGACTCCGACAGTGA	TTCGGACTCGGACAGCGACTCGGATTCGGATAGTGACTCCGACAGTGATTCAGATAGCGAC
AGTGACTCAGACTCCGACAGTGA	TTCAGATAGCGACAGTGACTCCGACTCGGACAGTGATTCCGATTCGGAT
AGCGACTCCGATTCTGACAGTGA	CTCCGATTCTGACTCGGATAGTGATTCAGATTCCGATAGTGATTCCGATTCGGAT
AGTGACTCAGACTCAGACAGTGA	TTCCGACTCCGATAGTGATTCGGATTCTGAC
AGCGATTCAGACTCAGACAGTGA	CTCGGACTCCGACAGTGATTCGGATAGCGACAGTGATTCGGATAGCGACAGTGACTCAGATTCCGAC
AGTGACTCAGACTCAGACAGTGA	TTCTGACTCCGACTCGGATAGTGATTCTGATTCTGAC
AGTGATTCAGACTCAGACAGTGA	CTCGGATTCGGACAGCGACAGTGACTCCGACTCGGAT
AGTGATTCTGACTCAGACAGTGA	CTCCGACTCGGATAGTGATTCGGATTCCGATAGTGATTCCGATTCGGACAGTGACTCCGATTCCGATAGTGATTCTGAC
AGCGATTCCGACTCCGACAGTGA	CTCCGACTCGGATAGTGATTCGGATTCCGACAGCGACTCCGATTCGGAT
AGTGACTCGGATTCCGACAGTGA	TTCCGATTCGGATAGTGATTCAGATAGCGACAGTGATTCCGATTCTGAC
AGTGACTCGGATTCCGACAGTGA	TTCTGACTCAGACAGTGATTCGGATAGCGACAGCGATTCCGAC
AGTGACTCAGATTCCGATAGTGA	TTCTGACTCTGATAGCGACTCGGATTCCGACAGTGATTCGGATAGCGAC
AGCGATTCAGATAGCGACAGTGA	TTCAGATTCCGACAGCGATTCGGATTCGGAT
AGTGATTCAGATTCAGACAGTGA	TTCGGATTCCGATAGTGATTCGGACTCAGAC
AGTGATTCGGATAGCGACAGTGA	CTCAGATTCAGACAGTGATTCTGACTCAGAC
AGTGATTCGGATAGCGACAGTGA	CTCAGACTCCGATAGCGAT
TCCGACTCGGACAGCGACAGTGA	TTCCGACTCTGATAGTGACTCCGACTCTGAT
AGTGATTCGGATTCCGACAGTGA	TTCGGACTCTGATAGTGATTCAGATAGCGACAGCGATTCAGACTCTGAT
AGCGATTCCGATTCCGATAGTGA	CTCAGACTCAGACAGTGATTCCGACTCCGAT
AGCGACTCCGATTCCGATAGTGA	TTCGGATTCCGACAGCGATTCAGATAGCGACAGTGATTCCGACTCCGAC
AGTGACTCCGATTCCGATAGTGA	TTCTGACTCTGATAGTGATTCCGACTCCGAC
AGTGACTCCGATTCCGATAGTGA	TTCTGACTCTGATAGTGATTCAGATTCCGAC
AGTGACTCAGACTCTGATAGTGA	TTCCGACTCTGATAGCGACTCCGATTCCGAC
AGCGATTCCGACTCAGACAGTGA	TTCCGATTCGGACAGTGACAGTGACTCAGACTCAGAT
AGTGATTCCGATTCTGACAGTGA	TTCGGATAGCGACAGTGATTCCGATTCTGAC
AGTGATTCCGACTCAGACTCCGA	CAGCGATTCAGACTCAGAT
AGTGACTCCGATTCCGACAGCGA	TTCAGACTCTGATAGCGATTCCAATTCTGAC
AGTGATTCGGATAGCGACAGCGA	CTCAGACTCGGACAGTGACTCAGATAGCGAC
AGCGATTCGGATTCCGATAGTGA	TTCCGACTCAGACAGTGATTCCGATTCCGAC
AGCGATTCGGATTCCGATAGTGA	TTCCGACTCAGACAGTGATTCCGATTCCGAC
AGCGATTCGGATTCGGATAGTGA	TTCCGATTCCGACTCGGACAGCGACAGTGACTCAGATTCCGACAGCGATTCCGAC
TCCGATTCGGACTCGGATAGTGA	TTCTGATTCCGACAGTGACTCCGACTCGGATAGTGATTCGGATTCAGAC
AGTGATTCCGACTCGGATAGTGA	CTCGGATTCCGATAGTGATTCGGACTCGGAT
AGTGATTCCGACTCTGATAGCGA	TTCAGATTCGGACAGTGATTCCGATTCAGACTCAGACTCGGACAGTGACTCAGATAGCGAC
AGCGATTCGGATTCCGATAGTGA	TTCCGACTCAGACAGTGATTCCGATTCCGAC
AGCGACTCGGATTCCGATAGCGA	TTCCGACTCGGACAGCGACTCAGACTCTGACAGTGATTCGGATAGCGAC
AGTGACTCGGATTCCGATAGTGA	CTCCGATTCGGACTCTGACAGCGATTCGGACTCTGACAGTGATTCGGATAGCGAC
AGTGACTCGGATTCGGATAGTGA	TTCCGACTCAGACAGCGATTCCGATAGTGACTCCGATTCAGACTCGGAT
AGTGATTCGGATTCGGACAGCGA	TTCGGATTCCGACAGCGATTCGGACTCTGACAGTGATTCCGACTCGGAT
AGTGATTCGGATTCGGACAGCGA	CTCAGATTCGGACAGTGATTCGGATTCGGAT
AGCGATTCGGATTCCGACAGCGA	CTCGGATTCCGACAGTGATTCCGACTCGGAT
AGTGATTCGGATTCCGACAGTGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016270.1\|WP_053338818.1\|332932_335359_+\|leucine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234743
NZ_CP016270.1\|WP_088899813.1\|324397_326032_+\|glycosyl-transferase-family-1	unknown	unknown	unknown
NZ_CP016270.1\|WP_053338815.1\|315127_316630_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341045
NZ_CP016270.1\|WP_053338814.1\|312872_313592_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016270.1\|WP_053338813.1\|311300_312797_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340855
NZ_CP016270.1\|WP_011101348.1\|326058_327567_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340855
NZ_CP016270.1\|WP_003644231.1\|337560_338301_+\|16S-rRNA-pseudouridine(516)-synthase	unknown	unknown	gnl\|CDD\|211327
NZ_CP016270.1\|WP_003643181.1\|331786_332470_-\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239486
NZ_CP016270.1\|WP_053338812.1\|304196_305033_-\|metallophosphoesterase-family-protein	unknown	unknown	gnl\|CDD\|378975
NZ_CP016270.1\|WP_053338819.1\|335882_337553_+\|polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|240529
NZ_CP016270.1\|WP_053338817.1\|329345_331016_-\|IS1182-family-transposase	unknown	unknown	gnl\|CDD\|226192
NZ_CP016270.1\|WP_003643183.1\|329133_329331_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016270.1\|WP_003643199.1\|303563_304082_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP016270.1\|WP_013355428.1\|307168_308143_-\|ferrochelatase	unknown	unknown	gnl\|CDD\|366291
NZ_CP016270.1\|WP_169484465.1\|313802_314993_+\|methionine-adenosyltransferase	unknown	unknown	gnl\|CDD\|235374
NZ_CP016270.1\|WP_003644215.1\|305871_307197_-\|Nramp-family-divalent-metal-transporter	unknown	unknown	gnl\|CDD\|234815
NZ_CP016270.1\|WP_003644218.1\|309970_310900_+\|homocysteine-S-methyltransferase	unknown	unknown	gnl\|CDD\|181899
NZ_CP016270.1\|WP_003643194.1\|308474_309857_-\|amino-acid-permease	unknown	unknown	gnl\|CDD\|236904
NZ_CP016270.1\|WP_011101349.1\|327577_329104_+\|accessory-Sec-system-glycosyltransferase-Asp1	unknown	unknown	gnl\|CDD\|340855
NZ_CP016270.1\|WP_013355436.1\|331190_331718_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|377744

Protein	Function_ID	Function_description	E-value
NZ_CP016270.1\|WP_003644231.1\|337560_338301_+\|16S-rRNA-pseudouridine(516)-synthase	gnl\|CDD\|211327	cd02553, PseudoU_synth_RsuA, Pseudouridine synthase, Escherichia coli RsuA like. This group is comprised of eukaryotic and bacterial proteins similar to Escherichia coli RsuA. Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi). No cofactors are required. E.coli RsuA makes psi516 in 16S RNA. Psi at this position is not generally conserved in other organisms.	6.60255e-87
NZ_CP016270.1\|WP_053338818.1\|332932_335359_+\|leucine--tRNA-ligase	gnl\|CDD\|234743	PRK00390, leuS, leucyl-tRNA synthetase; Validated.	0
NZ_CP016270.1\|WP_053338815.1\|315127_316630_+\|MFS-transporter	gnl\|CDD\|341045	cd17502, MFS_Azr1_MDR_like, Saccharomyces cerevisiae Azole resistance protein 1 (Azr1p), and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of multidrug resistance (MDR) transporters including various Saccharomyces cerevisiae proteins such as azole resistance protein 1 (Azr1p), vacuolar basic amino acid transporter 1 (Vba1p), vacuolar basic amino acid transporter 5 (Vba5p), and Sge1p (also known as Nor1p, 10-N-nonyl acridine orange resistance protein, and crystal violet resistance protein). MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.7732e-72
NZ_CP016270.1\|WP_003643199.1\|303563_304082_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.80056e-08
NZ_CP016270.1\|WP_053338813.1\|311300_312797_+\|glycosyltransferase	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	5.40481e-88
NZ_CP016270.1\|WP_011101348.1\|326058_327567_+\|glycosyltransferase	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	8.80379e-70
NZ_CP016270.1\|WP_003643181.1\|331786_332470_-\|phosphatase-PAP2-family-protein	gnl\|CDD\|239486	cd03392, PAP2_like_2, PAP2_like_2 proteins. PAP2 is a super-family of phosphatases and haloperoxidases. This subgroup, which is specific to bacteria, lacks functional characterization and may act as a membrane-associated lipid phosphatase.	1.93944e-45
NZ_CP016270.1\|WP_053338812.1\|304196_305033_-\|metallophosphoesterase-family-protein	gnl\|CDD\|378975	pfam12850, Metallophos_2, Calcineurin-like phosphoesterase superfamily domain. Members of this family are part of the Calcineurin-like phosphoesterase superfamily.	6.41895e-10
NZ_CP016270.1\|WP_053338817.1\|329345_331016_-\|IS1182-family-transposase	gnl\|CDD\|226192	COG3666, COG3666, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	3.69539e-15
NZ_CP016270.1\|WP_053338819.1\|335882_337553_+\|polysaccharide-biosynthesis-protein	gnl\|CDD\|240529	cd13124, MATE_SpoVB_like, Stage V sporulation protein B, also known as Stage III sporulation protein F, and related proteins. The integral membrane protein SpoVB has been implicated in the biosynthesis of the peptidoglycan component of the spore cortex in Bacillus subtilis. This model represents a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	3.0581e-131
NZ_CP016270.1\|WP_013355436.1\|331190_331718_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|377744	pfam06962, rRNA_methylase, Putative rRNA methylase. This family contains a number of putative rRNA methylases. Note that many family members are hypothetical proteins.	1.66853e-67
NZ_CP016270.1\|WP_013355428.1\|307168_308143_-\|ferrochelatase	gnl\|CDD\|366291	pfam00762, Ferrochelatase, Ferrochelatase.	7.70113e-117
NZ_CP016270.1\|WP_169484465.1\|313802_314993_+\|methionine-adenosyltransferase	gnl\|CDD\|235374	PRK05250, PRK05250, S-adenosylmethionine synthetase; Validated.	0
NZ_CP016270.1\|WP_003644215.1\|305871_307197_-\|Nramp-family-divalent-metal-transporter	gnl\|CDD\|234815	PRK00701, PRK00701, divalent metal cation transporter MntH.	2.2402e-148
NZ_CP016270.1\|WP_003644218.1\|309970_310900_+\|homocysteine-S-methyltransferase	gnl\|CDD\|181899	PRK09485, mmuM, homocysteine methyltransferase; Provisional.	2.70803e-161
NZ_CP016270.1\|WP_003643194.1\|308474_309857_-\|amino-acid-permease	gnl\|CDD\|236904	PRK11387, PRK11387, S-methylmethionine permease.	0
NZ_CP016270.1\|WP_011101349.1\|327577_329104_+\|accessory-Sec-system-glycosyltransferase-Asp1	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	4.16681e-107

>NZ_CP016270.1|WP_053338815.1|315127_316630_+|MFS-transporter
MQQRKTNVMAVTVAIYVATFMSAIEGTIVSTALPTIVGDLHGVSLMNWVFSIYLLTNAMMTPIYGKLTDLVGRKPVMQAGLIIFIIGSMMSGLSNSMPVLIFWRAIQGIGAGALMPVSMTIIADIYSFERRAKVLGFNSSAWGIASVLAPLIGGLIVDKLSWHWIFFINVPVGLITLFLFQFYLREPKRHYNVKIDYLGSFWLMLFLLCLMLSFQLLGNATISWVAVGTAWIISALSLWLFIRRESRTDEPVISMDLFKNHTFIIQNAVAALVSGFLMAVEVYIPTWTQGILGVPASLAGFAVTPSSLMWIVGSFVTGRLLAKWAPRRILYLSLAFILVTSICLAWLPVNTAFPWFFLITAIGGVGFGITITATTVTSQHLVPAENVGVATSFNTLSRTIGQTLMISIFGIALNVGMNQGIQHHAGTNMAMMNKLINPQTATQLPSHLLPTLHRILYTGLHWVYLIGLGLVILAFIVNSLDRGPQKTAAQHAADLNQNQD
>NZ_CP016270.1|WP_169484465.1|313802_314993_+|methionine-adenosyltransferase
MVSERHLFTSESVSEGHPDKIADQISDAILDAMLAQDPQARVAVETSVTTGLVLVFGEVSTKAYVDIQKVVRDTIKSIGYVDGQYGFDGDNCAVLVSLDEQSPDIAQGVDDSLETRSGDADPLDQIGAGDQGMMFGYAINETPELMPLPIALSHRLMRKIAALRKDGTIKWLRPDAKAQVTVEYDEDNQPKRIDTVVLSTQHDPDVDLDTIRQTVIDQVIKAVLPADLLDDQTKYLVNPTGRFVIGGPQGDAGLTGRKVIVDTYGGFAHHGGGAFSGKDATKVDRSASYAARYIAKNVVAAGLADQVEVQLAYAIGVAEPVSIAVDTAGTGKVSDEALINAIRENFDLRPAGIIKMLDLQRPIYRQTAAYGHFGRTDIDLPWEHTDKVDALKAAFK
>NZ_CP016270.1|WP_053338814.1|312872_313592_-|hypothetical-protein
MIRIGKLHIKRDYIALAIFTIVQSIISWWAALDYGRSFQTASFSAAQLPLIGYTLAVAAAVFIILDRRIAPQWSLIAIGITVAFAFTNIIAKESELLYLLLTCSAWLLVMAVPRFGMQNYFGLVVFGVIMTFTIPVAVFDLQNNYLSTTFLWKLTPMLASYVFLYVPSFSRQRQINQLISAITGLLLVITIFLQPLTWQTIVAILITIAVWLSQQSFGRTRLHLMINVAVQLVLILLLY
>NZ_CP016270.1|WP_053338813.1|311300_312797_+|glycosyltransferase
MYYFVGTGLGLKLTGIEKAQLNRLALFDAAGYQARCVYVTYNPRLHEHAARFGAEGKCFSLYDFFQGTMPEAVTKIHHDWMHYWQAVCHFKVIQVPNTTDFRVLGTDGQYLMYVHFVDAGRQQLDYVNYFDNQGVKVRREFYDNRGFLSRTSFLVKHQEVHTEVYYDLQGQVKIIKQYDITGPEPKLRLITLNNYQQRDFFFNTEQAFQTFFFNELATADDVYFCDRNRQTAAALGHTRPAIRVCSVLHSTHLRIGEDVVSGHLKSVYRYVLAHPDQFHRIIVSTEHQKRDLLARYDNLPPVVVIPVGYTTVHPVKIDGRDPHRIISVARYSPEKQLPHQLEVVRRLVGEFPDLTLQLFGHGQKIEMQMRQFIQANQLEKNIVIRGFLPNLAEEYQRASLALMTSVEEGFSLATMEAESYGVPVIGYRIAYGPEDIIEDGVNGYLVTPNDVDELTMKVRQYLQHPERQAQLITNAYNSATRYSKQTIIEKWRQLIAAL
>NZ_CP016270.1|WP_003644218.1|309970_310900_+|homocysteine-S-methyltransferase
MLSLTEQLNRGPVVSDGAMATELEKRGVATNSALWSATAMLDHPDAIQAVHQSYLDAGAKIMTTNTYQANVPAFEQAGIAAAQARQLIQQAVTIAHTARDASHVTDAVIAGSIGPYGAYLADGSEYTGAYQLTPSAYQDFHRERLALIMAAGVDVLALETMPRLDEVQALVQLITTTWPQQPYWVSFSIKDPQTLCDGTSLAAAAKWVAAQPNVVAVGVNCTTLENIAPALTTLKAAVAVPLIVYPNSGDQYDPVTKTWQETHLSHQFASFVPQWLAAGARIIGGCCRTTPKDIATVARALSVSDSAKL
>NZ_CP016270.1|WP_003643194.1|308474_309857_-|amino-acid-permease
MSKQTHLSRQMESRHVLMISLGGVIGTGLFLSSGYTIHQAGPIGTLLAYTIGAILVYLVMLCLGELSVAMPYTGAFHVYAKKYIGPGTGFTVAILYWLTWTIALGSEFTAAGLIMQTWFPHIATWIWSLVFMVVIFTVNALSVRWFAEAEFWFASIKVIAIIAFIVLGGLAMVGILPLHGHTSAPFLSNYTRNGWFPNGFGGVFTTMLTVNFAFSGTELIGITAGETKDPAHTIPTAIKTTLWRLIIFFIGSMSVMAALIPYKQAGVTQSPFVLVFKAIGIPYAADLMNFVVLTAIMSAANSGLYASTRMLWSLANEGTIPKVFKRTTKRDVPLVALITSMLGGILALLSSVYAAGSVYLVLVSISGLAVVIVWMAIALSEINFRKTYLKSGQSLDQLTFKTPGYPVVPWLAFILSGLSCILIWFDPNQRIALYYTIPFVAICYLGYYLNQRYRRTHAAK
>NZ_CP016270.1|WP_013355428.1|307168_308143_-|ferrochelatase
MHPGLLLVNLGSPASPRTKDVKAYLQEFLSDPSVIEMPAALWQPLLRGIILPTRSWRSATFYQDSWLPQGSPLIVYSQAICQQVQAALPDWDVRLAMTYGQPDIGATLKAMVADGCEKPIILPLFPQYTQSTHGGIHRQVEATGLPHTFIDSFYDQPTYIHLLATKVWQSYQAHHYDAVIFSYHSIPTAMVRHGDPYQRECEATTKAVLTERPELPADKVITAYQSKFGPMPWLKPYLKNELMQLVELGKRNVLVVTPSFVVDCLETLEEDYVQNYQTFRASGGDRFDLVPPMNKDTGFSQFLADLAIQKQEASNHAIASSSKS
>NZ_CP016270.1|WP_003644215.1|305871_307197_-|Nramp-family-divalent-metal-transporter
MQSHRHQSLEEINQSVAVPDVHQTAFWRKFLAYSGPGALVAVGYMDPGNWLTSLAGGGQFQYRLLAVLALAIIVAMFMQGLAIRLGVVARQDLAQAIASKLPRPVRYAAWILNEVAMMATDMTGVIGTAIALKMLFGLPLLAGILLTIADVLVVLLFLRFGIRRVEVIVLVAILTVGIIFGIEVGRAHVQFGNVLLGLVPTPLIVKNHTALVLSLGILGATIMPHNLYLHSSLAQSRRYDYHNPAQVTEALRFANWDSTVHLIAAFLINALLLVLGGTLFFGHTNALASLQAVFDGLKSTTVVGALASQVMSWLFALALLITGLISSITSTLAGQIVMEGYLHIRLPLWQRRLLTRAVTLIPILIIGMLVGFSDAAFENLIIYAQVALSIALPFTLLPLVALTNDASLMKTHVNRPTVTWLGYGLAGIITVLNIYLVYSLF
>NZ_CP016270.1|WP_053338812.1|304196_305033_-|metallophosphoesterase-family-protein
MVKIAVLSDVHGNATALEAVLADAQKQHVDEYWTVGDMTVRGPESERCLTLLDRVHPTAYVLGNHEENYQKVMAANPNTFTKPKQIMATVLTAFDRRQLSSTHFERLLNLPMTVIKHVGPLTIRLQHVLPTVASGHALAPTASQANFDQAAEGDVDIVIYAHTHQPIMRYATTGQLILNAGTVGLPTAINPHLRQPRANYLLLTIDETGLQHIDYHAVDFDWQRAITIAQNTHLPYFEFYEQTLRTNTYQYAPSAVAAYNTQHDMAREARKILLENRH
>NZ_CP016270.1|WP_003643199.1|303563_304082_-|GNAT-family-N-acetyltransferase
MYFKKATLDDLDTIIDILSDGRNQLAEAGVNQWQGDYPSRKQITADIMQGSAYLFNADDNATVGAVAVVPSPDETYDTAKAEWLNTTAPYVVIHRVAIHSSHAGHGYATQLFEKIIAHIAADHPEIKSIRIDTHADNQAMQHLIAKMNFKRVGEMVGVYHVDDVCYVYEKML
>NZ_CP016270.1|WP_088899813.1|324397_326032_+|glycosyl-transferase-family-1
MQKSTVTKLKQALIATGNLKDYGTSTVTLALSVSDHRHRAQVRFYRCDSFKQAWIAVAQQLAKTPQASWVRLEAVQSTQKLPRETFEKRLAATFRMNYWRYGISFDADFKTALLEMESNGQAFFRPSKAHRIGKNRSGSWVDYDRVEPYLDKREGALPVDIRKTENVWVFTTAGVFTDGQKIWNLSEQEDCGKGVRVVTDEQSELQSAIEHGETFLINQLKDNGKFVYGYFPARQRVLSNYNVVRHFSSLYALLEAIPFTKRTEDCAKVKLAIQWGLKNATIEKEGAIFVDDNGELKLGGQALLILALSKYQDVTKDDTFMPVLMKAFKGVHFFQEPSGKLIHVLNPDLTVKAAYRIIYYEGEVAFALSRLYELTHDKNVMDLVKQILDYMVANDYGKYHDHWISYAINEALLVFPDNRDYMKLGLKNVFSHLKFIEERDTTYPTLLELVDAAVKMTDMIKRSGNEDLIAPYDLVRLRQGLRYRALYEITTGCFLPEIAMYLYNPQKFIGGFYARHDNFRTRIDDCEHFLSGLINYYNYTYRQA
>NZ_CP016270.1|WP_011101348.1|326058_327567_+|glycosyltransferase
MFYFINEYILGKNSSVEHAAINRVKLFNHYKAPAQIVTKMYDRLLHQTMGTFQLANQQVLNMFDYFQQTTDVPTKVLHTDDMHLPVEYAVEVGANFSKIFNGDEHVSNVGFIPGTIGRVFYQEFFDNQGNLSSTDLWDWRGFKSSTQYFGQNGKLVLERFYNLQGETVIEQYYVPDTNGNPLASRLILKNYRDQAERFFQDANHLFRFFLAELSHLDKQTTTFISDRPGTSVKPLLELQDDSHKYVTVPIYQAKDINDPIHSPLDGFLTPAFDNLQHFDGFITATESQAQHLRTRFPKAKVTVLPTVTTSPLAQSKLRPITARPKQLLYVGRLAPDRQLDQLIRTIALVKQQVKEIQCDFYGYGDPEYLKTLNKLVEELKLTNNVHLLDYHPDLETRYDDYQLLLNTDIVDGGPMSMPEAMSHGIPVISYRFNYGPKDWIDDGHDGFIVDPGNQLALRDRVIELMTDTKKLTAFSEAAFKKLHTSQTDLKVWHRWQQLLGIK
>NZ_CP016270.1|WP_011101349.1|327577_329104_+|accessory-Sec-system-glycosyltransferase-Asp1
MYYFLNDNMQFSKSGIEQAEINRLTLFKKHHVAAKIVTRVFAMNLHDVLEGANIADADFVNLFDFFCGSQSVKRQRFDLADFEVPADAIKTRKDNQIQVMERGKLIMIIYLRAGTEAVSNVQYFDVNGRTLKMSWWDTRGFKCLEQLFDWDGKIAQEAYFGPDGLIHVEKLHLLNHAGQERITWRVLNYNEQSHTFNGMNELTRYFYDELNQLNDEQNVFICDRTVECAWGLFNMTTSAKKVLHLHNNHVSDAKDIMHSTLNNNYANALNNWAAWDAVISATPEQTKDVEARFGKDIPAFTIPVGYVDNATLKAAPVKFDQRQKDLVVQVARLAPEKQQNHSIEAFVEVHKHFPDAKLELWGYANGDIEKQLHAQVAAAHLEDVVLFKGYTTDVNAVYNRAQLGLLPSRAEGFSLMLLEAQAHGLPMVANDVKYGPSDIIQDHKSGILTTDGDVQQLTKTILELLKNQGQLAQYSAQAYENAKRYSEEAVFKQWQALLDYFKPAKVTA
>NZ_CP016270.1|WP_003643183.1|329133_329331_+|hypothetical-protein
MLMIMTIYGTVKMFTRMIVYCGIGGLVLIVRHHNRKKRRNEMDEGTKRIMRNTPKDENGKYPWEK
>NZ_CP016270.1|WP_053338817.1|329345_331016_-|IS1182-family-transposase
MQDYYNMNQTTLSIALDYQPEEHHSARYINQLVESLKLKYDYQFGRPREYNLGAMLKLVLLAYSYGIFSSRKIEQFARENKPAGWLIADQIPSYRTICRFRISDELATLTTDSLSQLTQYLRQNGMIDDVSFIDGTKILADANKYSFVWKKNTIRFDKMNREKLVDLLGELHEAKIVGEIPAGSELTPELLDIMISKVEDHLVVLNETVEATKQVSPNPAKQQRRTVKSQKRKLDKRRDKMREHQAQQAIYDQRNSYSKTDHDATFMRVKEDPMQNGQLKPAYNVQIATSNQFITGYRLFQNPTDTRTLQPFIEHLKANNVLGHTIVADAGYGSESNYRYLEDEFGQHTVLIPYGTMLKENSRKWQSDDRKVMNWDYHEKDDYFINPQNVRFNFNAYRQRTDKYGFTRDFKEYIAEKYDENHQLISAALTPKGYLKRISVNENWEYFKSKQRELLSAPETGQIYAQRKIDVEPVFGKMKASLHFNRFSVRGFDKVTKEAGIVILALNIMKLVTVGTNFKNQRRKQMGRETKIRFLVPFAYTEASYVTASFSIRYLT
>NZ_CP016270.1|WP_013355436.1|331190_331718_-|class-I-SAM-dependent-methyltransferase
MNQVVNPGDHVIDATVGNGHDTVYLAKLVGTTGRVDGFDIQSAAIEATTTALDKAALTHQVTLWQTGHEHIADKIAADQPIKCAVFNLGYLPGGDKQIITKPTTTLTAIKAIQERLVTNGLIILLVYAGHPGGATEAQAVLDYVTNLDQHQFQVLQYQFINQVHVPPYLLAIQKR
>NZ_CP016270.1|WP_003643181.1|331786_332470_-|phosphatase-PAP2-family-protein
MAIIYLSEESVLKQRSWQRSDSLILLIFIGWLGWTAAVWQRAPWLTHFDTTVANFWHHSPQWFQHAMVTYTQLGNPHTITIITLIIGLALWLGHNPRGAVFFWVTTWLIAGYGNYLIKQVIMRPRPTAWRLVQIGGYSYPSGHSTTTTVLIGSLLVLAFDYWHRNALTGWLTALGITAILLMMISRVIVGVHYPSDTIGGLLLGSVLLYISARFSMRYRHGPLRLRP
>NZ_CP016270.1|WP_053338818.1|332932_335359_+|leucine--tRNA-ligase
MAYNHKVIERKWQHYWKENKTFKTLDTTDKKKYYALDMFPYPSGQGLHVGHPEGYTATDIMSRFKRMQGYNVLHPMGWDAFGLPAEQYALKTGHNPKDFTAKNIKNFKRQIRSLGFSYDWDREVNTTDPSYYKWTQWIFEQLYKKGLAYESETLVNWAPDMMGGTVVSNEEVVDGKTERGGYDVYRVPMKQWSLKITAYADRLIDDLDDIDWPENIKEQQRNWIGRSVGASIRFKVAGQPDDTEIEVFSTRPDTLFGASYMVLAPEHDLVEQLTTPEQADSIKAYKAKIASKSDLERTDLNKDKTGVFTGSYGINPVNGEKLPIWIADYVLASYGTGAIMAVPAHDDRDFEFAQKFDLPIKPVIAGDNDYDQQAYTGDGEHINSGFVDGLAKQPAIDKMIDWLGEHHAGEKKVNYRLRDWIFSRQRYWGEPIPVIHWEDGETTLVPEDELPLRLPATKNLEPSGTGESPLANIDDWVNVVDENGRKGKRETNTMPQWAGSSWYFLRYVDPHNREALADYDKLKYWSPVDLYVGGAEHAVLHLLYARFWHKFLYDLGVVPTKEPFQKLVNQGMILGDNHEKMSKSRGNVVNPDDIVDQYGADTLRLYEMFMGPLEASIPWSTDGLHGANKWIERVWRLMIDENNRVRDRITTINDGKLTKIYNETVKKVTEDYEAMRFNIAISQMMVFVNEAYKVDDLPIIYIEGFVKLLSPIAPHLSEELWSLLGHDDTITYATWPTYDESKLVEDTVQIVLQVNGKVRSHAEVAKDMGKDELEKLALADEKIQEFTAGKTVRKVIAIPGKLVNVVAN
>NZ_CP016270.1|WP_053338819.1|335882_337553_+|polysaccharide-biosynthesis-protein
MSEESKANQPQNAHVNSEAEAHQKMVRGSAWMTAGSLFSRVLGAIYIIPWVIWMGADYTQGNALYAKGYNIYSFFLLIAIGGIPSAISKQLSEYNAMNEYAVGQRLFKRGLLLTSAFGIIGAIILWFGAGLISTAFGGYDANLIPVLHALAIALVILPSMSLTRGFFQGYQQMAPSAISQFVEQVFRVIYMLGATYFIMRVAHGDWVNAVTQSTFAAFVGAAASFLLLGWYYFRKRPELNALAAQSENKLVIPVWQLFRDIIIQAIPFIVIDTATTVFNLLDQATFQPMMRLVYHLGTKQIDTLYAYFAFNANKLVMIIVSLASAIAVTVVPILSESLASHNMRNIRKQLEDSIILFLFIMIPGALGMAAVAQPLNTLFYSYDQIGTLILQISAFTAIALGFFTVISALMQGLSRNRDIIRYYLIGLLVKIVIQLPCIYFLSTAGPLVATAIGMMVASLMAMYDLEVNFGIRYVKLLPKINRILVYSILTYVTARLVVYGLNFVLNEHSKTQSFLIVALAVIAGGAVYVCLALRSRMADLMIGTKAAGLRRKLRIK
>NZ_CP016270.1|WP_003644231.1|337560_338301_+|16S-rRNA-pseudouridine(516)-synthase
MRVDKFLHAMRIGTRTQVRRLIKDGHITANGEPVISGKQQINPGSDTVFLDDVQVRYQQYFYYVMNKPVGVITATTDSAAKTVMDLFNTTDFRDDLFPVGRLDKDTEGILVITNDGTLSHDLLSPNHHVTKVYEAEVTGEITAAQLANFNDGITLKDGTELQPAQAEIVQFHEIENFTTIRIMIHEGKYHQVKRMVGTLGERVVGLRRIKFGSLTLPVGLLAGNYRALTDDELTALKADANQPVGE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP016270_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016270_2

2455301-2455931

TypeII

Consensus_repeat	Method
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	PILER-CR
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	CRISPRCasFinder
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	CRT

9 spacers

csn2,cas2,cas1,cas9,csa3

The CRISPR arrays of NZ_CP016270_2

>merge|NZ_CP016270|2|2455301-2455931|PILER-CR,CRISPRCasFinder,CRT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACTTGAAGTCCCAGCCGTGAACCAGTTAATGAGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACTCAAATTAAGAATGCCGTAGCCACAATTACGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACGGACGCATCGGGGTATATTGCTGACGAAGAGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACAGAACGGTACGTATGAGTTAACACCTAAATGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACTTGTATTATCTAATCGTAATTGAGTACCGTAGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACGCTATACTATAAACATATATAAGGAAAGGAGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACGATTAAATGCAAGTACTGTCTTTCGAATATGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACACGTCGGCGAAATCTTCACCACGCCGATTAGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACGATGCTGAGGAAACGAAGCATAGAACGTTTGTCTTGAATAGCGGCCACATCAAAAACAGTTTCACG

>NZ_CP016270|2|1|2455301-2455865|PILER-CR
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TTGAAGTCCCAGCCGTGAACCAGTTAATGA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TCAAATTAAGAATGCCGTAGCCACAATTAC
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	GGACGCATCGGGGTATATTGCTGACGAAGA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	AGAACGGTACGTATGAGTTAACACCTAAAT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TTGTATTATCTAATCGTAATTGAGTACCGTA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	GCTATACTATAAACATATATAAGGAAAGGA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	GATTAAATGCAAGTACTGTCTTTCGAATAT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	ACGTCGGCGAAATCTTCACCACGCCGATTA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC

>NZ_CP016270|2|1|2455301-2455865|CRISPRCasFinder
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TTGAAGTCCCAGCCGTGAACCAGTTAATGA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TCAAATTAAGAATGCCGTAGCCACAATTAC
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	GGACGCATCGGGGTATATTGCTGACGAAGA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	AGAACGGTACGTATGAGTTAACACCTAAAT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TTGTATTATCTAATCGTAATTGAGTACCGTA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	GCTATACTATAAACATATATAAGGAAAGGA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	GATTAAATGCAAGTACTGTCTTTCGAATAT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	ACGTCGGCGAAATCTTCACCACGCCGATTA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC

>NZ_CP016270|2|2|2455301-2455931|CRT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TTGAAGTCCCAGCCGTGAACCAGTTAATGA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TCAAATTAAGAATGCCGTAGCCACAATTAC
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	GGACGCATCGGGGTATATTGCTGACGAAGA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	AGAACGGTACGTATGAGTTAACACCTAAAT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TTGTATTATCTAATCGTAATTGAGTACCGTA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	GCTATACTATAAACATATATAAGGAAAGGA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	GATTAAATGCAAGTACTGTCTTTCGAATAT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	ACGTCGGCGAAATCTTCACCACGCCGATTA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	GATGCTGAGGAAACGAAGCATAGAACGTTT
GTCTTGAATAGCGGCCACATCAAAAACAGTTTCACG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016270.1\|WP_003643663.1\|2463048_2464281_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340949
NZ_CP016270.1\|WP_027821583.1\|2461923_2462379_-\|DUF3021-domain-containing-protein	unknown	unknown	gnl\|CDD\|378668
NZ_CP016270.1\|WP_011100898.1\|2461413_2461836_+\|Hsp20/alpha-crystallin-family-protein	unknown	unknown	gnl\|CDD\|107228
NZ_CP016270.1\|WP_053339207.1\|2447339_2448047_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016270.1\|WP_011100896.1\|2460079_2460682_-\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|377026
NZ_CP016270.1\|WP_053339208.1\|2455995_2458734_-\|cation-transporting-P-type-ATPase	unknown	unknown	gnl\|CDD\|319775
NZ_CP016270.1\|WP_071542797.1\|2462375_2462660_-\|LytTR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197918
NZ_CP016270.1\|WP_003641724.1\|2445154_2445625_-\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|240033
NZ_CP016270.1\|WP_003641725.1\|2445857_2447222_+\|amino-acid-permease	unknown	unknown	gnl\|CDD\|182694
NZ_CP016270.1\|WP_027821588.1\|2449142_2453219_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	mkCas0193_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|374653
NZ_CP016270.1\|WP_015379640.1\|2454296_2454602_+\|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|226043
NZ_CP016270.1\|WP_027821587.1\|2453413_2454319_+\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187851
NZ_CP016270.1\|WP_027821589.1\|2448071_2448854_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP016270.1\|WP_027821586.1\|2454598_2455276_+\|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd12218_csn2_CAS-II-A	gnl\|CDD\|213411
NZ_CP016270.1\|WP_053339206.1\|2443446_2445039_+\|HIRAN-domain-containing-protein	unknown	unknown	gnl\|CDD\|214906
NZ_CP016270.1\|WP_003641722.1\|2442462_2443203_+\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|224982
NZ_CP016270.1\|WP_011100897.1\|2460794_2461268_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP016270.1\|WP_011100895.1\|2459018_2459777_+\|nucleoside-phosphorylase	unknown	unknown	gnl\|CDD\|350158
NZ_CP016270.1\|WP_015379645.1\|2464371_2464671_+\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP016270.1\|WP_003641730.1\|2459819_2460014_-\|PspC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377200

Protein	Function_ID	Function_description	E-value
NZ_CP016270.1\|WP_003643663.1\|2463048_2464281_+\|MFS-transporter	gnl\|CDD\|340949	cd17391, MFS_MdtG_MDR_like, Multidrug resistance protein MdtG and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli multidrug resistance protein MdtG, Streptococcus pneumoniae multidrug resistance efflux pump PmrA, and similar multidrug resistance (MDR) transporters from bacteria. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtG confers resistance to fosfomycin and deoxycholate. PmrA serves as an efflux pump for various substrates and is associated with fluoroquinolone resistance. MdtG-like MDR transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.1962e-140
NZ_CP016270.1\|WP_027821583.1\|2461923_2462379_-\|DUF3021-domain-containing-protein	gnl\|CDD\|378668	pfam11457, DUF3021, Protein of unknown function (DUF3021). This is a bacterial family of uncharacterized proteins.	1.50722e-25
NZ_CP016270.1\|WP_011100898.1\|2461413_2461836_+\|Hsp20/alpha-crystallin-family-protein	gnl\|CDD\|107228	cd06471, ACD_LpsHSP_like, Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18.5, HSP 18.55 and HSP 19.3. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Transcription of the genes encoding Lp HSP 18.5, 18.55 and 19.3 is regulated by a variety of stresses including heat, cold and ethanol. Early growing L. plantarum cells contain elevated levels of these mRNAs which rapidly fall of as the cells enter stationary phase. Also belonging to this group is Bifidobacterium breve (Bb) HSP20 and Oenococcus oenis (syn. Leuconostoc oenos) (Oo) HSP18. Transcription of the gene encoding BbHSP20 is strongly induced following heat or osmotic shock, and that of the gene encoding OoHSP18 following heat, ethanol or acid shock. OoHSP18 is peripherally associated with the cytoplasmic membrane.	2.67238e-43
NZ_CP016270.1\|WP_015379645.1\|2464371_2464671_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	2.33489e-13
NZ_CP016270.1\|WP_011100896.1\|2460079_2460682_-\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|377026	pfam03358, FMN_red, NADPH-dependent FMN reductase.	2.2024e-30
NZ_CP016270.1\|WP_053339208.1\|2455995_2458734_-\|cation-transporting-P-type-ATPase	gnl\|CDD\|319775	cd02080, P-type_ATPase_cation, P-type cation-transporting ATPase similar to Exiguobacterium aurantiacum Mna, an Na(+)-ATPase, and Synechocystis sp. PCC 6803 PMA1, a putative Ca(2+)-ATPase. This subfamily includes the P-type Na(+)-ATPase of an alkaliphilic bacterium Exiguobacterium aurantiacum Mna and cyanobacterium Synechocystis sp. PCC 6803 PMA1, a cation-transporting ATPase which may translocate calcium. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP016270.1\|WP_071542797.1\|2462375_2462660_-\|LytTR-family-transcriptional-regulator	gnl\|CDD\|197918	smart00850, LytTR, LytTr DNA-binding domain. This domain is found in a variety of bacterial transcriptional regulators. The domain binds to a specific DNA sequence pattern.	6.75435e-19
NZ_CP016270.1\|WP_003641724.1\|2445154_2445625_-\|NUDIX-hydrolase	gnl\|CDD\|240033	cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	8.22877e-58
NZ_CP016270.1\|WP_003641725.1\|2445857_2447222_+\|amino-acid-permease	gnl\|CDD\|182694	PRK10746, PRK10746, putative transport protein YifK; Provisional.	0
NZ_CP016270.1\|WP_027821588.1\|2449142_2453219_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|374653	pfam16592, Cas9_REC, REC lobe of CRISPR-associated endonuclease Cas9. The REC lobe of Cas9 - the CRISPR-associated endonuclease Cas9 - includes the REC1 and REC2 domains. REC1 forms an elongated, alpha-helical structure consisting of 25 alpha helices and two beta-sheets, whereas REC2 inserted within REC1 adopts a six-helix bundle structure. The REC lobe and the NUC lobe of Cas9 fold to present a positively charged groove at their interface which accommodates the negatively charged sgRNA:target DNA heteroduplex. CRISPR (clustered regularly interspaced short palindromic repeat)-Cas system occurs naturally in bacteria as a defense against invasion by phages or other mobile genetic elements. Cas9 is targeted to specific genomic locations by sgRNAs or single guide RNAs, in order to complex with invading DNA in order to cleave it and render it inactive.	2.66373e-128
NZ_CP016270.1\|WP_015379640.1\|2454296_2454602_+\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	2.01798e-25
NZ_CP016270.1\|WP_027821587.1\|2453413_2454319_+\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	6.41428e-89
NZ_CP016270.1\|WP_027821589.1\|2448071_2448854_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.18043e-25
NZ_CP016270.1\|WP_027821586.1\|2454598_2455276_+\|type-II-A-CRISPR-associated-protein-Csn2	gnl\|CDD\|213411	cd12218, Csn2, CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	1.34637e-80
NZ_CP016270.1\|WP_053339206.1\|2443446_2445039_+\|HIRAN-domain-containing-protein	gnl\|CDD\|214906	smart00910, HIRAN, The HIRAN protein (HIP116, Rad5p N-terminal) is found in the N-terminal regions of the SWI2/SNF2 proteins typified by HIP116 and Rad5p. HIRAN is found as a standalone protein in several bacteria and prophages, or fused to other catalytic domains, such as a nuclease of the restriction endonuclease fold and TDP1-like DNA phosphoesterases, in the eukaryotes. It has been predicted that this protein functions as a DNA-binding domain that probably recognises features associated with damaged DNA or stalled replication forks.	4.91349e-17
NZ_CP016270.1\|WP_003641722.1\|2442462_2443203_+\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	gnl\|CDD\|224982	COG2071, COG2071, Predicted glutamine amidotransferases [General function prediction only].	4.48973e-88
NZ_CP016270.1\|WP_011100897.1\|2460794_2461268_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	0.000255443
NZ_CP016270.1\|WP_011100895.1\|2459018_2459777_+\|nucleoside-phosphorylase	gnl\|CDD\|350158	cd09007, NP-I_spr0068, uncharacterized subfamily of the nucleoside phosphorylase-I family. This subfamily is composed of uncharacterized members including Streptococcus pneumoniae hypothetical protein spr0068. The nucleoside phosphorylase-I (NP-I) family members accept a range of purine nucleosides as well as the pyrimidine nucleoside uridine. The NP-1 family includes phosphorolytic nucleosidases such as purine nucleoside phosphorylase (PNP, EC. 2.4.2.1), uridine phosphorylase (UP, EC 2.4.2.3), and 5'-deoxy-5'-methylthioadenosine phosphorylase (MTAP, EC 2.4.2.28), and hydrolytic nucleosidases such as AMP nucleosidase (AMN, EC 3.2.2.4) and 5'-methylthioadenosine/S-adenosylhomocysteine (MTA/SAH) nucleosidase (MTAN, EC 3.2.2.16). Members of the NP-I family display different physiologically relevant quaternary structures: hexameric (trimer-of-dimers arrangement of Shewanella oneidensis MR-1 UP); homotrimeric (human PNP and Escherichia coli PNPII or XapA); hexameric (with some evidence for co-existence of a trimeric form) such as E. coli PNPI (DeoD); or homodimeric such as human and Trypanosoma brucei UP. The NP-I family is distinct from nucleoside phosphorylase-II, which belongs to a different structural family.	7.05874e-91
NZ_CP016270.1\|WP_003641730.1\|2459819_2460014_-\|PspC-domain-containing-protein	gnl\|CDD\|377200	pfam04024, PspC, PspC domain. This family includes Phage shock protein C (PspC) that is thought to be a transcriptional regulator. The presumed domain is 60 amino acid residues in length.	2.12668e-17

>NZ_CP016270.1|WP_027821586.1|2454598_2455276_+|type-II-A-CRISPR-associated-protein-Csn2
MNITYYPFPPFKIDAGKVNVLDLGNSNMYAEVCQGFRDRIDSVRISNDDLELQTISSQCNWYGDLMLSVDLNRLFLKKVQTQIIKLMADDRQVAVLDENRKVVSQVMEASFLLDLPLDVDESPSLEQILKFTGVHFPTELMNDPRAILEALVQTHVELGLKQKLVLTNVSHYLNQKQWASFEQLVHDLGATVIVIEYSEINRMEKFKNSCYYYVDEDLVDWRDMN
>NZ_CP016270.1|WP_015379640.1|2454296_2454602_+|CRISPR-associated-endonuclease-Cas2
MRLIVMFDVPMDTSEERRAYRHFHKALVREGFLMMQYSTYVRVCVNKKAAEFVEKRIAPLAPKGGKVQTMTVTEKQYQAMHYIQGTPSNDILNSAERTIVI
>NZ_CP016270.1|WP_027821587.1|2453413_2454319_+|type-II-CRISPR-associated-endonuclease-Cas1
MGWRNVIITQHAKVSYSMNRILVQTSSDKYAVPISDIQLLLVGTTQAVITSAALCALAEAHVKVIFTDHQGEPISETNDYYPTRRTADLVRQQVTWPEARIATLWTKNVGSKILNQIQVIDFVGGDTQTLVDELDKLELNDVTNREAVVANKYFSLLFGAQFYRRDFSPINAALNYGYAVLLSMVNREIVLNGYLTCIGIHHENNENEFNLGSDLMEPFRPIVDQWVSQQRFKDFTPDIKIGLVSLLDLEIGFNGHQTIVSHAITEYVAACLHYLSGETEELKIEVKLPNEVSSDAINSHV
>NZ_CP016270.1|WP_027821588.1|2449142_2453219_+|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MKEPYGVGLDIGTNSVGWTVVDASGHVRKIKGQTGIGVRLFKEGAAAADRRGFRTTRRRLKRVKWRLRLLREFFDQPISKVDINFFARRKYSDISPRDPNYNGLEKTLFNDRSDQDFYHDYPTIYHLREALMTQHRKFDVREIYLAIHHIVKYRGNFLRNDAATAYRSGTLDLQQHFETLNHLFSQADLELNLNLTTDVALLDSIKQTLVRTDISRSDRQKLIMPLLAVLTGATTAEKKRQKAVVTEFAKALVGNKTKIDVLTLTDIDATEAKDWAFSLEENQDKLPGIEDRFSEVGQQIIDEVIRLYASVNLAQLIPEGKRFSQSMVEKYKRHGEDLKLLKAYIRSQSDAKRGRAIRATYDQYIDGVKSKQVTQEAFQKALGKFVDADVDLNSWAAQIKQAIDSEQFMPKLRIKQNGAIPYQVQQNELDQIISNQKEYYPWLGEENPVIKRRGKFPYKLDELVGFRVPYYVGPLITKEMQAATANAGFAWMVRKADGPITPWNFDDKVDRVASATAFIQRMQTTDTYLIGEEVLPARSLIYQRFMVLNELNNIRVDDGQLTPRQKQRLYNQVFKKHKRVTAKNIQDNLVAAGEFPTAPRITGLADPKVFNSSLSTYHDLKQVLPEAMSDVRKQADIEKIILWSTIFEDSTIFKQKLTEISWLTAAQLKQLGQLRYRGWGQLSRKLLTGLKDDNNRSIMDGLWETNANFMQLRSQPAIENQIKSANQANLTTADLQDTINELYTSPQNKKAIREVMVVLADIKDAMHGQTPNWIFVEAARGGGVAGRRTQSRSKQIVAAYQGTAQAIVSDQVQRELKEKIKNKANFNTRLVLYFLQNGRDLYTGDAINIDRLSEYDIDHILPQSLVKDDSLDNRVLTNARINREKNDTFASEKFGKKMGAKWKEMHRMGLMTKRKLDHLLMRPDEISKYATGFINRQLVETRQVIKLVEELINAEYPSTAIVSVKANLTHQFRQTFDFPKIREVNDYHHAFDAALTAFIGTYLLKRYPKLERFFVYGKFAKQPVNLTRFNVIRKLAKTDTPITDIDTGEVLWDKLTDIKYFETLYDYKRLLVTREVSENYGAMFDQTLLKASDNGKRLIRKKQSFDTAIYGGYTGKTLAYMAIVKVSTKKDVQYQVVGVPTTMVTQIEQLEQQGMTNKQAVTKVIEPLIAANNKKMLTYEVLLPKVRFEQVVRDRIKGQTHRFALGTDTYYHNIQELYLPLTLQRAFLGKQNESEVQLNQNLLTVFDATLAQVNRYFPLYEMNKFKKILNSARDQIELLEAKNQFVKNKLVLGKQGILTNMFIGLHANASYGDLKVLGVKTDFGKLQVPGGIKLTGDAEIIYQSPTGLFERKISLKDL
>NZ_CP016270.1|WP_027821589.1|2448071_2448854_+|alpha/beta-hydrolase
MRFITSDHVQLDYTDEGQGQPIVILTGFGGAKDIWRAQIPVLIQAGYRVINLDGRCQGLSEHTAKGLRMSRRAVDAHELIEKLQLKQPILLGNSMGAATWFAYVSLYGDTGIKALIDVDQTPRMINTPHWQYGFKQVQWQDIPDYFRMPLGHSTFKHIDDATYARVKAVEAQAPFDAKLMFPLLVNHAVQDWRDVIRQLTVPFLIIAGAKSPFFNPDFAAVTAQMALRGQSVVIPEAGHIVMAEQSVAFNKALLEFLATC
>NZ_CP016270.1|WP_053339207.1|2447339_2448047_+|hypothetical-protein
MVKQGHYAKVSKQKRLRQLKQRRQAQEKRAIMPEMVSEFLQVRYHLTQAAKQRPAMRQMMQRFMAQWLAAGQAELSDNGQTTWSVVALTKQTLQTFNRQLPWQGYALVDQEMARWTAFLNKEVPAVPLSERITLTEVLSPATWQACLSEQLAINALLALTGDSRQLGQITTEQVRQLQTSIQTATGIDWEKVAQLLDSTVIAQNTLSKAGLDDKTRQWLEKLKKLTPQDFNDHVE
>NZ_CP016270.1|WP_003641725.1|2445857_2447222_+|amino-acid-permease
MQRKLSTGQMQMIALGGTIGVGLFMGSSSTIKWTGPSVLIAYIVSGAFLYLIMRALGEMLYVDPNTGSFAKFASEYIHPVFGYLTAWSNIFQFVVVGMSEMIALGGYCRYWWPNLPDWIPGLIAIVFLCAANLISVKMFGTLETWFSLIKVVTIILMIIAGLGLIIFGIGNGGHPIGISNLWTHGGFFTGGVKGFVFALAIVLASYQGIELIGVTAGEAENPQSTIVKAIRSTVARILIFYVGAIFVIVSIYPWDKLSQIGSPFVQTFAKIGITAAASIINFVVITASLSGTNSGIYSASRMTYTLAESHQLPRKMTLLNRHGVPFYSVIAIATGILIGVVLNVVLPMFFKDASEIFVMVYSSSVLPGMVPWFVILVSQIAFRKQNAAKMANHPFKMPLSPYSNYLTLAFLALTLVFMFINPETRYSILVGVVFLVIMTLIYFRKYAGNKEETL
>NZ_CP016270.1|WP_003641724.1|2445154_2445625_-|NUDIX-hydrolase
MANYIKEIRALVGHKPIILNTAAGILVNDQQQVLLNLRTDTHNWSLPGGYLEYGETYATACVREYKEDSGIDVEVVDRIGIFDKGETAYPNGDVAQTISALFLVKPIGGHVLTQATDETLKLDYFDFDNLPPLLNQQNADMIHAAQEYLQTHSATK
>NZ_CP016270.1|WP_053339206.1|2443446_2445039_+|HIRAN-domain-containing-protein
MERIEAGMSVMTLKKQTYRVIAVINQGQELLVRAHEPETADIEIIPVTTVVQVTEQNSTGDAAVALDTVTVVGERYVDDIVATLTTLRVGMAVLLQRESGNQYDDNAISVWTLQHAKLGYIARYQNQPYAALMDQGQRLYGIVTVLDQQKQHLELMLWRTTAVPSPIEALQIRQRLAKPRTNLGAVPTHSLQTPLGTIVMMCNGHPIKYQQVPLSPWLTPADELHVTKRYLLTPDWSQVPPDSLITCQVTAKADVVQRWQNEHISAAVLTNASSFYVVGISAQTKTGLNDNLVDDAAQPAVIYRVGQVSAHVQAGFMVSWAPFGDPRVQPALKLALHFSSQPLVPYHPVTPSRTNATFTQQELAALLVSALPNYQGGQRLEPSVTAITVEKLRQTLGDQTYHALANYQRHVQLVAGSTEGVNETLLQALIHAVTYHELTTMHYYQPTVGMVDQVIYPIQLFSTTTKDEDDAQLVGCLALYNYETFEIQQVPLTAIARIAIIADPEHPQTTPETESPDWLRIFLHGWNDDF
>NZ_CP016270.1|WP_003641722.1|2442462_2443203_+|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein
MVKPIIGIAPGVVTVNSQMFPGRVRDYVNRDYLKSVTDNGGVPLVLPVTTDATTIERYVGMIDGLLLCGGADVAPLTYGEEPQPKLGGVDPERDQYEIALIRATHAVGKPVLGICRGLQILNVCYGGNLYQDMSELPAGQGTLKHMQGQLAAYGMHHVKVVPGTTLAEYLGTTSDAITVNSFHHQAVKQVATGFQVVAQSADQVVEAIEATAGGLQLGVQWHPEMMQQVNSVQARLFAAFMRACVA
>NZ_CP016270.1|WP_053339208.1|2455995_2458734_-|cation-transporting-P-type-ATPase
MIKDDNQSLTSNEEQNDTQNPPDADNLWQLDESALAAKYATDPENGLSTAEAAERLQHNGRNELETKRTSRFVQFIKQFNNSIIYILAAAAVLTFFMHHYSDSIVIGLVIIANAIIGYVQERQAGNALERIREMLISKNFVIRDGKKLEIDARELVVGDLVNLEAGDAVPADMRLISADNFNVQESVLTGETNPVEKQEEPMTETTLALADRKNMVYASTAVTSGSAVGIVTATAEDTEIGHIQQSVSDVKQTTTPLMRNLNSLGVGLSIAIVVAAVLLFLLGMVMDTYSLPTLLIAVITMVVGSMPEGLPASTSVVLAMGTRQMTKKNVIVKSLPAVETLGAVDIVNTDKTGTLTKNEMTVTKVVTPEHTFDVTGVGYDDNGGVNFDGHLKLNGNKVDWHQDNAMEWLVKIAGQTTDAELHFENNRWELTGEPTDGALTTLYRKMTGHDPEVEEVDSLPFDSAFRFSARLADLDGQRLLMVKGSPATVLRLTDQANQTAYWDDAMDDLTADGLRVVALAYQEVDDDVTTIDAQAIGGLHLAGLVGIIDPPREEAATAIAELRQAGVQVKMITGDHPDTAMAIANKLNLAANVKAITGPEIDAMDDQQLQAHIDDYNVFARATPNNKLRIVRAQQANNHVVSMTGDGVNDAPALKQADIGVAMGIKGTEVAKESADMVLADDDFADIVAAVREGRHVFDNIRKTIRFLLPTSFAEGLVVIISILMGHELPLYPTQLLWINMVSALTIQFAFIFEPPEAGIMARGPRNVKSGLLSKLDYFEIGYVSFLISGLGIFAYNYLTALGLPNVVGSTMSLNIIIFGKIFYLFNLRNDHPVISKYFFQNKMAFYIIGILILLQLGIIYLPFMQSVFHTTSINFWYGWGIPIICGIVVLIVTEVGKFIRFRWMGKDGVID
>NZ_CP016270.1|WP_011100895.1|2459018_2459777_+|nucleoside-phosphorylase
MTDKLTLLQYDPNPTAMVGPDVDGRFTVPAKLLYIFSGDDYFQQFVTRYHGHRLGQFNTITKVSWVYQIGYRGQKLAVAQAPLGSPAATMYLEMLIDFGARTVIAVGSCGALTALPEEQLLIPTVALRDEGTSFHYLAAADWVPLDPKVIQVLGTTLTKACLPWQMVKTWTTDAFFRETVSKVKAARQQGCQVVEMECSALAACSAFRQVSFGQLLYTADTLAQLEHYDPRHWGAGGVLAAIELAVESLAAY
>NZ_CP016270.1|WP_003641730.1|2459819_2460014_-|PspC-domain-containing-protein
MKIDIHRSATDRVIAGVIGGIAEHFNWNTNVTRLLFVVLAITPMFPGIIAYLILWLLMKDPIKD
>NZ_CP016270.1|WP_011100896.1|2460079_2460682_-|NAD(P)H-dependent-oxidoreductase
MFKIAIILGSTRSQANGRALLNHLKLIIDQLPTHSPIHYQFLDLANYQLPFFDEPEPPMANPHRELPANQQQWLTDMASADGYIILTPEYNHAMPAGLKNAFDFLAFEGARKPAKIISYSDNMRGGQFGAAALVPVLQRLGIVVLPKPTPIGNVPQTLQSNGHFIDNAPLSKRYDHTLHQALTEITYYTTVLTTTPFPTD
>NZ_CP016270.1|WP_011100897.1|2460794_2461268_+|MarR-family-transcriptional-regulator
MTTPLVSQLMTELNQFLTQDSVDDQEKRWAMQQTTDPQLQAALKQLSTTDIKIMAYLGRRGASRAKSLPAPTELSQATISRGLTKLSRLKLATKYRDLTNNKEILVRLTTLGEAVADLHTQLDATIAAKAQAIADDYSDAELRRFVSLMRRIREIKI
>NZ_CP016270.1|WP_011100898.1|2461413_2461836_+|Hsp20/alpha-crystallin-family-protein
MANTLMNRNDFGMLDPFERMARSFWAPLENMDQVLKTDINETDDQYQVKVDVPGIDKQDVKLDYRDNVLSIKVQKDSFVDHEDQDQNIVMNERHTGTLQRQYMLPNVAANKITASQADGVLTITLPKTQPSANDGQIEIQ
>NZ_CP016270.1|WP_027821583.1|2461923_2462379_-|DUF3021-domain-containing-protein
MKRLWHTLLIGAIGGIVIGYLMALGFSTFFNTTYLFPSNPTFVSHWSSPLAATQLSTLLWILIGEVWAFSSWLFEIETWSITKQTIAHCLCSFLGMTPLAILCGWFPLNVRWFGFYTLVYTGAYIGLWLIEMALARIKVIQLNQQLTNQRS
>NZ_CP016270.1|WP_071542797.1|2462375_2462660_-|LytTR-family-transcriptional-regulator
MPLQSVSRFYTANKRLYCETTTGAYLVHSHLHTLMDQLPPHQFLRISSSEIVRIACVKNFTLTKWGSFQVNLTTGTTTYASRRYTQQIRKAAQL
>NZ_CP016270.1|WP_003643663.1|2463048_2464281_+|MFS-transporter
MDDAERERGPWHRNLIVLWFCTFVAGMAFSEIMPFLSLFVSQLGDFTKAQITFYSGLAFAADYAISAISAPLWGIIADKKGRKIMLLRASLGMAVAMGLMGFVTNVWQLVALRALQGVFAGFISNAQALVASQTPRKYSGRALSTLITGAVSGQLFGPVIGGLLAQLFSIRNTFFITAGLLMVAFLLSLFFVQEHFKPVAHHREPGDSRNPLAAFQNPRLIIVMLCSTAIVQFGNASIAPIISLYVRELMHYRGPITVVAGIIAALPGISNIFSAPRLGRYGDQHGSGKVLLFGYIFAVIMYFPQGIVTSVVALGILRFAIGISDGALYPEIQTVLTKNTPVHLTSTIFSYNQSFQAIGNMFGALLGGLVAGWFNYNAVFIMTALLLLINLGLILWLVPDIWKNGKRAVS
>NZ_CP016270.1|WP_015379645.1|2464371_2464671_+|winged-helix-turn-helix-transcriptional-regulator
MNIEISKQDQADQQRVAIFKALADANRLRIIRVLYQAQREMTCSEVGAQLNISKSTVSYHFKTLRLVGLTNTRRKAQTKYLSLQLATFDRFLPGFLATL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP016270_1	1.32\|322564\|31\|NZ_CP016270\|CRT	322564-322594	31	NZ_CP016270.1	320302-320332	1	0.968
NZ_CP016270_1	1.21\|321940\|31\|NZ_CP016270\|CRT	321940-321970	31	NZ_CP016270.1	323602-323632	2	0.935

1. spacer 1.32|322564|31|NZ_CP016270|CRT matches to position: 320302-320332, mismatch: 1, identity: 0.968

ttcggatagcgacagtgattccgattctgac	CRISPR spacer
ttcggatagcgacagtgattccgactctgac	Protospacer
************************.******

2. spacer 1.21|321940|31|NZ_CP016270|CRT matches to position: 323602-323632, mismatch: 2, identity: 0.935

ttcggattccgatagtgattcggactcagac	CRISPR spacer
ttcggattccgacagtgactcggactcagac	Protospacer
************.*****.************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP016270_1	1.33\|322618\|19\|NZ_CP016270\|CRT	322618-322636	19	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19655-19673	0	1.0
NZ_CP016270_1	1.33\|322618\|19\|NZ_CP016270\|CRT	322618-322636	19	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20117-20135	0	1.0
NZ_CP016270_2	2.7\|2455734\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455734-2455763	30	NZ_CP032752	Lactobacillus plantarum subsp. argentoratensis strain DSM 16365 plasmid unnamed1, complete sequence	44248-44277	0	1.0
NZ_CP016270_2	2.7\|2455734\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455734-2455763	30	NZ_CP021472	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-2, complete sequence	22320-22349	0	1.0
NZ_CP016270_2	2.7\|2455734\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455734-2455763	30	NZ_CP017356	Lactobacillus plantarum strain TMW 1.25 plasmid pL125-2, complete sequence	554-583	0	1.0
NZ_CP016270_2	2.7\|2455734\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455734-2455763	30	NZ_CP017366	Lactobacillus plantarum strain TMW 1.277 plasmid pL1277-3, complete sequence	3851-3880	0	1.0
NZ_CP016270_2	2.7\|2455734\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455734-2455763	30	NZ_CP017381	Lactobacillus plantarum strain TMW 1.1623 plasmid pL11623-2, complete sequence	5167-5196	0	1.0
NZ_CP016270_2	2.7\|2455734\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455734-2455763	30	NZ_CP018868	Lactobacillus alimentarius DSM 20249 plasmid pLDW-11, complete sequence	44155-44184	0	1.0
NZ_CP016270_2	2.7\|2455734\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455734-2455763	30	NZ_CP028231	Lactobacillus plantarum strain SRCM101222 plasmid unnamed2, complete sequence	7973-8002	0	1.0
NZ_CP016270_2	2.7\|2455734\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455734-2455763	30	NZ_CP035557	Lactobacillus plantarum strain SRCM103297 plasmid unnamed1	6645-6674	0	1.0
NZ_CP016270_2	2.7\|2455734\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455734-2455763	30	NZ_CP035557	Lactobacillus plantarum strain SRCM103297 plasmid unnamed1	48912-48941	0	1.0
NZ_CP016270_2	2.7\|2455734\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455734-2455763	30	NZ_CP021933	Lactobacillus plantarum strain TMW 1.1478 plasmid pL11478-1, complete sequence	52769-52798	0	1.0
NZ_CP016270_2	2.7\|2455734\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455734-2455763	30	NZ_CP016492	Lactobacillus pentosus strain BGM48 plasmid pBGM48-1, complete sequence	20119-20148	0	1.0
NZ_CP016270_2	2.7\|2455734\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455734-2455763	30	NC_022114	Lactobacillus paracasei subsp. paracasei 8700:2 plasmid 1, complete sequence	11474-11503	0	1.0
NZ_CP016270_2	2.7\|2455734\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455734-2455763	30	NZ_AP014682	Lactobacillus hokkaidonensis JCM 18461 strain LOOC260 plasmid pLOOC260-2, complete sequence	11051-11080	0	1.0
NZ_CP016270_2	2.7\|2455734\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455734-2455763	30	NC_016608	Pediococcus claussenii ATCC BAA-344 plasmid pPECL-5, complete sequence	10937-10966	0	1.0
NZ_CP016270_2	2.7\|2455734\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455734-2455763	30	NZ_CP028242	Lactobacillus plantarum strain SRCM101518 plasmid unnamed1, complete sequence	8123-8152	0	1.0
NZ_CP016270_2	2.7\|2455734\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455734-2455763	30	NZ_CP035152	Pediococcus acidilactici strain SRCM103367 plasmid unnamed1	43974-44003	0	1.0
NZ_CP016270_1	1.30\|322450\|31\|NZ_CP016270\|CRT	322450-322480	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157606-157636	1	0.968
NZ_CP016270_1	1.36\|322768\|31\|NZ_CP016270\|CRT	322768-322798	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156412-156442	1	0.968
NZ_CP016270_1	1.37\|322822\|31\|NZ_CP016270\|CRT	322822-322852	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156412-156442	1	0.968
NZ_CP016270_1	1.42\|323164\|31\|NZ_CP016270\|CRT	323164-323194	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156412-156442	1	0.968
NZ_CP016270_2	2.2\|2455403\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455403-2455432	30	AY682195	Lactobacillus plantarum bacteriophage LP65, complete genome	8592-8621	1	0.967
NZ_CP016270_2	2.2\|2455403\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455403-2455432	30	NC_006565	Lactobacillus phage LP65, complete genome	8592-8621	1	0.967
NZ_CP016270_2	2.7\|2455734\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455734-2455763	30	NZ_CP046657	Lactobacillus plantarum strain 123-17 plasmid p123-18.1, complete sequence	10801-10830	1	0.967
NZ_CP016270_1	1.11\|321238\|31\|NZ_CP016270\|CRT	321238-321268	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154468-154498	2	0.935
NZ_CP016270_1	1.11\|321238\|31\|NZ_CP016270\|CRT	321238-321268	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1849-1879	2	0.935
NZ_CP016270_1	1.20\|321886\|31\|NZ_CP016270\|CRT	321886-321916	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153616-153646	2	0.935
NZ_CP016270_1	1.21\|321940\|31\|NZ_CP016270\|CRT	321940-321970	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1543-1573	2	0.935
NZ_CP016270_1	1.22\|321994\|31\|NZ_CP016270\|CRT	321994-322024	31	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21088-21118	2	0.935
NZ_CP016270_1	1.22\|321994\|31\|NZ_CP016270\|CRT	321994-322024	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15475-15505	2	0.935
NZ_CP016270_1	1.22\|321994\|31\|NZ_CP016270\|CRT	321994-322024	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15583-15613	2	0.935
NZ_CP016270_1	1.22\|321994\|31\|NZ_CP016270\|CRT	321994-322024	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15709-15739	2	0.935
NZ_CP016270_1	1.22\|321994\|31\|NZ_CP016270\|CRT	321994-322024	31	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9646-9676	2	0.935
NZ_CP016270_1	1.30\|322450\|31\|NZ_CP016270\|CRT	322450-322480	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154774-154804	2	0.935
NZ_CP016270_1	1.30\|322450\|31\|NZ_CP016270\|CRT	322450-322480	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155170-155200	2	0.935
NZ_CP016270_1	1.30\|322450\|31\|NZ_CP016270\|CRT	322450-322480	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155224-155254	2	0.935
NZ_CP016270_1	1.30\|322450\|31\|NZ_CP016270\|CRT	322450-322480	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155404-155434	2	0.935
NZ_CP016270_1	1.36\|322768\|31\|NZ_CP016270\|CRT	322768-322798	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156430-156460	2	0.935
NZ_CP016270_1	1.37\|322822\|31\|NZ_CP016270\|CRT	322822-322852	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156430-156460	2	0.935
NZ_CP016270_1	1.42\|323164\|31\|NZ_CP016270\|CRT	323164-323194	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156430-156460	2	0.935
NZ_CP016270_1	1.47\|323512\|31\|NZ_CP016270\|CRT	323512-323542	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153064-153094	2	0.935
NZ_CP016270_1	1.48\|323566\|31\|NZ_CP016270\|CRT	323566-323596	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153934-153964	2	0.935
NZ_CP016270_2	2.6\|2455668\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455668-2455697	30	AY682195	Lactobacillus plantarum bacteriophage LP65, complete genome	347-376	2	0.933
NZ_CP016270_2	2.6\|2455668\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455668-2455697	30	NC_006565	Lactobacillus phage LP65, complete genome	347-376	2	0.933
NZ_CP016270_1	1.11\|321238\|31\|NZ_CP016270\|CRT	321238-321268	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1561-1591	3	0.903
NZ_CP016270_1	1.11\|321238\|31\|NZ_CP016270\|CRT	321238-321268	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2767-2797	3	0.903
NZ_CP016270_1	1.20\|321886\|31\|NZ_CP016270\|CRT	321886-321916	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151843-151873	3	0.903
NZ_CP016270_1	1.20\|321886\|31\|NZ_CP016270\|CRT	321886-321916	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154666-154696	3	0.903
NZ_CP016270_1	1.20\|321886\|31\|NZ_CP016270\|CRT	321886-321916	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154882-154912	3	0.903
NZ_CP016270_1	1.20\|321886\|31\|NZ_CP016270\|CRT	321886-321916	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155080-155110	3	0.903
NZ_CP016270_1	1.20\|321886\|31\|NZ_CP016270\|CRT	321886-321916	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155314-155344	3	0.903
NZ_CP016270_1	1.20\|321886\|31\|NZ_CP016270\|CRT	321886-321916	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151621-151651	3	0.903
NZ_CP016270_1	1.20\|321886\|31\|NZ_CP016270\|CRT	321886-321916	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154648-154678	3	0.903
NZ_CP016270_1	1.20\|321886\|31\|NZ_CP016270\|CRT	321886-321916	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157498-157528	3	0.903
NZ_CP016270_1	1.20\|321886\|31\|NZ_CP016270\|CRT	321886-321916	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2653-2683	3	0.903
NZ_CP016270_1	1.24\|322090\|31\|NZ_CP016270\|CRT	322090-322120	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2785-2815	3	0.903
NZ_CP016270_1	1.26\|322216\|31\|NZ_CP016270\|CRT	322216-322246	31	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21070-21100	3	0.903
NZ_CP016270_1	1.26\|322216\|31\|NZ_CP016270\|CRT	322216-322246	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15457-15487	3	0.903
NZ_CP016270_1	1.26\|322216\|31\|NZ_CP016270\|CRT	322216-322246	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15565-15595	3	0.903
NZ_CP016270_1	1.26\|322216\|31\|NZ_CP016270\|CRT	322216-322246	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15691-15721	3	0.903
NZ_CP016270_1	1.26\|322216\|31\|NZ_CP016270\|CRT	322216-322246	31	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9628-9658	3	0.903
NZ_CP016270_1	1.30\|322450\|31\|NZ_CP016270\|CRT	322450-322480	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157318-157348	3	0.903
NZ_CP016270_1	1.30\|322450\|31\|NZ_CP016270\|CRT	322450-322480	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1345-1375	3	0.903
NZ_CP016270_1	1.36\|322768\|31\|NZ_CP016270\|CRT	322768-322798	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151639-151669	3	0.903
NZ_CP016270_1	1.36\|322768\|31\|NZ_CP016270\|CRT	322768-322798	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151693-151723	3	0.903
NZ_CP016270_1	1.36\|322768\|31\|NZ_CP016270\|CRT	322768-322798	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157354-157384	3	0.903
NZ_CP016270_1	1.36\|322768\|31\|NZ_CP016270\|CRT	322768-322798	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157516-157546	3	0.903
NZ_CP016270_1	1.36\|322768\|31\|NZ_CP016270\|CRT	322768-322798	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1561-1591	3	0.903
NZ_CP016270_1	1.37\|322822\|31\|NZ_CP016270\|CRT	322822-322852	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151639-151669	3	0.903
NZ_CP016270_1	1.37\|322822\|31\|NZ_CP016270\|CRT	322822-322852	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151693-151723	3	0.903
NZ_CP016270_1	1.37\|322822\|31\|NZ_CP016270\|CRT	322822-322852	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157354-157384	3	0.903
NZ_CP016270_1	1.37\|322822\|31\|NZ_CP016270\|CRT	322822-322852	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157516-157546	3	0.903
NZ_CP016270_1	1.37\|322822\|31\|NZ_CP016270\|CRT	322822-322852	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1561-1591	3	0.903
NZ_CP016270_1	1.40\|323026\|31\|NZ_CP016270\|CRT	323026-323056	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1543-1573	3	0.903
NZ_CP016270_1	1.40\|323026\|31\|NZ_CP016270\|CRT	323026-323056	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2275-2305	3	0.903
NZ_CP016270_1	1.40\|323026\|31\|NZ_CP016270\|CRT	323026-323056	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3043-3073	3	0.903
NZ_CP016270_1	1.40\|323026\|31\|NZ_CP016270\|CRT	323026-323056	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156322-156352	3	0.903
NZ_CP016270_1	1.40\|323026\|31\|NZ_CP016270\|CRT	323026-323056	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157300-157330	3	0.903
NZ_CP016270_1	1.40\|323026\|31\|NZ_CP016270\|CRT	323026-323056	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157426-157456	3	0.903
NZ_CP016270_1	1.42\|323164\|31\|NZ_CP016270\|CRT	323164-323194	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151639-151669	3	0.903
NZ_CP016270_1	1.42\|323164\|31\|NZ_CP016270\|CRT	323164-323194	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151693-151723	3	0.903
NZ_CP016270_1	1.42\|323164\|31\|NZ_CP016270\|CRT	323164-323194	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157354-157384	3	0.903
NZ_CP016270_1	1.42\|323164\|31\|NZ_CP016270\|CRT	323164-323194	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157516-157546	3	0.903
NZ_CP016270_1	1.42\|323164\|31\|NZ_CP016270\|CRT	323164-323194	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1561-1591	3	0.903
NZ_CP016270_1	1.47\|323512\|31\|NZ_CP016270\|CRT	323512-323542	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151459-151489	3	0.903
NZ_CP016270_1	1.47\|323512\|31\|NZ_CP016270\|CRT	323512-323542	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156322-156352	3	0.903
NZ_CP016270_1	1.47\|323512\|31\|NZ_CP016270\|CRT	323512-323542	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156340-156370	3	0.903
NZ_CP016270_1	1.47\|323512\|31\|NZ_CP016270\|CRT	323512-323542	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156358-156388	3	0.903
NZ_CP016270_1	1.47\|323512\|31\|NZ_CP016270\|CRT	323512-323542	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3043-3073	3	0.903
NZ_CP016270_1	1.48\|323566\|31\|NZ_CP016270\|CRT	323566-323596	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151531-151561	3	0.903
NZ_CP016270_1	1.48\|323566\|31\|NZ_CP016270\|CRT	323566-323596	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151567-151597	3	0.903
NZ_CP016270_1	1.48\|323566\|31\|NZ_CP016270\|CRT	323566-323596	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154042-154072	3	0.903
NZ_CP016270_1	1.48\|323566\|31\|NZ_CP016270\|CRT	323566-323596	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154738-154768	3	0.903
NZ_CP016270_1	1.48\|323566\|31\|NZ_CP016270\|CRT	323566-323596	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154936-154966	3	0.903
NZ_CP016270_1	1.48\|323566\|31\|NZ_CP016270\|CRT	323566-323596	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155134-155164	3	0.903
NZ_CP016270_1	1.48\|323566\|31\|NZ_CP016270\|CRT	323566-323596	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155368-155398	3	0.903
NZ_CP016270_1	1.48\|323566\|31\|NZ_CP016270\|CRT	323566-323596	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155848-155878	3	0.903
NZ_CP016270_1	1.48\|323566\|31\|NZ_CP016270\|CRT	323566-323596	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155902-155932	3	0.903
NZ_CP016270_1	1.48\|323566\|31\|NZ_CP016270\|CRT	323566-323596	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156322-156352	3	0.903
NZ_CP016270_1	1.48\|323566\|31\|NZ_CP016270\|CRT	323566-323596	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156790-156820	3	0.903
NZ_CP016270_1	1.48\|323566\|31\|NZ_CP016270\|CRT	323566-323596	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156958-156988	3	0.903
NZ_CP016270_1	1.48\|323566\|31\|NZ_CP016270\|CRT	323566-323596	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157192-157222	3	0.903
NZ_CP016270_1	1.48\|323566\|31\|NZ_CP016270\|CRT	323566-323596	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157300-157330	3	0.903
NZ_CP016270_1	1.48\|323566\|31\|NZ_CP016270\|CRT	323566-323596	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157426-157456	3	0.903
NZ_CP016270_1	1.48\|323566\|31\|NZ_CP016270\|CRT	323566-323596	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1543-1573	3	0.903
NZ_CP016270_1	1.48\|323566\|31\|NZ_CP016270\|CRT	323566-323596	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3133-3163	3	0.903
NZ_CP016270_1	1.48\|323566\|31\|NZ_CP016270\|CRT	323566-323596	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2275-2305	3	0.903
NZ_CP016270_1	1.48\|323566\|31\|NZ_CP016270\|CRT	323566-323596	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3043-3073	3	0.903
NZ_CP016270_1	1.20\|321886\|31\|NZ_CP016270\|CRT	321886-321916	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151459-151489	4	0.871
NZ_CP016270_1	1.20\|321886\|31\|NZ_CP016270\|CRT	321886-321916	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151969-151999	4	0.871
NZ_CP016270_1	1.20\|321886\|31\|NZ_CP016270\|CRT	321886-321916	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153208-153238	4	0.871
NZ_CP016270_1	1.22\|321994\|31\|NZ_CP016270\|CRT	321994-322024	31	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21070-21100	4	0.871
NZ_CP016270_1	1.22\|321994\|31\|NZ_CP016270\|CRT	321994-322024	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15457-15487	4	0.871
NZ_CP016270_1	1.22\|321994\|31\|NZ_CP016270\|CRT	321994-322024	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15565-15595	4	0.871
NZ_CP016270_1	1.22\|321994\|31\|NZ_CP016270\|CRT	321994-322024	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15691-15721	4	0.871
NZ_CP016270_1	1.22\|321994\|31\|NZ_CP016270\|CRT	321994-322024	31	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9628-9658	4	0.871
NZ_CP016270_1	1.26\|322216\|31\|NZ_CP016270\|CRT	322216-322246	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156430-156460	4	0.871
NZ_CP016270_1	1.26\|322216\|31\|NZ_CP016270\|CRT	322216-322246	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1003-1033	4	0.871
NZ_CP016270_1	1.46\|323440\|49\|NZ_CP016270\|CRT	323440-323488	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155008-155056	4	0.918
NZ_CP016270_1	1.46\|323440\|49\|NZ_CP016270\|CRT	323440-323488	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155188-155236	4	0.918
NZ_CP016270_1	1.46\|323440\|49\|NZ_CP016270\|CRT	323440-323488	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155242-155290	4	0.918
NZ_CP016270_1	1.46\|323440\|49\|NZ_CP016270\|CRT	323440-323488	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151351-151399	4	0.918
NZ_CP016270_1	1.47\|323512\|31\|NZ_CP016270\|CRT	323512-323542	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154648-154678	4	0.871
NZ_CP016270_1	1.48\|323566\|31\|NZ_CP016270\|CRT	323566-323596	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151879-151909	4	0.871
NZ_CP016270_1	1.48\|323566\|31\|NZ_CP016270\|CRT	323566-323596	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2635-2665	4	0.871
NZ_CP016270_2	2.8\|2455800\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455800-2455829	30	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	284024-284053	4	0.867
NZ_CP016270_1	1.11\|321238\|31\|NZ_CP016270\|CRT	321238-321268	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153826-153856	5	0.839
NZ_CP016270_1	1.11\|321238\|31\|NZ_CP016270\|CRT	321238-321268	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156100-156130	5	0.839
NZ_CP016270_1	1.11\|321238\|31\|NZ_CP016270\|CRT	321238-321268	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156574-156604	5	0.839
NZ_CP016270_1	1.35\|322714\|31\|NZ_CP016270\|CRT	322714-322744	31	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21142-21172	5	0.839
NZ_CP016270_1	1.35\|322714\|31\|NZ_CP016270\|CRT	322714-322744	31	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21340-21370	5	0.839
NZ_CP016270_1	1.35\|322714\|31\|NZ_CP016270\|CRT	322714-322744	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15943-15973	5	0.839
NZ_CP016270_1	1.35\|322714\|31\|NZ_CP016270\|CRT	322714-322744	31	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9700-9730	5	0.839
NZ_CP016270_1	1.35\|322714\|31\|NZ_CP016270\|CRT	322714-322744	31	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9844-9874	5	0.839
NZ_CP016270_1	1.20\|321886\|31\|NZ_CP016270\|CRT	321886-321916	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154096-154126	6	0.806
NZ_CP016270_1	1.20\|321886\|31\|NZ_CP016270\|CRT	321886-321916	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154132-154162	6	0.806
NZ_CP016270_1	1.21\|321940\|31\|NZ_CP016270\|CRT	321940-321970	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1183-1213	6	0.806
NZ_CP016270_1	1.24\|322090\|31\|NZ_CP016270\|CRT	322090-322120	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154276-154306	6	0.806
NZ_CP016270_1	1.24\|322090\|31\|NZ_CP016270\|CRT	322090-322120	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155458-155488	6	0.806
NZ_CP016270_1	1.24\|322090\|31\|NZ_CP016270\|CRT	322090-322120	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156238-156268	6	0.806
NZ_CP016270_1	1.24\|322090\|31\|NZ_CP016270\|CRT	322090-322120	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1165-1195	6	0.806
NZ_CP016270_1	1.26\|322216\|31\|NZ_CP016270\|CRT	322216-322246	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155458-155488	6	0.806
NZ_CP016270_1	1.26\|322216\|31\|NZ_CP016270\|CRT	322216-322246	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156238-156268	6	0.806
NZ_CP016270_1	1.28\|322342\|31\|NZ_CP016270\|CRT	322342-322372	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155458-155488	6	0.806
NZ_CP016270_1	1.28\|322342\|31\|NZ_CP016270\|CRT	322342-322372	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156238-156268	6	0.806
NZ_CP016270_1	1.35\|322714\|31\|NZ_CP016270\|CRT	322714-322744	31	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21286-21316	6	0.806
NZ_CP016270_1	1.35\|322714\|31\|NZ_CP016270\|CRT	322714-322744	31	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21304-21334	6	0.806
NZ_CP016270_1	1.35\|322714\|31\|NZ_CP016270\|CRT	322714-322744	31	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21358-21388	6	0.806
NZ_CP016270_1	1.35\|322714\|31\|NZ_CP016270\|CRT	322714-322744	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15763-15793	6	0.806
NZ_CP016270_1	1.35\|322714\|31\|NZ_CP016270\|CRT	322714-322744	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15907-15937	6	0.806
NZ_CP016270_1	1.35\|322714\|31\|NZ_CP016270\|CRT	322714-322744	31	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9988-10018	6	0.806
NZ_CP016270_1	1.35\|322714\|31\|NZ_CP016270\|CRT	322714-322744	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18575-18605	6	0.806
NZ_CP016270_1	1.40\|323026\|31\|NZ_CP016270\|CRT	323026-323056	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1183-1213	6	0.806
NZ_CP016270_1	1.43\|323218\|49\|NZ_CP016270\|CRT	323218-323266	49	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1903-1951	6	0.878
NZ_CP016270_1	1.47\|323512\|31\|NZ_CP016270\|CRT	323512-323542	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154558-154588	6	0.806
NZ_CP016270_1	1.48\|323566\|31\|NZ_CP016270\|CRT	323566-323596	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1183-1213	6	0.806
NZ_CP016270_2	2.4\|2455535\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455535-2455564	30	NZ_CP032366	Bacillus wiedmannii strain SR52 plasmid unnamed1, complete sequence	46601-46630	6	0.8
NZ_CP016270_2	2.6\|2455668\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455668-2455697	30	NZ_KX258624	Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence	33713-33742	6	0.8
NZ_CP016270_2	2.8\|2455800\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455800-2455829	30	AB981169	Ralstonia phage RSY1 DNA, complete genome	19536-19565	6	0.8
NZ_CP016270_2	2.8\|2455800\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455800-2455829	30	NC_049432	Ralstonia phage RsoM1USA, complete genome	13669-13698	6	0.8
NZ_CP016270_2	2.8\|2455800\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455800-2455829	30	NZ_CP039965	Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence	1133280-1133309	6	0.8
NZ_CP016270_1	1.11\|321238\|31\|NZ_CP016270\|CRT	321238-321268	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2131-2161	7	0.774
NZ_CP016270_1	1.20\|321886\|31\|NZ_CP016270\|CRT	321886-321916	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153826-153856	7	0.774
NZ_CP016270_1	1.20\|321886\|31\|NZ_CP016270\|CRT	321886-321916	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156100-156130	7	0.774
NZ_CP016270_1	1.20\|321886\|31\|NZ_CP016270\|CRT	321886-321916	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156574-156604	7	0.774
NZ_CP016270_1	1.20\|321886\|31\|NZ_CP016270\|CRT	321886-321916	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154558-154588	7	0.774
NZ_CP016270_1	1.20\|321886\|31\|NZ_CP016270\|CRT	321886-321916	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154828-154858	7	0.774
NZ_CP016270_1	1.20\|321886\|31\|NZ_CP016270\|CRT	321886-321916	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155794-155824	7	0.774
NZ_CP016270_1	1.27\|322270\|49\|NZ_CP016270\|CRT	322270-322318	49	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17339-17387	7	0.857
NZ_CP016270_1	1.27\|322270\|49\|NZ_CP016270\|CRT	322270-322318	49	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18653-18701	7	0.857
NZ_CP016270_1	1.30\|322450\|31\|NZ_CP016270\|CRT	322450-322480	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154288-154318	7	0.774
NZ_CP016270_1	1.30\|322450\|31\|NZ_CP016270\|CRT	322450-322480	31	MH632120	Mycobacterium phage Thonko, complete genome	31507-31537	7	0.774
NZ_CP016270_1	1.35\|322714\|31\|NZ_CP016270\|CRT	322714-322744	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15745-15775	7	0.774
NZ_CP016270_1	1.44\|323290\|55\|NZ_CP016270\|CRT	323290-323344	55	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157552-157606	7	0.873
NZ_CP016270_1	1.44\|323290\|55\|NZ_CP016270\|CRT	323290-323344	55	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151765-151819	7	0.873
NZ_CP016270_1	1.47\|323512\|31\|NZ_CP016270\|CRT	323512-323542	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1183-1213	7	0.774
NZ_CP016270_1	1.48\|323566\|31\|NZ_CP016270\|CRT	323566-323596	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3079-3109	7	0.774
NZ_CP016270_1	1.48\|323566\|31\|NZ_CP016270\|CRT	323566-323596	31	NZ_CP046573	Rhodococcus sp. WAY2 plasmid pRWAY01, complete sequence	20508-20538	7	0.774
NZ_CP016270_1	1.20\|321886\|31\|NZ_CP016270\|CRT	321886-321916	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1183-1213	8	0.742
NZ_CP016270_1	1.22\|321994\|31\|NZ_CP016270\|CRT	321994-322024	31	LC576631	Staphylococcus phage vB_SauH_DELF3 DNA, complete sequence	61670-61700	8	0.742
NZ_CP016270_1	1.24\|322090\|31\|NZ_CP016270\|CRT	322090-322120	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1-28	8	0.742
NZ_CP016270_1	1.24\|322090\|31\|NZ_CP016270\|CRT	322090-322120	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157693-157723	8	0.742
NZ_CP016270_1	1.27\|322270\|49\|NZ_CP016270\|CRT	322270-322318	49	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16049-16097	8	0.837
NZ_CP016270_1	1.35\|322714\|31\|NZ_CP016270\|CRT	322714-322744	31	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21070-21100	8	0.742
NZ_CP016270_1	1.35\|322714\|31\|NZ_CP016270\|CRT	322714-322744	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15457-15487	8	0.742
NZ_CP016270_1	1.35\|322714\|31\|NZ_CP016270\|CRT	322714-322744	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15565-15595	8	0.742
NZ_CP016270_1	1.35\|322714\|31\|NZ_CP016270\|CRT	322714-322744	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15691-15721	8	0.742
NZ_CP016270_1	1.35\|322714\|31\|NZ_CP016270\|CRT	322714-322744	31	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9628-9658	8	0.742
NZ_CP016270_1	1.44\|323290\|55\|NZ_CP016270\|CRT	323290-323344	55	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1057-1111	8	0.855
NZ_CP016270_1	1.44\|323290\|55\|NZ_CP016270\|CRT	323290-323344	55	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1735-1789	8	0.855
NZ_CP016270_1	1.44\|323290\|55\|NZ_CP016270\|CRT	323290-323344	55	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3361-3415	8	0.855
NZ_CP016270_1	1.29\|322396\|31\|NZ_CP016270\|CRT	322396-322426	31	MT773554	Myoviridae sp. isolate BML_2 genomic sequence	115519-115549	9	0.71
NZ_CP016270_1	1.30\|322450\|31\|NZ_CP016270\|CRT	322450-322480	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1-28	9	0.71
NZ_CP016270_1	1.36\|322768\|31\|NZ_CP016270\|CRT	322768-322798	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1-28	9	0.71
NZ_CP016270_1	1.36\|322768\|31\|NZ_CP016270\|CRT	322768-322798	31	JQ067084	Pseudomonas phage PaMx25, complete genome	24081-24111	9	0.71
NZ_CP016270_1	1.37\|322822\|31\|NZ_CP016270\|CRT	322822-322852	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1-28	9	0.71
NZ_CP016270_1	1.37\|322822\|31\|NZ_CP016270\|CRT	322822-322852	31	JQ067084	Pseudomonas phage PaMx25, complete genome	24081-24111	9	0.71
NZ_CP016270_1	1.42\|323164\|31\|NZ_CP016270\|CRT	323164-323194	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1-28	9	0.71
NZ_CP016270_1	1.42\|323164\|31\|NZ_CP016270\|CRT	323164-323194	31	JQ067084	Pseudomonas phage PaMx25, complete genome	24081-24111	9	0.71
NZ_CP016270_1	1.43\|323218\|49\|NZ_CP016270\|CRT	323218-323266	49	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2101-2149	9	0.816
NZ_CP016270_2	2.6\|2455668\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455668-2455697	30	NC_014633	Ilyobacter polytropus DSM 2926 plasmid pILYOP01, complete sequence	881825-881854	9	0.7
NZ_CP016270_2	2.6\|2455668\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455668-2455697	30	NZ_CP047429	Spiroplasma citri strain BLH-13 plasmid pSciBLH13-1, complete sequence	16481-16510	9	0.7
NZ_CP016270_2	2.6\|2455668\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455668-2455697	30	NC_010182	Bacillus mycoides KBAB4 plasmid pBWB403, complete sequence	58269-58298	9	0.7
NZ_CP016270_2	2.6\|2455668\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455668-2455697	30	NZ_CP046373	Spiroplasma citri strain LB 319 plasmid pScpLB319-2, complete sequence	19849-19878	9	0.7
NZ_CP016270_2	2.4\|2455535\|30\|NZ_CP016270\|PILER-CR,CRISPRCasFinder,CRT	2455535-2455564	30	NZ_CP016179	Vibrio breoganii strain FF50 plasmid unnamed1, complete sequence	68555-68584	10	0.667
NZ_CP016270_1	1.44\|323290\|55\|NZ_CP016270\|CRT	323290-323344	55	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154204-154258	11	0.8
NZ_CP016270_1	1.44\|323290\|55\|NZ_CP016270\|CRT	323290-323344	55	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156556-156610	11	0.8
NZ_CP016270_1	1.44\|323290\|55\|NZ_CP016270\|CRT	323290-323344	55	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154168-154222	12	0.782

1. spacer 1.33|322618|19|NZ_CP016270|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cagcgattcagactcagat	CRISPR spacer
cagcgattcagactcagat	Protospacer
*******************

2. spacer 1.33|322618|19|NZ_CP016270|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cagcgattcagactcagat	CRISPR spacer
cagcgattcagactcagat	Protospacer
*******************

3. spacer 2.7|2455734|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032752 (Lactobacillus plantarum subsp. argentoratensis strain DSM 16365 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gattaaatgcaagtactgtctttcgaatat	CRISPR spacer
gattaaatgcaagtactgtctttcgaatat	Protospacer
******************************

4. spacer 2.7|2455734|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021472 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-2, complete sequence) position: , mismatch: 0, identity: 1.0

gattaaatgcaagtactgtctttcgaatat	CRISPR spacer
gattaaatgcaagtactgtctttcgaatat	Protospacer
******************************

5. spacer 2.7|2455734|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017356 (Lactobacillus plantarum strain TMW 1.25 plasmid pL125-2, complete sequence) position: , mismatch: 0, identity: 1.0

gattaaatgcaagtactgtctttcgaatat	CRISPR spacer
gattaaatgcaagtactgtctttcgaatat	Protospacer
******************************

6. spacer 2.7|2455734|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017366 (Lactobacillus plantarum strain TMW 1.277 plasmid pL1277-3, complete sequence) position: , mismatch: 0, identity: 1.0

gattaaatgcaagtactgtctttcgaatat	CRISPR spacer
gattaaatgcaagtactgtctttcgaatat	Protospacer
******************************

7. spacer 2.7|2455734|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017381 (Lactobacillus plantarum strain TMW 1.1623 plasmid pL11623-2, complete sequence) position: , mismatch: 0, identity: 1.0

gattaaatgcaagtactgtctttcgaatat	CRISPR spacer
gattaaatgcaagtactgtctttcgaatat	Protospacer
******************************

8. spacer 2.7|2455734|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP018868 (Lactobacillus alimentarius DSM 20249 plasmid pLDW-11, complete sequence) position: , mismatch: 0, identity: 1.0

gattaaatgcaagtactgtctttcgaatat	CRISPR spacer
gattaaatgcaagtactgtctttcgaatat	Protospacer
******************************

9. spacer 2.7|2455734|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028231 (Lactobacillus plantarum strain SRCM101222 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gattaaatgcaagtactgtctttcgaatat	CRISPR spacer
gattaaatgcaagtactgtctttcgaatat	Protospacer
******************************

10. spacer 2.7|2455734|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035557 (Lactobacillus plantarum strain SRCM103297 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gattaaatgcaagtactgtctttcgaatat	CRISPR spacer
gattaaatgcaagtactgtctttcgaatat	Protospacer
******************************

11. spacer 2.7|2455734|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035557 (Lactobacillus plantarum strain SRCM103297 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gattaaatgcaagtactgtctttcgaatat	CRISPR spacer
gattaaatgcaagtactgtctttcgaatat	Protospacer
******************************

12. spacer 2.7|2455734|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021933 (Lactobacillus plantarum strain TMW 1.1478 plasmid pL11478-1, complete sequence) position: , mismatch: 0, identity: 1.0

gattaaatgcaagtactgtctttcgaatat	CRISPR spacer
gattaaatgcaagtactgtctttcgaatat	Protospacer
******************************

13. spacer 2.7|2455734|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016492 (Lactobacillus pentosus strain BGM48 plasmid pBGM48-1, complete sequence) position: , mismatch: 0, identity: 1.0

gattaaatgcaagtactgtctttcgaatat	CRISPR spacer
gattaaatgcaagtactgtctttcgaatat	Protospacer
******************************

14. spacer 2.7|2455734|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NC_022114 (Lactobacillus paracasei subsp. paracasei 8700:2 plasmid 1, complete sequence) position: , mismatch: 0, identity: 1.0

gattaaatgcaagtactgtctttcgaatat	CRISPR spacer
gattaaatgcaagtactgtctttcgaatat	Protospacer
******************************

15. spacer 2.7|2455734|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP014682 (Lactobacillus hokkaidonensis JCM 18461 strain LOOC260 plasmid pLOOC260-2, complete sequence) position: , mismatch: 0, identity: 1.0

gattaaatgcaagtactgtctttcgaatat	CRISPR spacer
gattaaatgcaagtactgtctttcgaatat	Protospacer
******************************

16. spacer 2.7|2455734|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NC_016608 (Pediococcus claussenii ATCC BAA-344 plasmid pPECL-5, complete sequence) position: , mismatch: 0, identity: 1.0

gattaaatgcaagtactgtctttcgaatat	CRISPR spacer
gattaaatgcaagtactgtctttcgaatat	Protospacer
******************************

17. spacer 2.7|2455734|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028242 (Lactobacillus plantarum strain SRCM101518 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gattaaatgcaagtactgtctttcgaatat	CRISPR spacer
gattaaatgcaagtactgtctttcgaatat	Protospacer
******************************

18. spacer 2.7|2455734|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035152 (Pediococcus acidilactici strain SRCM103367 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gattaaatgcaagtactgtctttcgaatat	CRISPR spacer
gattaaatgcaagtactgtctttcgaatat	Protospacer
******************************

19. spacer 1.30|322450|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

ttccgactctgatagcgactccgattccgac	CRISPR spacer
ttccgactctgacagcgactccgattccgac	Protospacer
************.******************

20. spacer 1.36|322768|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

ttccgactcagacagtgattccgattccgac	CRISPR spacer
ttccgactccgacagtgattccgattccgac	Protospacer
********* *********************

21. spacer 1.37|322822|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

ttccgactcagacagtgattccgattccgac	CRISPR spacer
ttccgactccgacagtgattccgattccgac	Protospacer
********* *********************

22. spacer 1.42|323164|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

ttccgactcagacagtgattccgattccgac	CRISPR spacer
ttccgactccgacagtgattccgattccgac	Protospacer
********* *********************

23. spacer 2.2|2455403|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to AY682195 (Lactobacillus plantarum bacteriophage LP65, complete genome) position: , mismatch: 1, identity: 0.967

tcaaattaagaatgccgtagccacaattac	CRISPR spacer
tcaaattaagaataccgtagccacaattac	Protospacer
*************.****************

24. spacer 2.2|2455403|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NC_006565 (Lactobacillus phage LP65, complete genome) position: , mismatch: 1, identity: 0.967

tcaaattaagaatgccgtagccacaattac	CRISPR spacer
tcaaattaagaataccgtagccacaattac	Protospacer
*************.****************

25. spacer 2.7|2455734|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP046657 (Lactobacillus plantarum strain 123-17 plasmid p123-18.1, complete sequence) position: , mismatch: 1, identity: 0.967

gattaaatgcaagtactgtctttcgaatat	CRISPR spacer
gattaaatgcaggtactgtctttcgaatat	Protospacer
***********.******************

26. spacer 1.11|321238|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

ttccgactccgatagtgattcggattctgac	CRISPR spacer
ttccgactccgacagtgattcggactctgac	Protospacer
************.***********.******

27. spacer 1.11|321238|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

ttccgactccgatagtgattcggattctgac	CRISPR spacer
ttccgactccgacagcgattcggattctgac	Protospacer
************.**.***************

28. spacer 1.20|321886|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

ttcagattccgacagcgattcggattcggat	CRISPR spacer
ttcggattccgacagcgattcggattcggac	Protospacer
***.**************************.

29. spacer 1.21|321940|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

ttcggattccgatagtgattcggactcagac	CRISPR spacer
ttcggattccgacagtgattcggactcggac	Protospacer
************.**************.***

30. spacer 1.22|321994|31|NZ_CP016270|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 2, identity: 0.935

ctcagattcagacagtgattctgactcagac	CRISPR spacer
ctccgattcagacagtgattcagactcagac	Protospacer
*** ***************** *********

31. spacer 1.22|321994|31|NZ_CP016270|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.935

ctcagattcagacagtgattctgactcagac	CRISPR spacer
ctccgattcagacagtgattcagactcagac	Protospacer
*** ***************** *********

32. spacer 1.22|321994|31|NZ_CP016270|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.935

ctcagattcagacagtgattctgactcagac	CRISPR spacer
ctccgattcagacagtgattcagactcagac	Protospacer
*** ***************** *********

33. spacer 1.22|321994|31|NZ_CP016270|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.935

ctcagattcagacagtgattctgactcagac	CRISPR spacer
ctccgattcagacagtgattcagactcagac	Protospacer
*** ***************** *********

34. spacer 1.22|321994|31|NZ_CP016270|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 2, identity: 0.935

ctcagattcagacagtgattctgactcagac	CRISPR spacer
ctccgattcagacagtgattcagactcagac	Protospacer
*** ***************** *********

35. spacer 1.30|322450|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

ttccgactctgatagcgactccgattccgac	CRISPR spacer
ttccgactctgacagcgactcggattccgac	Protospacer
************.******** *********

36. spacer 1.30|322450|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

ttccgactctgatagcgactccgattccgac	CRISPR spacer
ttccgactctgacagcgactcggattccgac	Protospacer
************.******** *********

37. spacer 1.30|322450|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

ttccgactctgatagcgactccgattccgac	CRISPR spacer
ttccgactctgacagcgactcggattccgac	Protospacer
************.******** *********

38. spacer 1.30|322450|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

ttccgactctgatagcgactccgattccgac	CRISPR spacer
ttccgactctgacagcgactcggattccgac	Protospacer
************.******** *********

39. spacer 1.36|322768|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

ttccgactcagacagtgattccgattccgac	CRISPR spacer
ttccgactccgacagtgattccgactccgac	Protospacer
********* **************.******

40. spacer 1.37|322822|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

ttccgactcagacagtgattccgattccgac	CRISPR spacer
ttccgactccgacagtgattccgactccgac	Protospacer
********* **************.******

41. spacer 1.42|323164|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

ttccgactcagacagtgattccgattccgac	CRISPR spacer
ttccgactccgacagtgattccgactccgac	Protospacer
********* **************.******

42. spacer 1.47|323512|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

ctcagattcggacagtgattcggattcggat	CRISPR spacer
ctccgattcggacagtgattcggattcggac	Protospacer
*** **************************.

43. spacer 1.48|323566|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

ctcggattccgacagtgattccgactcggat	CRISPR spacer
ctcggattccgacagtgactccgattcggat	Protospacer
******************.*****.******

44. spacer 2.6|2455668|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to AY682195 (Lactobacillus plantarum bacteriophage LP65, complete genome) position: , mismatch: 2, identity: 0.933

gctatactataaacatatataaggaaagga	CRISPR spacer
ggtatactataaacatagataaggaaagga	Protospacer
* *************** ************

45. spacer 2.6|2455668|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NC_006565 (Lactobacillus phage LP65, complete genome) position: , mismatch: 2, identity: 0.933

gctatactataaacatatataaggaaagga	CRISPR spacer
ggtatactataaacatagataaggaaagga	Protospacer
* *************** ************

46. spacer 1.11|321238|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

ttccgactccgatagtgattcggattctgac	CRISPR spacer
ctccgactccgacagtgattcggattccgac	Protospacer
.***********.**************.***

47. spacer 1.11|321238|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

ttccgactccgatagtgattcggattctgac	CRISPR spacer
ctccgactccgacagcgattcggattctgac	Protospacer
.***********.**.***************

48. spacer 1.20|321886|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ttcagattccgacagcgattcggattcggat	CRISPR spacer
ctcggattccgacagcgattcggattcggac	Protospacer
.**.**************************.

49. spacer 1.20|321886|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ttcagattccgacagcgattcggattcggat	CRISPR spacer
ctcggattccgacagcgattcggattcggac	Protospacer
.**.**************************.

50. spacer 1.20|321886|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ttcagattccgacagcgattcggattcggat	CRISPR spacer
ctcggattccgacagcgattcggattcggac	Protospacer
.**.**************************.

51. spacer 1.20|321886|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ttcagattccgacagcgattcggattcggat	CRISPR spacer
ctcggattccgacagcgattcggattcggac	Protospacer
.**.**************************.

52. spacer 1.20|321886|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ttcagattccgacagcgattcggattcggat	CRISPR spacer
ctcggattccgacagcgattcggattcggac	Protospacer
.**.**************************.

53. spacer 1.20|321886|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ttcagattccgacagcgattcggattcggat	CRISPR spacer
ttccgattccgacagcgactcggattcggac	Protospacer
*** **************.***********.

54. spacer 1.20|321886|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ttcagattccgacagcgattcggattcggat	CRISPR spacer
ttcggattcggacagcgattcggattcggac	Protospacer
***.***** ********************.

55. spacer 1.20|321886|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ttcagattccgacagcgattcggattcggat	CRISPR spacer
ttccgattccgacagcgattcggactcggac	Protospacer
*** ********************.*****.

56. spacer 1.20|321886|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

ttcagattccgacagcgattcggattcggat	CRISPR spacer
ttccgattccgacagcgattcggattccgac	Protospacer
*** *********************** **.

57. spacer 1.24|322090|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

ttccgactctgatagtgactccgactctgat	CRISPR spacer
ttccgactctgacagtgactccgactccgac	Protospacer
************.**************.**.

58. spacer 1.26|322216|31|NZ_CP016270|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.903

ctcagactcagacagtgattccgactccgat	CRISPR spacer
ttcagactcagacagtgattcagactcagat	Protospacer
.******************** ***** ***

59. spacer 1.26|322216|31|NZ_CP016270|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

ctcagactcagacagtgattccgactccgat	CRISPR spacer
ttcagactcagacagtgattcagactcagat	Protospacer
.******************** ***** ***

60. spacer 1.26|322216|31|NZ_CP016270|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

ctcagactcagacagtgattccgactccgat	CRISPR spacer
ttcagactcagacagtgattcagactcagat	Protospacer
.******************** ***** ***

61. spacer 1.26|322216|31|NZ_CP016270|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

ctcagactcagacagtgattccgactccgat	CRISPR spacer
ttcagactcagacagtgattcagactcagat	Protospacer
.******************** ***** ***

62. spacer 1.26|322216|31|NZ_CP016270|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.903

ctcagactcagacagtgattccgactccgat	CRISPR spacer
ttcagactcagacagtgattcagactcagat	Protospacer
.******************** ***** ***

63. spacer 1.30|322450|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ttccgactctgatagcgactccgattccgac	CRISPR spacer
ctcggactctgacagcgactccgattccgac	Protospacer
.** ********.******************

64. spacer 1.30|322450|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

ttccgactctgatagcgactccgattccgac	CRISPR spacer
ctctgactctgacagcgactccgattccgac	Protospacer
.**.********.******************

65. spacer 1.36|322768|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ttccgactcagacagtgattccgattccgac	CRISPR spacer
ctcggactctgacagtgattccgattccgac	Protospacer
.** ***** *********************

66. spacer 1.36|322768|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ttccgactcagacagtgattccgattccgac	CRISPR spacer
ctcggactctgacagtgattccgattccgac	Protospacer
.** ***** *********************

67. spacer 1.36|322768|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ttccgactcagacagtgattccgattccgac	CRISPR spacer
ctcggactctgacagtgattccgattccgac	Protospacer
.** ***** *********************

68. spacer 1.36|322768|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ttccgactcagacagtgattccgattccgac	CRISPR spacer
ctcggactctgacagtgattccgattccgac	Protospacer
.** ***** *********************

69. spacer 1.36|322768|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

ttccgactcagacagtgattccgattccgac	CRISPR spacer
ctccgactccgacagtgattcggattccgac	Protospacer
.******** *********** *********

70. spacer 1.37|322822|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ttccgactcagacagtgattccgattccgac	CRISPR spacer
ctcggactctgacagtgattccgattccgac	Protospacer
.** ***** *********************

71. spacer 1.37|322822|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ttccgactcagacagtgattccgattccgac	CRISPR spacer
ctcggactctgacagtgattccgattccgac	Protospacer
.** ***** *********************

72. spacer 1.37|322822|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ttccgactcagacagtgattccgattccgac	CRISPR spacer
ctcggactctgacagtgattccgattccgac	Protospacer
.** ***** *********************

73. spacer 1.37|322822|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ttccgactcagacagtgattccgattccgac	CRISPR spacer
ctcggactctgacagtgattccgattccgac	Protospacer
.** ***** *********************

74. spacer 1.37|322822|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

ttccgactcagacagtgattccgattccgac	CRISPR spacer
ctccgactccgacagtgattcggattccgac	Protospacer
.******** *********** *********

75. spacer 1.40|323026|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

ctcggattccgatagtgattcggactcggat	CRISPR spacer
ttcggattccgacagtgattcggactcggac	Protospacer
.***********.*****************.

76. spacer 1.40|323026|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

ctcggattccgatagtgattcggactcggat	CRISPR spacer
ctcggattctgacagtgattcggactcggac	Protospacer
*********.**.*****************.

77. spacer 1.40|323026|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

ctcggattccgatagtgattcggactcggat	CRISPR spacer
ctcggattcggacagtgattcggactcggac	Protospacer
********* **.*****************.

78. spacer 1.40|323026|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ctcggattccgatagtgattcggactcggat	CRISPR spacer
ctcggattcggacagtgattcggactcggac	Protospacer
********* **.*****************.

79. spacer 1.40|323026|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ctcggattccgatagtgattcggactcggat	CRISPR spacer
ctccgattccgacagtgattcggactcggac	Protospacer
*** ********.*****************.

80. spacer 1.40|323026|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ctcggattccgatagtgattcggactcggat	CRISPR spacer
ctcggactccgacagtgattcggactcggac	Protospacer
******.*****.*****************.

81. spacer 1.42|323164|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ttccgactcagacagtgattccgattccgac	CRISPR spacer
ctcggactctgacagtgattccgattccgac	Protospacer
.** ***** *********************

82. spacer 1.42|323164|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ttccgactcagacagtgattccgattccgac	CRISPR spacer
ctcggactctgacagtgattccgattccgac	Protospacer
.** ***** *********************

83. spacer 1.42|323164|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ttccgactcagacagtgattccgattccgac	CRISPR spacer
ctcggactctgacagtgattccgattccgac	Protospacer
.** ***** *********************

84. spacer 1.42|323164|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ttccgactcagacagtgattccgattccgac	CRISPR spacer
ctcggactctgacagtgattccgattccgac	Protospacer
.** ***** *********************

85. spacer 1.42|323164|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

ttccgactcagacagtgattccgattccgac	CRISPR spacer
ctccgactccgacagtgattcggattccgac	Protospacer
.******** *********** *********

86. spacer 1.47|323512|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ctcagattcggacagtgattcggattcggat	CRISPR spacer
ctcggattcggacagcgattcggattcggac	Protospacer
***.***********.**************.

87. spacer 1.47|323512|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ctcagattcggacagtgattcggattcggat	CRISPR spacer
ctcggattcggacagtgattcggactcggac	Protospacer
***.********************.*****.

88. spacer 1.47|323512|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ctcagattcggacagtgattcggattcggat	CRISPR spacer
ctcggattcggacagtgactcggattcggac	Protospacer
***.**************.***********.

89. spacer 1.47|323512|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ctcagattcggacagtgattcggattcggat	CRISPR spacer
ctccgattcggacagtgactcggattcggac	Protospacer
*** **************.***********.

90. spacer 1.47|323512|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

ctcagattcggacagtgattcggattcggat	CRISPR spacer
ctcggattcggacagtgattcggactcggac	Protospacer
***.********************.*****.

91. spacer 1.48|323566|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ctcggattccgacagtgattccgactcggat	CRISPR spacer
ctcggattccgacagcgattccgactccgac	Protospacer
***************.*********** **.

92. spacer 1.48|323566|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ctcggattccgacagtgattccgactcggat	CRISPR spacer
ctcggattccgacagcgattccgactccgac	Protospacer
***************.*********** **.

93. spacer 1.48|323566|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ctcggattccgacagtgattccgactcggat	CRISPR spacer
ctcggattccgacagtgactccgattcggac	Protospacer
******************.*****.*****.

94. spacer 1.48|323566|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ctcggattccgacagtgattccgactcggat	CRISPR spacer
ctcggactccgacagtgattccgattcggac	Protospacer
******.*****************.*****.

95. spacer 1.48|323566|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ctcggattccgacagtgattccgactcggat	CRISPR spacer
ctcggactccgacagtgattccgattcggac	Protospacer
******.*****************.*****.

96. spacer 1.48|323566|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ctcggattccgacagtgattccgactcggat	CRISPR spacer
ctcggactccgacagtgattccgattcggac	Protospacer
******.*****************.*****.

97. spacer 1.48|323566|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ctcggattccgacagtgattccgactcggat	CRISPR spacer
ctcggactccgacagtgattccgattcggac	Protospacer
******.*****************.*****.

98. spacer 1.48|323566|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ctcggattccgacagtgattccgactcggat	CRISPR spacer
ctcggattccgacagcgattccgactctgac	Protospacer
***************.*********** **.

99. spacer 1.48|323566|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ctcggattccgacagtgattccgactcggat	CRISPR spacer
ctcggattccgacagtgactccgattcggac	Protospacer
******************.*****.*****.

100. spacer 1.48|323566|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ctcggattccgacagtgattccgactcggat	CRISPR spacer
ctcggattcggacagtgattcggactcggac	Protospacer
********* *********** ********.

101. spacer 1.48|323566|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ctcggattccgacagtgattccgactcggat	CRISPR spacer
ctcggattccgacagcgattccgactctgac	Protospacer
***************.*********** **.

102. spacer 1.48|323566|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ctcggattccgacagtgattccgactcggat	CRISPR spacer
ctcggattccgacagcgattccgactccgac	Protospacer
***************.*********** **.

103. spacer 1.48|323566|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ctcggattccgacagtgattccgactcggat	CRISPR spacer
ctcggattctgacagtgattccgattcggac	Protospacer
*********.**************.*****.

104. spacer 1.48|323566|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ctcggattccgacagtgattccgactcggat	CRISPR spacer
ctccgattccgacagtgattcggactcggac	Protospacer
*** ***************** ********.

105. spacer 1.48|323566|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

ctcggattccgacagtgattccgactcggat	CRISPR spacer
ctcggactccgacagtgattcggactcggac	Protospacer
******.************** ********.

106. spacer 1.48|323566|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

ctcggattccgacagtgattccgactcggat	CRISPR spacer
ttcggattccgacagtgattcggactcggac	Protospacer
.******************** ********.

107. spacer 1.48|323566|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

ctcggattccgacagtgattccgactcggat	CRISPR spacer
ttcggattccgacagtgattccgactctgac	Protospacer
.************************** **.

108. spacer 1.48|323566|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

ctcggattccgacagtgattccgactcggat	CRISPR spacer
ctcggattctgacagtgattcggactcggac	Protospacer
*********.*********** ********.

109. spacer 1.48|323566|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

ctcggattccgacagtgattccgactcggat	CRISPR spacer
ctcggattcggacagtgattcggactcggac	Protospacer
********* *********** ********.

110. spacer 1.20|321886|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

ttcagattccgacagcgattcggattcggat	CRISPR spacer
ctcggattcggacagcgattcggattcggac	Protospacer
.**.***** ********************.

111. spacer 1.20|321886|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

ttcagattccgacagcgattcggattcggat	CRISPR spacer
ctcggattccgacagcgattcggattctgac	Protospacer
.**.*********************** **.

112. spacer 1.20|321886|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

ttcagattccgacagcgattcggattcggat	CRISPR spacer
ctcggactccgacagcgattcggattcggac	Protospacer
.**.**.***********************.

113. spacer 1.22|321994|31|NZ_CP016270|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 4, identity: 0.871

ctcagattcagacagtgattctgactcagac	CRISPR spacer
ttcagactcagacagtgattcagactcagat	Protospacer
.*****.************** ********.

114. spacer 1.22|321994|31|NZ_CP016270|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

ctcagattcagacagtgattctgactcagac	CRISPR spacer
ttcagactcagacagtgattcagactcagat	Protospacer
.*****.************** ********.

115. spacer 1.22|321994|31|NZ_CP016270|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

ctcagattcagacagtgattctgactcagac	CRISPR spacer
ttcagactcagacagtgattcagactcagat	Protospacer
.*****.************** ********.

116. spacer 1.22|321994|31|NZ_CP016270|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

ctcagattcagacagtgattctgactcagac	CRISPR spacer
ttcagactcagacagtgattcagactcagat	Protospacer
.*****.************** ********.

117. spacer 1.22|321994|31|NZ_CP016270|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 4, identity: 0.871

ctcagattcagacagtgattctgactcagac	CRISPR spacer
ttcagactcagacagtgattcagactcagat	Protospacer
.*****.************** ********.

118. spacer 1.26|322216|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

ctcagactcagacagtgattccgactccgat	CRISPR spacer
ttccgactccgacagtgattccgactccgac	Protospacer
.** ***** ********************.

119. spacer 1.26|322216|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

ctcagactcagacagtgattccgactccgat	CRISPR spacer
ttcagactctgacagcgattccgactccgac	Protospacer
.******** *****.**************.

120. spacer 1.46|323440|49|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.918

ttcggattccgacagcgattcggactctgacagtgattccgactcggat	CRISPR spacer
ctcggattctgacagcgattcggactctgacagtgattccgactctgac	Protospacer
.********.*********************************** **.

121. spacer 1.46|323440|49|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.918

ttcggattccgacagcgattcggactctgacagtgattccgactcggat	CRISPR spacer
ctcggattccgacagcgactcggactctgacagtgattccgactctgac	Protospacer
.*****************.************************** **.

122. spacer 1.46|323440|49|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.918

ttcggattccgacagcgattcggactctgacagtgattccgactcggat	CRISPR spacer
ctcggattctgacagcgattcggactctgacagtgattccgactctgac	Protospacer
.********.*********************************** **.

123. spacer 1.46|323440|49|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.918

ttcggattccgacagcgattcggactctgacagt-gattccgactcggat	CRISPR spacer
ttcggactccgacagcgactcggactctgacagtggattctgactcgga-	Protospacer
******.***********.*************** *****.********

124. spacer 1.47|323512|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

ctcagattcggacagtgattcggattcggat	CRISPR spacer
ttcggattcggacagcgattcggattcggac	Protospacer
.**.***********.**************.

125. spacer 1.48|323566|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

ctcggattccgacagtgattccgactcggat	CRISPR spacer
ttcggactccgacagtgattccgattcggac	Protospacer
.*****.*****************.*****.

126. spacer 1.48|323566|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

ctcggattccgacagtgattccgactcggat	CRISPR spacer
ttcggattccgacagtgactccgactccgac	Protospacer
.*****************.******** **.

127. spacer 2.8|2455800|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 4, identity: 0.867

acgtcggcgaaatcttcacca----cgccgatta	CRISPR spacer
acgtcggcgaaatcttcaccaacaccgccg----	Protospacer
*********************    *****

128. spacer 1.11|321238|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

ttccgactccgatagtgattcggattctgac	CRISPR spacer
cagcgactccgacagcgattcggattctgac	Protospacer
.  *********.**.***************

129. spacer 1.11|321238|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

ttccgactccgatagtgattcggattctgac	CRISPR spacer
cagcgactccgacagcgattcggattctgac	Protospacer
.  *********.**.***************

130. spacer 1.11|321238|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

ttccgactccgatagtgattcggattctgac	CRISPR spacer
cagcgactccgacagcgattcggattctgac	Protospacer
.  *********.**.***************

131. spacer 1.35|322714|31|NZ_CP016270|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 5, identity: 0.839

ctcagactcggacagtgactcagatagcgac	CRISPR spacer
ctcagactcagacagcgactcagattcagac	Protospacer
*********.*****.*********   ***

132. spacer 1.35|322714|31|NZ_CP016270|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 5, identity: 0.839

ctcagactcggacagtgactcagatagcgac	CRISPR spacer
ctcagactcagacagcgactcagattcagac	Protospacer
*********.*****.*********   ***

133. spacer 1.35|322714|31|NZ_CP016270|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

ctcagactcggacagtgactcagatagcgac	CRISPR spacer
ctcagactcagacagcgactcagattcagac	Protospacer
*********.*****.*********   ***

134. spacer 1.35|322714|31|NZ_CP016270|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 5, identity: 0.839

ctcagactcggacagtgactcagatagcgac	CRISPR spacer
ctcagactcagacagcgactcagattcagac	Protospacer
*********.*****.*********   ***

135. spacer 1.35|322714|31|NZ_CP016270|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 5, identity: 0.839

ctcagactcggacagtgactcagatagcgac	CRISPR spacer
ctcagactcagacagcgactcagattcagac	Protospacer
*********.*****.*********   ***

136. spacer 1.20|321886|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

ttcagattccgacagcgattcggattcggat	CRISPR spacer
ttccgactccgacagcgattcggatagtgac	Protospacer
*** **.******************   **.

137. spacer 1.20|321886|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

ttcagattccgacagcgattcggattcggat	CRISPR spacer
ttccgactccgacagcgattcggatagtgac	Protospacer
*** **.******************   **.

138. spacer 1.21|321940|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

ttcggattccgatagtgattcggactcagac	CRISPR spacer
ctctgattccgacagtgattcggacagcgac	Protospacer
.** ********.************   ***

139. spacer 1.24|322090|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

ttccgactctgatagtgactccgactctgat	CRISPR spacer
cagcgactccgacagtgactccgactctgac	Protospacer
.  ******.**.*****************.

140. spacer 1.24|322090|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

ttccgactctgatagtgactccgactctgat	CRISPR spacer
cagcgactctgacagtgattccgactctgac	Protospacer
.  *********.*****.***********.

141. spacer 1.24|322090|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

ttccgactctgatagtgactccgactctgat	CRISPR spacer
cagcgactctgacagtgattccgactctgac	Protospacer
.  *********.*****.***********.

142. spacer 1.24|322090|31|NZ_CP016270|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 6, identity: 0.806

ttccgactctgatagtgactccgactctgat	CRISPR spacer
cagcgactctgacagtgactccgattctgac	Protospacer
.  *********.***********.*****.

143. spacer 1.26|322216|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

ctcagactcagacagtgattccgactccgat	CRISPR spacer
cagcgactctgacagtgattccgactctgac	Protospacer
*   ***** *****************.**.

144. spacer 1.26|322216|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

ctcagactcagacagtgattccgactccgat	CRISPR spacer
cagcgactctgacagtgattccgactctgac	Protospacer
*   ***** *****************.**.

145. spacer 1.28|322342|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

ttctgactctgatagtgattccgactccgac	CRISPR spacer
cagcgactctgacagtgattccgactctgac	Protospacer
.  .********.**************.***

146. spacer 1.28|322342|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

ttctgactctgatagtgattccgactccgac	CRISPR spacer
cagcgactctgacagtgattccgactctgac	Protospacer
.  .********.**************.***

147. spacer 1.35|322714|31|NZ_CP016270|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 6, identity: 0.806

ctcagactcggacagtgactcagatagcgac	CRISPR spacer
ctcagactcagacagcgactcagactcagac	Protospacer
*********.*****.********.   ***

148. spacer 1.35|322714|31|NZ_CP016270|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 6, identity: 0.806

ctcagactcggacagtgactcagatagcgac	CRISPR spacer
ctcagactcagacagcgactcagactcagac	Protospacer
*********.*****.********.   ***

149. spacer 1.35|322714|31|NZ_CP016270|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 6, identity: 0.806

ctcagactcggacagtgactcagatagcgac	CRISPR spacer
ctcagactcagacagcgactcagactcagac	Protospacer
*********.*****.********.   ***

150. spacer 1.35|322714|31|NZ_CP016270|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.806

ctcagactcggacagtgactcagatagcgac	CRISPR spacer
ctcagactcagacagcgactcagactcagac	Protospacer
*********.*****.********.   ***

151. spacer 1.35|322714|31|NZ_CP016270|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.806

ctcagactcggacagtgactcagatagcgac	CRISPR spacer
ctcagactcagacagcgactcagactcagac	Protospacer
*********.*****.********.   ***

152. spacer 1.35|322714|31|NZ_CP016270|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 6, identity: 0.806

ctcagactcggacagtgactcagatagcgac	CRISPR spacer
ctcagactcagacagcgactcagactcagac	Protospacer
*********.*****.********.   ***

153. spacer 1.35|322714|31|NZ_CP016270|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

ctcagactcggacagtgactcagatagcgac	CRISPR spacer
ctcagactcagacagcgactcagactcagac	Protospacer
*********.*****.********.   ***

154. spacer 1.40|323026|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

ctcggattccgatagtgattcggactcggat	CRISPR spacer
ctctgattccgacagtgattcggacagcgac	Protospacer
*** ********.************   **.

155. spacer 1.43|323218|49|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.878

ttccgactcggacagcgactcagactctgacagtgattcggatagcgac	CRISPR spacer
ctccgactcggacagcgactcggactctgacagcgattcggattctgac	Protospacer
.********************.***********.*********  .***

156. spacer 1.47|323512|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

ctcagattcggacagtgattcggattcggat	CRISPR spacer
ctctgattcggacagcgattcggatagcgac	Protospacer
*** ***********.*********   **.

157. spacer 1.48|323566|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

ctcggattccgacagtgattccgactcggat	CRISPR spacer
ctctgattccgacagtgattcggacagcgac	Protospacer
*** ***************** ***   **.

158. spacer 2.4|2455535|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032366 (Bacillus wiedmannii strain SR52 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

agaacggtacgtatgagttaacacctaaat	CRISPR spacer
agttgggtaagtatgagttaacacctaaga	Protospacer
**   **** ******************.

159. spacer 2.6|2455668|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KX258624 (Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence) position: , mismatch: 6, identity: 0.8

gctatactataaacatatataaggaaagga	CRISPR spacer
ccaaaactataaacatataaaaggaattga	Protospacer
 * * ************** ******  **

160. spacer 2.8|2455800|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to AB981169 (Ralstonia phage RSY1 DNA, complete genome) position: , mismatch: 6, identity: 0.8

acgtcggcgaaatcttcaccacgccgatta	CRISPR spacer
ccatcggcgacatcctcaccacgccgatcg	Protospacer
 *.******* ***.*************..

161. spacer 2.8|2455800|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NC_049432 (Ralstonia phage RsoM1USA, complete genome) position: , mismatch: 6, identity: 0.8

acgtcggcgaaatcttcaccacgccgatta	CRISPR spacer
ccatgggcgacatcctcaccacgccgattg	Protospacer
 *.* ***** ***.**************.

162. spacer 2.8|2455800|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP039965 (Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

acgtcgg-cgaaatcttcaccacgccgatta	CRISPR spacer
-ggtcagtcgaaatattcaccacgccgatag	Protospacer
  ***.* ****** ************** .

163. spacer 1.11|321238|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.774

ttccgactccgatagtgattcggattctgac	CRISPR spacer
ctccgactccgacagtgactcggacagcgac	Protospacer
.***********.*****.*****.  .***

164. spacer 1.20|321886|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

ttcagattccgacagcgattcggattcggat	CRISPR spacer
cagcgactccgacagcgattcggattctgac	Protospacer
.   **.******************** **.

165. spacer 1.20|321886|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

ttcagattccgacagcgattcggattcggat	CRISPR spacer
cagcgactccgacagcgattcggattctgac	Protospacer
.   **.******************** **.

166. spacer 1.20|321886|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

ttcagattccgacagcgattcggattcggat	CRISPR spacer
cagcgactccgacagcgattcggattctgac	Protospacer
.   **.******************** **.

167. spacer 1.20|321886|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

ttcagattccgacagcgattcggattcggat	CRISPR spacer
ctctgattcggacagcgattcggatagcgac	Protospacer
.** ***** ***************   **.

168. spacer 1.20|321886|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

ttcagattccgacagcgattcggattcggat	CRISPR spacer
ctcggattctgacagcgattcggatagcgac	Protospacer
.**.*****.***************   **.

169. spacer 1.20|321886|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

ttcagattccgacagcgattcggattcggat	CRISPR spacer
ctcggattctgacagcgattcggatagcgac	Protospacer
.**.*****.***************   **.

170. spacer 1.27|322270|49|NZ_CP016270|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.857

ttcggattccgacagcgattcagatagcgacagtgattccgactccgac	CRISPR spacer
ctcagacagcgacagcgattcagatagcgacagtgattcagactcagac	Protospacer
.**.**.  ****************************** ***** ***

171. spacer 1.27|322270|49|NZ_CP016270|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.857

ttcggattccgacagcgattcagatagcgacagtgattccgactccgac	CRISPR spacer
ctcagacagcgacagcgattcagatagcgacagtgattcagactcagac	Protospacer
.**.**.  ****************************** ***** ***

172. spacer 1.30|322450|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

ttccgactctgatagcgactccgattccgac	CRISPR spacer
ctcggactctgacagcgactccgacagtgac	Protospacer
.** ********.***********.  .***

173. spacer 1.30|322450|31|NZ_CP016270|CRT matches to MH632120 (Mycobacterium phage Thonko, complete genome) position: , mismatch: 7, identity: 0.774

ttccgactctgatagcgactccgattccgac	CRISPR spacer
gaccgagtctgatagcgacttcgattggggc	Protospacer
  **** *************.*****  *.*

174. spacer 1.35|322714|31|NZ_CP016270|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.774

ctcagactcggacagtgactcagatagcgac	CRISPR spacer
ctcagactcagacagcgactcagactcagat	Protospacer
*********.*****.********.   **.

175. spacer 1.44|323290|55|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.873

ctccgattcggactctgacagcgattcggactctgacagtgattcggatagcgac	CRISPR spacer
cagtgattcggactctgacagcgattcggactctgacagcgattcggattctgac	Protospacer
*  .***********************************.*********  .***

176. spacer 1.44|323290|55|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.873

ctccgattcggactctgacagcgattcggactctgacagtgattcggatagcgac	CRISPR spacer
cagcgattcggactctgacagcgattcggattctgacagcgattcggattctgac	Protospacer
*  ***************************.********.*********  .***

177. spacer 1.47|323512|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.774

ctcagattcggacagtgattcggattcggat	CRISPR spacer
ctctgattccgacagtgattcggacagcgac	Protospacer
*** ***** **************.   **.

178. spacer 1.48|323566|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.774

ctcggattccgacagtgattccgactcggat	CRISPR spacer
ttcggattcggacagcgattccgacagcgac	Protospacer
.******** *****.*********   **.

179. spacer 1.48|323566|31|NZ_CP016270|CRT matches to NZ_CP046573 (Rhodococcus sp. WAY2 plasmid pRWAY01, complete sequence) position: , mismatch: 7, identity: 0.774

ctcggattccgacagtgattccgactcggat	CRISPR spacer
ccggtattccggcagtgattcagactcggta	Protospacer
*. * ******.********* *******

180. spacer 1.20|321886|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.742

ttcagattccgacagcgattcggattcggat	CRISPR spacer
ctctgattccgacagtgattcggacagcgac	Protospacer
.** ***********.********.   **.

181. spacer 1.22|321994|31|NZ_CP016270|CRT matches to LC576631 (Staphylococcus phage vB_SauH_DELF3 DNA, complete sequence) position: , mismatch: 8, identity: 0.742

ctcaga---ttcagacagtgattctgactcagac	CRISPR spacer
---aggcctttcagacagtagttctgactcaggt	Protospacer
   **.   **********..***********..

182. spacer 1.24|322090|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.742

ttccgactctgatagtgactccgactctgat	CRISPR spacer
cagcgactctgacagtgactccgattct---	Protospacer
.  *********.***********.***

183. spacer 1.24|322090|31|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.742

ttccgactctgatagtgactccgactctgat	CRISPR spacer
ctcggactctgacagtgactccgatcttggc	Protospacer
.** ********.***********...**..

184. spacer 1.27|322270|49|NZ_CP016270|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.837

ttcggattccgacagcgattcagatagcgacagtgattccgactccgac	CRISPR spacer
ctttgatgaagacagcgattcagatagcgacagtgattcagactcagac	Protospacer
.*. ***   ***************************** ***** ***

185. spacer 1.35|322714|31|NZ_CP016270|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 8, identity: 0.742

ctcagactcggacagtgactcagatagcgac	CRISPR spacer
ttcagactcagacagtgattcagactcagat	Protospacer
.********.********.*****.   **.

186. spacer 1.35|322714|31|NZ_CP016270|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

ctcagactcggacagtgactcagatagcgac	CRISPR spacer
ttcagactcagacagtgattcagactcagat	Protospacer
.********.********.*****.   **.

187. spacer 1.35|322714|31|NZ_CP016270|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

ctcagactcggacagtgactcagatagcgac	CRISPR spacer
ttcagactcagacagtgattcagactcagat	Protospacer
.********.********.*****.   **.

188. spacer 1.35|322714|31|NZ_CP016270|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

ctcagactcggacagtgactcagatagcgac	CRISPR spacer
ttcagactcagacagtgattcagactcagat	Protospacer
.********.********.*****.   **.

189. spacer 1.35|322714|31|NZ_CP016270|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 8, identity: 0.742

ctcagactcggacagtgactcagatagcgac	CRISPR spacer
ttcagactcagacagtgattcagactcagat	Protospacer
.********.********.*****.   **.

190. spacer 1.44|323290|55|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.855

ctccgattcggactctgacagcgattcggactctgacagtgattcggatagcgac	CRISPR spacer
cagcgactcggactctgacagcgattcggattctgacagtgattcggactctgac	Protospacer
*  ***.***********************.*****************.  .***

191. spacer 1.44|323290|55|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.855

ctccgattcggactctgacagcgattcggactctgacagtgattcggatagcgac	CRISPR spacer
cagtgattcggactctgacagcgattcggactccgacagcgattcggatgctgac	Protospacer
*  .*****************************.*****.*********. .***

192. spacer 1.44|323290|55|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.855

ctccgattcggactctgacagcgattcggactctgacagtgattcggatagcgac	CRISPR spacer
cagtgattccgactctgacagcgattcggactccgacagtgattcggattcggac	Protospacer
*  .***** ***********************.***************   ***

193. spacer 1.29|322396|31|NZ_CP016270|CRT matches to MT773554 (Myoviridae sp. isolate BML_2 genomic sequence) position: , mismatch: 9, identity: 0.71

ttctgactctgatagtgattcagattccgac	CRISPR spacer
ttctgattctgatattgattcaggcggaagc	Protospacer
******.******* ********..   ..*

194. spacer 1.30|322450|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 9, identity: 0.71

ttccgactctgatagcgactccgattccgac	CRISPR spacer
cagcgactctgacagtgactccgattct---	Protospacer
.  *********.**.***********.

195. spacer 1.36|322768|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 9, identity: 0.71

ttccgactcagacagtgattccgattccgac	CRISPR spacer
cagcgactctgacagtgactccgattct---	Protospacer
.  ****** ********.********.

196. spacer 1.36|322768|31|NZ_CP016270|CRT matches to JQ067084 (Pseudomonas phage PaMx25, complete genome) position: , mismatch: 9, identity: 0.71

ttccgactcagacagtgattccgattccgac	CRISPR spacer
ctccgaaccagacagtgattccgatcagcgg	Protospacer
.***** .*****************.   .

197. spacer 1.37|322822|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 9, identity: 0.71

ttccgactcagacagtgattccgattccgac	CRISPR spacer
cagcgactctgacagtgactccgattct---	Protospacer
.  ****** ********.********.

198. spacer 1.37|322822|31|NZ_CP016270|CRT matches to JQ067084 (Pseudomonas phage PaMx25, complete genome) position: , mismatch: 9, identity: 0.71

ttccgactcagacagtgattccgattccgac	CRISPR spacer
ctccgaaccagacagtgattccgatcagcgg	Protospacer
.***** .*****************.   .

199. spacer 1.42|323164|31|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 9, identity: 0.71

ttccgactcagacagtgattccgattccgac	CRISPR spacer
cagcgactctgacagtgactccgattct---	Protospacer
.  ****** ********.********.

200. spacer 1.42|323164|31|NZ_CP016270|CRT matches to JQ067084 (Pseudomonas phage PaMx25, complete genome) position: , mismatch: 9, identity: 0.71

ttccgactcagacagtgattccgattccgac	CRISPR spacer
ctccgaaccagacagtgattccgatcagcgg	Protospacer
.***** .*****************.   .

201. spacer 1.43|323218|49|NZ_CP016270|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 9, identity: 0.816

ttccgactcggacagcgactcagactctgacagtgattcggatagcgac	CRISPR spacer
cagtgactcggacagcgactccgactctgacagtgactcggattctgac	Protospacer
.  .***************** **************.******  .***

202. spacer 2.6|2455668|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NC_014633 (Ilyobacter polytropus DSM 2926 plasmid pILYOP01, complete sequence) position: , mismatch: 9, identity: 0.7

gctatactataaacatatataaggaaagga	CRISPR spacer
atggtacaataaacaaatataaggaaattt	Protospacer
.. .*** ******* ***********

203. spacer 2.6|2455668|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP047429 (Spiroplasma citri strain BLH-13 plasmid pSciBLH13-1, complete sequence) position: , mismatch: 9, identity: 0.7

gctatactataaacatatataaggaaagga	CRISPR spacer
ataatactagaaacatatataatgaatctg	Protospacer
.. ****** ************ ***   .

204. spacer 2.6|2455668|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NC_010182 (Bacillus mycoides KBAB4 plasmid pBWB403, complete sequence) position: , mismatch: 9, identity: 0.7

gctatactataaacatatataaggaaagga	CRISPR spacer
gctatactatacacatatatacgcctttag	Protospacer
*********** ********* *     ..

205. spacer 2.6|2455668|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP046373 (Spiroplasma citri strain LB 319 plasmid pScpLB319-2, complete sequence) position: , mismatch: 9, identity: 0.7

gctatactataaacatatataaggaaagga	CRISPR spacer
ataatactagaaacatatataatgaatctg	Protospacer
.. ****** ************ ***   .

206. spacer 2.4|2455535|30|NZ_CP016270|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016179 (Vibrio breoganii strain FF50 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.667

agaacggtacgtatgagttaacacctaaat	CRISPR spacer
ctgctggtatgtatgagttaacacctctga	Protospacer
  . .****.****************  .

207. spacer 1.44|323290|55|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 11, identity: 0.8

ctccgattcggactctgacagcgattcggactctgacagtgattcggatagcgac	CRISPR spacer
cagcgattcggactctgacagcgattcggactccgacagtgacagtgactctgac	Protospacer
*  ******************************.********.   **.  .***

208. spacer 1.44|323290|55|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 11, identity: 0.8

ctccgattcggactctgacagcgattcggactctgacagtgattcggatagcgac	CRISPR spacer
ttcagacagcgactccgacagcgattcggattctgacagtgattcggattctgac	Protospacer
.** **.   *****.**************.******************  .***

209. spacer 1.44|323290|55|NZ_CP016270|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 12, identity: 0.782

ctccgattcggactctgacagcgattcggactctgacagtgattcggatagcgac	CRISPR spacer
cagtgacagtgactctgacagcgattcggactctgacagcgactcggattcggac	Protospacer
*  .**.   *****************************.**.******   ***

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

419613 : 426974

Lactobacillus_phage(83.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643099.1\|419613_420561_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
WP_003643097.1\|420904_421519_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_053338837.1\|421521_423960_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.3
WP_003643095.1\|424047_424608_+	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	2.7e-101	100.0
WP_011101401.1\|424678_425119_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	3.0e-76	98.6
WP_015380221.1\|425214_425352_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_003645220.1\|425978_426974_+	glycosyltransferase family 2 protein	S5FKN0	Shigella_phage	3.1e-52	38.8

DBSCAN-SWA_2

932071 : 1020061

Lactobacillus_phage(69.57%)

protease,tRNA,capsid,terminase,portal,integrase,head,tail

attL 957654:957671|attR 1026995:1027012

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027821256.1\|932071_932995_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_027821257.1\|933479_934001_-	shikimate kinase	NA	NA	NA	NA
WP_015825650.1\|934003_935101_-	prephenate dehydrogenase	NA	NA	NA	NA
WP_015825651.1\|935103_936402_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_027821258.1\|936415_936943_-	hypothetical protein	NA	NA	NA	NA
WP_013355607.1\|936951_938121_-	chorismate synthase	NA	NA	NA	NA
WP_003645963.1\|938113_939568_-	MFS transporter	NA	NA	NA	NA
WP_003640723.1\|940216_940570_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_003645962.1\|940592_943169_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	9.6e-21	23.3
WP_003640725.1\|943183_943489_-	ribosomal L7Ae/L30e/S12e/Gadd45 family protein	NA	NA	NA	NA
WP_003640726.1\|943478_943778_-	YlxR family protein	NA	NA	NA	NA
WP_003640727.1\|943822_945040_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_003640728.1\|945060_945537_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_003640729.1\|945832_950146_-	DNA polymerase III subunit alpha	A0A1X9SH08	Bradyrhizobium_phage	1.0e-14	34.0
WP_003640732.1\|950639_952349_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_003640733.1\|952388_953666_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_003640734.1\|953703_954489_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_003640735.1\|954504_955284_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	1.1e-23	43.1
WP_003640736.1\|955403_955967_-	ribosome recycling factor	NA	NA	NA	NA
WP_003640737.1\|955968_956691_-	UMP kinase	NA	NA	NA	NA
WP_003644498.1\|956891_957770_-	elongation factor Ts	NA	NA	NA	NA
957654:957671	attL	NA	NA	NA	NA
WP_003640739.1\|957872_958676_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_003640740.1\|958900_959623_+	HAD family hydrolase	NA	NA	NA	NA
WP_003640741.1\|961682_962681_-	D-2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	2.3e-47	34.9
WP_003640742.1\|962765_963071_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_053338917.1\|963054_963813_-\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_003645630.1\|963924_964560_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_003640745.1\|964616_964853_-	YneF family protein	NA	NA	NA	NA
WP_003644501.1\|964950_965190_-	DUF896 domain-containing protein	NA	NA	NA	NA
WP_003640747.1\|965341_965974_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	2.3e-16	56.2
WP_089178220.1\|966063_966294_-	DNA alkylation repair protein	NA	NA	NA	NA
WP_053338918.1\|966597_967227_+	hypothetical protein	NA	NA	NA	NA
WP_053338919.1\|967276_968446_-	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_003640750.1\|968481_968874_-	hypothetical protein	NA	NA	NA	NA
WP_003644503.1\|969037_969430_+	hypothetical protein	NA	NA	NA	NA
WP_053338920.1\|969875_970817_+	glycosyltransferase family 2 protein	V9QJB1	Oenococcus_phage	5.3e-78	49.0
WP_053338921.1\|971568_972141_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_088899822.1\|972292_973477_-	LCP family protein	NA	NA	NA	NA
WP_088899823.1\|973457_974249_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.5e-30	36.8
WP_003644508.1\|976487_977699_-	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_016058344.1\|978939_979470_-	hypothetical protein	E9LUS0	Lactobacillus_phage	2.9e-41	100.0
WP_003644510.1\|979482_979746_-	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	2.0e-38	100.0
WP_053338925.1\|979745_980918_-	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	1.5e-210	97.9
WP_164886062.1\|981679_981841_-	hypothetical protein	A0A2P0ZLG1	Lactobacillus_phage	2.3e-18	96.2
WP_053338926.1\|981853_982096_-	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	9.5e-32	95.0
WP_053338927.1\|982088_984878_-	hypothetical protein	E9LUR4	Lactobacillus_phage	1.5e-261	78.8
WP_088899824.1\|984895_987265_-\|tail	phage tail protein	E9LUR3	Lactobacillus_phage	0.0e+00	93.2
WP_053338929.1\|987330_989100_-\|tail	phage tail family protein	E9LUR2	Lactobacillus_phage	0.0e+00	92.3
WP_053338930.1\|989172_994578_-\|tail	phage tail tape measure protein	A0A2H4PBB0	Lactobacillus_phage	5.7e-116	37.1
WP_027822832.1\|994605_994815_-	hypothetical protein	NA	NA	NA	NA
WP_027822831.1\|994832_995213_-	hypothetical protein	A0A2P0ZLH4	Lactobacillus_phage	1.8e-13	41.2
WP_053338931.1\|995285_995939_-\|tail	phage tail protein	A0A2P0ZLH1	Lactobacillus_phage	7.0e-69	66.2
WP_053338932.1\|995953_996328_-	DUF806 family protein	Q94MA5	Lactococcus_phage	1.1e-15	39.7
WP_027822828.1\|996329_996716_-	HK97 gp10 family phage protein	Q3L0S9	Lactobacillus_rhamnosus_Lc-Nu-like_prophage	2.6e-15	38.3
WP_027822827.1\|996721_997063_-\|head	phage head closure protein	Q9AZM0	Lactococcus_phage	3.7e-13	39.6
WP_027822826.1\|997025_997388_-\|head,tail	phage gp6-like head-tail connector protein	Q6J1Y1	Lactobacillus_phage	5.5e-23	53.2
WP_053338933.1\|997521_998664_-\|capsid	phage major capsid protein	Q6J1Y2	Lactobacillus_phage	1.7e-118	61.1
WP_157696019.1\|998666_999392_-\|protease	ATP-dependent Clp protease proteolytic subunit	Q6J1Y3	Lactobacillus_phage	9.8e-72	62.1
WP_053338935.1\|999351_1000500_-\|portal	phage portal protein	Q6J1Y4	Lactobacillus_phage	6.2e-145	65.7
WP_088899825.1\|1000503_1000692_-	hypothetical protein	NA	NA	NA	NA
WP_053338937.1\|1000708_1002595_-\|terminase	terminase large subunit	Q6J1Y6	Lactobacillus_phage	1.5e-268	70.2
WP_053338938.1\|1002581_1003049_-\|terminase	phage terminase small subunit P27 family	Q6J1Y7	Lactobacillus_phage	9.2e-39	49.3
WP_053338939.1\|1003446_1003959_-	HNH endonuclease	A8YQN7	Lactobacillus_phage	4.1e-48	54.4
WP_080372337.1\|1004019_1004184_-	hypothetical protein	E9LUP6	Lactobacillus_phage	6.5e-08	59.3
WP_053338940.1\|1004386_1004938_-	hypothetical protein	A8ASQ2	Listeria_phage	2.7e-21	38.3
WP_053338941.1\|1005470_1005899_-	transcriptional regulator	E9LUP5	Lactobacillus_phage	1.4e-65	85.8
WP_080372338.1\|1005879_1006050_-	hypothetical protein	E9LUP4	Lactobacillus_phage	1.9e-18	89.3
WP_053338942.1\|1006164_1006593_-	DUF1642 domain-containing protein	A0A2P0ZLB8	Lactobacillus_phage	4.3e-51	66.7
WP_053338943.1\|1006589_1006955_-	hypothetical protein	A0A291I9N7	Lactobacillus_phage	3.1e-42	69.3
WP_053338944.1\|1006951_1007299_-	hypothetical protein	O03921	Lactobacillus_phage	1.4e-55	93.8
WP_022638754.1\|1007379_1007538_-	hypothetical protein	A0A2P0ZLB5	Lactobacillus_phage	3.9e-18	92.3
WP_053338945.1\|1007530_1007839_-	hypothetical protein	E9LUN7	Lactobacillus_phage	8.4e-49	94.1
WP_053338946.1\|1007974_1008760_-	ATP-binding protein	E9LUN6	Lactobacillus_phage	1.1e-145	99.2
WP_053338947.1\|1009628_1009886_-	hypothetical protein	NA	NA	NA	NA
WP_187331851.1\|1009885_1010056_-	hypothetical protein	NA	NA	NA	NA
WP_003641371.1\|1010235_1010436_-	hypothetical protein	E9LUT7	Lactobacillus_phage	1.0e-26	89.4
WP_003641370.1\|1010438_1010687_-	hypothetical protein	E9LUT6	Lactobacillus_phage	2.7e-29	76.1
WP_003641369.1\|1010699_1010903_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003641368.1\|1011068_1011359_+	hypothetical protein	NA	NA	NA	NA
WP_053338948.1\|1011952_1012213_-	hypothetical protein	NA	NA	NA	NA
WP_053338949.1\|1012271_1012517_+	hypothetical protein	NA	NA	NA	NA
WP_154813462.1\|1012503_1012659_-	hypothetical protein	NA	NA	NA	NA
WP_050339257.1\|1012672_1012882_-	hypothetical protein	NA	NA	NA	NA
WP_080372369.1\|1012893_1013637_-	ORF6C domain-containing protein	A0A1P8BLG8	Lactococcus_phage	2.2e-50	46.1
WP_053338950.1\|1013647_1013869_-	hypothetical protein	NA	NA	NA	NA
WP_033609542.1\|1014665_1015004_+	helix-turn-helix transcriptional regulator	A0A059T6G1	Listeria_phage	9.3e-17	45.1
WP_015380505.1\|1015013_1015292_+	hypothetical protein	D2KRD5	Lactobacillus_phage	1.3e-21	59.3
WP_053338951.1\|1015349_1015736_+	hypothetical protein	NA	NA	NA	NA
WP_015380507.1\|1015744_1016443_+	hypothetical protein	Q9AZW5	Lactococcus_phage	2.1e-18	36.8
WP_053338952.1\|1016624_1016825_+	hypothetical protein	E9LUS6	Lactobacillus_phage	2.5e-25	97.0
WP_064972032.1\|1018042_1018681_-	hypothetical protein	NA	NA	NA	NA
WP_053338955.1\|1018897_1020061_+\|integrase	site-specific integrase	B4XYR4	Lactobacillus_phage	1.2e-55	36.5
1026995:1027012	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1309342 : 1372237

Lactobacillus_phage(68.63%)

holin,capsid,head,terminase,integrase,portal,tail

attL 1358575:1358596|attR 1372415:1372436

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053338992.1\|1309342_1311073_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.6e-46	27.6
WP_003641420.1\|1311300_1311693_-	YxeA family protein	NA	NA	NA	NA
WP_053338993.1\|1313417_1314296_+	Abi family protein	M1PS09	Streptococcus_phage	7.8e-07	21.9
WP_080372339.1\|1314347_1314578_-	LysM peptidoglycan-binding domain-containing protein	Q6J1W8	Lactobacillus_phage	4.0e-11	64.6
WP_053338994.1\|1314791_1315166_-\|holin	holin	A0A2K9VCG4	Lactobacillus_phage	1.5e-15	66.2
WP_053338995.1\|1315152_1315449_-	hypothetical protein	A0A1I9KK55	Lactobacillus_phage	1.7e-38	76.5
WP_053339288.1\|1315449_1316565_-	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	1.9e-45	65.7
WP_053338996.1\|1316627_1316873_-	hypothetical protein	A0A0A1ENR9	Lactobacillus_phage	1.4e-17	69.2
WP_053338997.1\|1316869_1317988_-	hypothetical protein	A0A286QPL6	Streptococcus_phage	1.9e-45	50.0
WP_080372341.1\|1318002_1318149_-	XkdX family protein	NA	NA	NA	NA
WP_053338998.1\|1318145_1318466_-	hypothetical protein	NA	NA	NA	NA
WP_053338999.1\|1318477_1319221_-	hypothetical protein	NA	NA	NA	NA
WP_053339000.1\|1319234_1321076_-	metallophosphoesterase	A0A2P0ZKZ2	Lactobacillus_phage	8.1e-139	54.2
WP_053339001.1\|1321076_1321388_-	hypothetical protein	O03939	Lactobacillus_phage	2.0e-10	86.8
WP_080372342.1\|1321365_1321659_-	hypothetical protein	NA	NA	NA	NA
WP_053339003.1\|1321651_1322770_-\|tail	phage tail protein	O03938	Lactobacillus_phage	9.8e-188	90.9
WP_053339004.1\|1322782_1323592_-\|tail	phage tail family protein	D2KRB8	Lactobacillus_phage	2.5e-52	41.9
WP_053339005.1\|1323591_1328487_-	peptidoglycan DD-metalloendopeptidase family protein	O03937	Lactobacillus_phage	0.0e+00	63.3
WP_053339006.1\|1328490_1329114_-	hypothetical protein	O03936	Lactobacillus_phage	4.1e-103	96.5
WP_053339007.1\|1329119_1329551_-	hypothetical protein	O03935	Lactobacillus_phage	5.2e-73	97.2
WP_053339008.1\|1329602_1330118_-	hypothetical protein	O03972	Lactobacillus_phage	3.5e-84	96.3
WP_053339009.1\|1330150_1330555_-	hypothetical protein	O03934	Lactobacillus_phage	9.0e-67	96.3
WP_053339010.1\|1330554_1330902_-\|capsid	minor capsid protein	O03933	Lactobacillus_phage	1.8e-47	83.9
WP_053339011.1\|1330901_1331255_-\|capsid	capsid protein	O03932	Lactobacillus_phage	1.4e-55	91.5
WP_053339012.1\|1331251_1331680_-	hypothetical protein	NA	NA	NA	NA
WP_053339013.1\|1331706_1332762_-	hypothetical protein	O03966	Lactobacillus_phage	9.8e-198	99.1
WP_088899828.1\|1332778_1333393_-	phage scaffolding protein	O03931	Lactobacillus_phage	1.4e-66	92.2
WP_053339015.1\|1333494_1334637_-\|capsid	capsid protein	O03929	Lactobacillus_phage	5.5e-170	94.0
WP_053339016.1\|1334633_1336160_-\|portal	phage portal protein	O03928	Lactobacillus_phage	2.0e-247	82.7
WP_053339017.1\|1336168_1337512_-\|terminase	PBSX family phage terminase large subunit	O03927	Lactobacillus_phage	1.2e-261	96.9
WP_088899829.1\|1337492_1338011_-\|terminase	terminase small subunit	O03926	Lactobacillus_phage	5.2e-67	81.4
WP_053339019.1\|1338069_1338390_-	hypothetical protein	A0A1J1J9Q7	Escherichia_phage	9.4e-19	48.1
WP_053339020.1\|1338613_1338877_-	hypothetical protein	A0A1S5SBT9	Streptococcus_phage	8.0e-24	60.9
WP_053339021.1\|1338996_1339197_-	hypothetical protein	E9LUP6	Lactobacillus_phage	5.1e-07	56.0
WP_053339022.1\|1339271_1340372_-	hypothetical protein	NA	NA	NA	NA
WP_053339023.1\|1341345_1341795_-	hypothetical protein	B8R690	Lactobacillus_phage	2.4e-12	37.0
WP_053339289.1\|1342150_1342384_-	hypothetical protein	E9LUP1	Lactobacillus_phage	2.7e-23	85.0
WP_053339024.1\|1342470_1342701_-	hypothetical protein	O03916	Lactobacillus_phage	2.7e-20	56.6
WP_053339025.1\|1342700_1343135_-	hypothetical protein	A0A288TZS1	Enterococcus_phage	1.2e-29	48.8
WP_053339026.1\|1343131_1343509_-	endodeoxyribonuclease	NA	NA	NA	NA
WP_053339027.1\|1343505_1344024_-	hypothetical protein	O03915	Lactobacillus_phage	5.4e-40	53.9
WP_033611991.1\|1344020_1344308_-	hypothetical protein	NA	NA	NA	NA
WP_053339028.1\|1344304_1345213_-	DnaD domain protein	NA	NA	NA	NA
WP_187338150.1\|1345293_1346046_-	PD-(D/E)XK nuclease-like domain-containing protein	A0A0P0IZH9	Lactobacillus_phage	5.6e-70	49.4
WP_053339030.1\|1346077_1346977_-	recombinase RecT	E9LUM3	Lactobacillus_phage	6.7e-62	47.4
WP_080372344.1\|1346973_1347360_-	hypothetical protein	NA	NA	NA	NA
WP_053339032.1\|1347843_1348356_-	transcriptional regulator	D6PST4	Lactobacillus_phage	6.5e-30	45.3
WP_053339033.1\|1348422_1348728_-	DUF771 domain-containing protein	NA	NA	NA	NA
WP_080372345.1\|1348739_1348910_-	hypothetical protein	NA	NA	NA	NA
WP_011101083.1\|1348922_1349153_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011101082.1\|1349325_1349688_+	helix-turn-helix domain-containing protein	A0A0U4KKM4	Exiguobacterium_phage	2.6e-09	32.0
WP_003642784.1\|1349699_1350113_+	ImmA/IrrE family metallo-endopeptidase	A0A0M4RD70	Bacillus_phage	3.4e-05	31.3
WP_053339034.1\|1350138_1351485_+	DUF4041 domain-containing protein	A0A1B0Y697	Lactobacillus_phage	3.9e-82	52.7
WP_071242850.1\|1351534_1352068_+	hypothetical protein	NA	NA	NA	NA
WP_161324305.1\|1353069_1353774_+	Ltp family lipoprotein	V9QJ01	Oenococcus_phage	3.0e-09	41.0
WP_003642778.1\|1354047_1354224_+	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	2.6e-10	51.7
WP_053339035.1\|1354409_1355375_+	AAA family ATPase	A0A1X9IGI7	Lactococcus_phage	1.8e-28	34.5
WP_053339036.1\|1355367_1355805_+	hypothetical protein	NA	NA	NA	NA
WP_053339037.1\|1355807_1356491_+	hypothetical protein	NA	NA	NA	NA
WP_053339038.1\|1356588_1357710_+\|integrase	site-specific integrase	D6PSS4	Lactobacillus_phage	2.9e-46	32.4
WP_003642774.1\|1358061_1358268_-	hypothetical protein	NA	NA	NA	NA
1358575:1358596	attL	NA	NA	NA	NA
WP_045353068.1\|1359073_1359445_-	hypothetical protein	NA	NA	NA	NA
WP_053339040.1\|1359600_1359870_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_053339041.1\|1360277_1361858_-\|capsid	phage major capsid protein	B8R651	Lactobacillus_phage	1.6e-39	26.5
WP_053339042.1\|1361847_1362954_-\|portal	phage portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	1.1e-50	33.9
WP_033611503.1\|1362954_1363155_-	hypothetical protein	NA	NA	NA	NA
WP_053339043.1\|1363108_1364812_-\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	4.9e-122	40.5
WP_053339044.1\|1364808_1365282_-\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_080372346.1\|1366184_1366574_-	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	6.7e-19	44.7
WP_053339045.1\|1366566_1366905_-\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	1.2e-08	36.6
WP_053339046.1\|1366891_1367083_-	hypothetical protein	NA	NA	NA	NA
WP_053339047.1\|1367241_1368636_-	virulence protein	D2J048	Enterococcus_phage	2.5e-68	35.7
WP_053339048.1\|1368635_1369436_-	bifunctional DNA primase/polymerase	NA	NA	NA	NA
WP_053339049.1\|1369432_1369687_-	hypothetical protein	NA	NA	NA	NA
WP_053339050.1\|1370124_1370328_-	hypothetical protein	NA	NA	NA	NA
WP_053339051.1\|1370460_1371027_+	helix-turn-helix domain-containing protein	A0A139ZPI6	Marinitoga_camini_virus	1.9e-06	47.5
WP_053339052.1\|1371079_1372237_+\|integrase	site-specific integrase	Q938N9	Temperate_phage	1.0e-54	34.8
1372415:1372436	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1566401 : 1574912

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645867.1\|1566401_1566980_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9
WP_027821845.1\|1566972_1567998_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	9.3e-60	41.3
WP_003642591.1\|1567994_1569449_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.5e-50	34.0
WP_021356102.1\|1569433_1571653_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.5e-144	39.1
WP_011101895.1\|1571645_1572326_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003642588.1\|1572325_1572580_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_021356104.1\|1572581_1573313_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	2.1e-37	37.3
WP_053339078.1\|1573315_1574446_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003645861.1\|1574429_1574912_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0

DBSCAN-SWA_5

2674501 : 2727413

Bacillus_virus(33.33%)

protease,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053339232.1\|2674501_2675065_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_016511451.1\|2675258_2675927_+	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_027821520.1\|2676084_2677590_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_013355173.1\|2677854_2678223_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|2678335_2678845_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_024521227.1\|2678875_2680072_-	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003646440.1\|2680181_2680652_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_011100976.1\|2680670_2681126_+	hypothetical protein	NA	NA	NA	NA
WP_027821518.1\|2681229_2681802_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_011100977.1\|2681967_2682888_-	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_003643768.1\|2683024_2683936_+	oxidoreductase	NA	NA	NA	NA
WP_003641939.1\|2684823_2685270_-	hypothetical protein	NA	NA	NA	NA
WP_003641940.1\|2685507_2687034_+	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_027821516.1\|2687034_2688006_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_024971425.1\|2688083_2689415_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_053339233.1\|2689880_2691398_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_053339234.1\|2691412_2693242_+	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_080372359.1\|2693256_2693979_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	1.6e-29	31.5
WP_053339236.1\|2694565_2698249_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_162993148.1\|2699680_2700028_+	hemagglutinin	NA	NA	NA	NA
WP_053339301.1\|2700058_2700574_+	hypothetical protein	NA	NA	NA	NA
WP_053339237.1\|2700691_2700970_+	hypothetical protein	NA	NA	NA	NA
WP_053339238.1\|2701108_2701354_-	hypothetical protein	NA	NA	NA	NA
WP_157485085.1\|2701395_2701620_+	hypothetical protein	NA	NA	NA	NA
WP_053339239.1\|2701748_2702141_+	hypothetical protein	NA	NA	NA	NA
WP_053339240.1\|2703768_2704032_+	hypothetical protein	NA	NA	NA	NA
WP_003643788.1\|2704148_2704352_+	hypothetical protein	NA	NA	NA	NA
WP_053339241.1\|2704476_2704716_+	hypothetical protein	NA	NA	NA	NA
WP_003646453.1\|2704733_2705120_+	hypothetical protein	NA	NA	NA	NA
WP_088899880.1\|2705569_2705761_+	hypothetical protein	NA	NA	NA	NA
WP_053339242.1\|2706152_2706428_+	hypothetical protein	NA	NA	NA	NA
WP_003643792.1\|2706971_2707391_+	hypothetical protein	NA	NA	NA	NA
WP_027821509.1\|2707682_2708147_+	hypothetical protein	NA	NA	NA	NA
WP_027821508.1\|2708482_2709100_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_053339243.1\|2709103_2710258_-	MFS transporter	NA	NA	NA	NA
WP_088899881.1\|2710261_2711053_-	HAD family hydrolase	NA	NA	NA	NA
WP_003643797.1\|2711123_2711996_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_003641966.1\|2712155_2712971_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_027821507.1\|2713496_2714873_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_011100995.1\|2714917_2716102_+	cation:proton antiporter	NA	NA	NA	NA
WP_027821506.1\|2716665_2716845_+\|bacteriocin	class IIb bacteriocin, lactobin A/cerein 7B family	NA	NA	NA	NA
WP_027821505.1\|2717775_2718444_-	hypothetical protein	NA	NA	NA	NA
WP_153302738.1\|2719036_2719204_+	hypothetical protein	NA	NA	NA	NA
WP_088899883.1\|2719221_2720562_+	GHKL domain-containing protein	NA	NA	NA	NA
WP_015825122.1\|2720562_2721306_+	response regulator transcription factor	NA	NA	NA	NA
WP_027821503.1\|2721599_2722373_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003643811.1\|2722471_2722630_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
WP_003641985.1\|2722654_2722825_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
WP_027821502.1\|2723090_2725241_+	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	3.6e-45	27.9
WP_053339245.1\|2725257_2726634_+	HlyD family secretion protein	NA	NA	NA	NA
WP_053339246.1\|2726723_2727413_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_6

2925059 : 2933684

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053338710.1\|2925059_2926757_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.0e-55	37.0
WP_003640956.1\|2926778_2927087_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003637790.1\|2927102_2927702_+	recombination protein RecR	NA	NA	NA	NA
WP_003640957.1\|2927716_2927968_+	YaaL family protein	NA	NA	NA	NA
WP_003644908.1\|2928366_2929032_+	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
WP_003640965.1\|2929028_2929358_+	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_003640966.1\|2929374_2930394_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
WP_003640967.1\|2930418_2930766_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
WP_053338711.1\|2930864_2931761_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	1.7e-81	55.7
WP_053338712.1\|2931764_2932550_+	acyl-ACP thioesterase	NA	NA	NA	NA
WP_053338713.1\|2932688_2933684_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	1.0e-50	37.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP016271

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

6567 : 62667

Staphylococcus_phage(25.0%)

integrase,transposase

attL 33397:33418|attR 57721:57742

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088899809.1\|6567_7367_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_024002725.1\|7741_8587_+	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_027822949.1\|8623_8953_+	hypothetical protein	NA	NA	NA	NA
WP_187338152.1\|9144_9483_+	KxYKxGKxW signal peptide domain-containing protein	NA	NA	NA	NA
WP_187338153.1\|9469_12316_+	MucBP domain-containing protein	F8WPR5	Bacillus_phage	6.4e-34	26.7
WP_027822610.1\|12666_13329_+	metalloregulator ArsR/SmtB family transcription factor	NA	NA	NA	NA
WP_027822611.1\|13464_13749_+	thioredoxin family protein	NA	NA	NA	NA
WP_053339260.1\|13770_14694_+	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	1.8e-78	46.5
WP_053339259.1\|14709_15360_+	DsbA family oxidoreductase	NA	NA	NA	NA
WP_027822614.1\|15514_15829_+	thioredoxin	A0A1X9I9P5	Staphylococcus_phage	2.8e-15	32.7
WP_027822615.1\|15850_17188_+	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	1.2e-19	23.5
WP_027822616.1\|17693_18056_-	hypothetical protein	NA	NA	NA	NA
WP_027822617.1\|18082_18523_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_010495033.1\|18659_19097_+	OsmC family protein	NA	NA	NA	NA
WP_111443464.1\|19114_19531_+	OsmC family protein	NA	NA	NA	NA
WP_027822817.1\|19913_20945_-\|transposase	IS30 family transposase	A0A2K9V2S9	Faecalibacterium_phage	2.3e-42	34.4
WP_027822898.1\|21573_21897_+	hypothetical protein	NA	NA	NA	NA
WP_027822897.1\|21969_22368_-	hypothetical protein	NA	NA	NA	NA
WP_027822896.1\|22360_22681_-	hypothetical protein	NA	NA	NA	NA
WP_027822895.1\|22673_23975_-	Y-family DNA polymerase	M1Q231	Streptococcus_phage	6.4e-82	40.0
WP_027822894.1\|24088_24400_+	hypothetical protein	NA	NA	NA	NA
WP_016526748.1\|24637_24907_-	hypothetical protein	NA	NA	NA	NA
WP_027822893.1\|24893_25796_-	AAA family ATPase	F0PIG8	Enterococcus_phage	4.1e-27	32.1
WP_027822892.1\|26655_28188_+	primase C-terminal domain-containing protein	NA	NA	NA	NA
WP_088899809.1\|28832_29632_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_027822890.1\|30704_30983_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_010625626.1\|30972_31275_+	type II toxin-antitoxin system YafQ family toxin	NA	NA	NA	NA
WP_027822859.1\|31619_31919_-	hypothetical protein	NA	NA	NA	NA
WP_015063546.1\|31911_32190_-	DUF2089 family protein	NA	NA	NA	NA
WP_085844568.1\|32385_33315_-\|transposase	IS30-like element ISLpl1 family transposase	H7BW47	unidentified_phage	2.3e-25	34.4
33397:33418	attL	NA	NA	NA	NA
WP_088899894.1\|34168_34956_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_053339277.1\|35576_38381_+	cation-transporting P-type ATPase	M1IAU8	Acanthocystis_turfacea_Chlorella_virus	2.0e-72	27.6
WP_053339276.1\|38440_38704_+	hypothetical protein	NA	NA	NA	NA
WP_027822857.1\|38739_39207_+	hypothetical protein	NA	NA	NA	NA
WP_162838578.1\|39433_39586_-	hypothetical protein	NA	NA	NA	NA
WP_053339275.1\|39569_40739_-	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_001748276.1\|42391_42661_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_001748275.1\|42647_43019_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_072558124.1\|43070_43658_-\|integrase	site-specific integrase	D2XR58	Bacillus_phage	3.7e-21	34.3
WP_003586674.1\|43734_44013_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_053339273.1\|44609_45785_+\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.1e-27	29.2
WP_053339272.1\|46244_46586_+	type II toxin-antitoxin system YafQ family toxin	NA	NA	NA	NA
WP_053339271.1\|47024_50303_-	ATP-dependent DNA helicase RecQ	A0A1V0SBK0	Catovirus	8.7e-27	27.8
WP_053339270.1\|50323_51697_-	sigma-70 family RNA polymerase sigma factor	A0A2I7SAT0	Vibrio_phage	6.2e-27	30.7
WP_053339269.1\|51797_52691_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_053339268.1\|52710_53085_-	hypothetical protein	NA	NA	NA	NA
WP_053339267.1\|53450_54041_-\|integrase	site-specific integrase	D2XR58	Bacillus_phage	7.5e-22	34.3
WP_080372366.1\|54386_56720_+	DUF1906 domain-containing protein	NA	NA	NA	NA
WP_042253884.1\|57868_58336_+	DNA starvation/stationary phase protection protein	NA	NA	NA	NA
57721:57742	attR	NA	NA	NA	NA
WP_027822873.1\|58582_59326_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-27	33.5
WP_088899895.1\|59303_60551_+	ABC transporter permease	NA	NA	NA	NA
WP_027822875.1\|60555_61227_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_027823042.1\|61983_62667_-\|transposase	IS6 family transposase	A0A0N9RU54	Staphylococcus_phage	1.6e-60	53.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP016270

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP016271

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection