CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP012646	Streptococcus mitis strain KCOM 1350 (= ChDC B183) chromosome, complete genome	2 crisprs	cas3,DEDDh,DinG,WYL	0	0	9	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP012646_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012646_1

482291-482385

Orphan

Consensus_repeat	Method
ATGTGTAAGATTTTTATATATAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP012646_1

>merge|NZ_CP012646|1|482291-482385|CRISPRCasFinder
ATGTGTAAGATTTTTATATATAATTTTTCTACACATACATTGTACATCTAAAAGAAAGCCCTGTCAAGAAATATGTGTAAAATTTTTATATATAA

>NZ_CP012646|1|1|482291-482385|CRISPRCasFinder
ATGTGTAAGATTTTTATATATAA	TTTTTCTACACATACATTGTACATCTAAAAGAAAGCCCTGTCAAGAAAT
ATGTGTAAAATTTTTATATATAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012646.1\|WP_060627367.1\|477186_478173_+\|rhodanese-related-sulfurtransferase	unknown	unknown	gnl\|CDD\|234663
NZ_CP012646.1\|WP_000838912.1\|488142_488814_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	unknown	unknown	gnl\|CDD\|224674
NZ_CP012646.1\|WP_060627377.1\|491079_491667_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012646.1\|WP_060627364.1\|473261_474185_+\|carbohydrate-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223472
NZ_CP012646.1\|WP_060627372.1\|482410_483577_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340897
NZ_CP012646.1\|WP_060627369.1\|479331_480396_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|374284
NZ_CP012646.1\|WP_060627373.1\|483731_484562_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133038
NZ_CP012646.1\|WP_060627365.1\|476001_476691_+\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP012646.1\|WP_045605200.1\|484647_486498_+\|polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|224011
NZ_CP012646.1\|WP_060627366.1\|476760_477057_+\|bacteriocin-immunity-protein	unknown	unknown	gnl\|CDD\|370205
NZ_CP012646.1\|WP_060627371.1\|481365_481959_-\|DUF1700-domain-containing-protein	unknown	unknown	gnl\|CDD\|227053
NZ_CP012646.1\|WP_000273858.1\|481945_482272_-\|PadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224609
NZ_CP012646.1\|WP_060627370.1\|480458_481373_-\|DUF4097-family-beta-strand-repeat-protein	unknown	unknown	gnl\|CDD\|372574
NZ_CP012646.1\|WP_049488632.1\|474287_475769_+\|DUF3502-domain-containing-protein	unknown	unknown	gnl\|CDD\|378792
NZ_CP012646.1\|WP_060627374.1\|486607_487240_-\|HAD-IA-family-hydrolase	unknown	unknown	gnl\|CDD\|319798
NZ_CP012646.1\|WP_060627376.1\|489837_490695_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197775
NZ_CP012646.1\|WP_060627375.1\|489053_489704_+\|LysM-peptidoglycan-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|212030
NZ_CP012646.1\|WP_060627378.1\|491952_494061_+\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|273736
NZ_CP012646.1\|WP_020902659.1\|487261_488134_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	unknown	unknown	gnl\|CDD\|129801
NZ_CP012646.1\|WP_060627368.1\|478294_479155_+\|DUF4299-domain-containing-protein	unknown	unknown	gnl\|CDD\|339103

Protein	Function_ID	Function_description	E-value
NZ_CP012646.1\|WP_060627367.1\|477186_478173_+\|rhodanese-related-sulfurtransferase	gnl\|CDD\|234663	PRK00142, PRK00142, rhodanese-related sulfurtransferase.	0
NZ_CP012646.1\|WP_000838912.1\|488142_488814_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	gnl\|CDD\|224674	COG1760, SdaA, L-serine deaminase [Amino acid transport and metabolism].	1.1908e-89
NZ_CP012646.1\|WP_060627364.1\|473261_474185_+\|carbohydrate-ABC-transporter-permease	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	6.93211e-69
NZ_CP012646.1\|WP_060627372.1\|482410_483577_-\|MFS-transporter	gnl\|CDD\|340897	cd17339, MFS_NIMT_CynX_like, 2-nitroimidazole and cyanate transporters and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Escherichia coli 2-nitroimidazole transporter (NIMT) and cyanate transport protein CynX, and similar proteins. NIMT, also called YeaN, confers resistance to 2-nitroimidazole, the antibacterial and antifungal antibiotic, by mediating the active efflux of this compound. CynX is part of an active transport system that transports exogenous cyanate into E. coli cells. The NIMT/CynX-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.04052e-124
NZ_CP012646.1\|WP_060627369.1\|479331_480396_-\|hypothetical-protein	gnl\|CDD\|374284	pfam16001, DUF4775, Domain of unknown function (DUF4775). This family of proteins is functionally uncharacterized. This family of proteins is found in eukaryotes. Proteins in this family are typically between 308 and 484 amino acids in length.	0.000328344
NZ_CP012646.1\|WP_060627373.1\|483731_484562_+\|glycosyltransferase	gnl\|CDD\|133038	cd04195, GT2_AmsE_like, GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis. AmsE is a glycosyltransferase involved in exopolysaccharide amylovora biosynthesis in Erwinia amylovora. Amylovara is one of the three exopolysaccharide produced by E. amylovora. Amylovara-deficient mutants are non-pathogenic. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.	4.92887e-89
NZ_CP012646.1\|WP_060627365.1\|476001_476691_+\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	1.31409e-09
NZ_CP012646.1\|WP_045605200.1\|484647_486498_+\|polysaccharide-biosynthesis-protein	gnl\|CDD\|224011	COG1086, COG1086, Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism].	0
NZ_CP012646.1\|WP_060627366.1\|476760_477057_+\|bacteriocin-immunity-protein	gnl\|CDD\|370205	pfam08951, EntA_Immun, Enterocin A Immunity. Gram-positive lactobacilli produce bacteriocins to kill closely-related competitor species. To protect themselves from the bacteriocidal activity of this molecule they co-express an immunity protein (for discussion of this operon see Bacteriocin_IIc pfam10439). The immunity protein structure is a soluble, cytoplasmic, antiparallel four alpha-helical globular bundle with a fifth, more flexible and more divergent C-terminal helical hair-pin. The C-terminal hair-pin recognizes the C-terminus of the producer bacteriocin and this interaction is sufficient to dis-orient the bacteriocin within the membrane and close up the permeabilising pore that on its own the bacteriocin creates. These immunity proteins interact in the same way with other bacteriocins, family Bacteriocin_II, pfam01721. Since many enterococci can produce more than one bacteriocin it seems likely that the whole operon can be carried on transferable plasmids.	1.31302e-05
NZ_CP012646.1\|WP_060627371.1\|481365_481959_-\|DUF1700-domain-containing-protein	gnl\|CDD\|227053	COG4709, COG4709, Predicted membrane protein [Function unknown].	1.33394e-63
NZ_CP012646.1\|WP_000273858.1\|481945_482272_-\|PadR-family-transcriptional-regulator	gnl\|CDD\|224609	COG1695, COG1695, Predicted transcriptional regulators [Transcription].	4.64307e-19
NZ_CP012646.1\|WP_060627370.1\|480458_481373_-\|DUF4097-family-beta-strand-repeat-protein	gnl\|CDD\|372574	pfam13349, DUF4097, Putative adhesin. This has a putative all-beta structure with a twenty-residue repeat with a highly conserved repeating GD, gly-asp, motif. It may form part of a bacterial adhesin.	1.04204e-33
NZ_CP012646.1\|WP_049488632.1\|474287_475769_+\|DUF3502-domain-containing-protein	gnl\|CDD\|378792	pfam12010, DUF3502, Domain of unknown function (DUF3502). This presumed domain is functionally uncharacterized. This domain is found in bacteria. This domain is about 140 amino acids in length. This domain is found associated with pfam01547.	8.57773e-44
NZ_CP012646.1\|WP_060627374.1\|486607_487240_-\|HAD-IA-family-hydrolase	gnl\|CDD\|319798	cd04302, HAD_5NT, haloacid dehalogenase (HAD)-like 5'-nucleotidases similar to the Pseudomonas aeruginosa PA0065. 5'-nucleotidases dephosphorylate nucleoside 5'-monophosphates to nucleosides and inorganic phosphate. Purified Pseudomonas aeruginosa PA0065 displayed high activity toward 5'-UMP and 5'-IMP, significant activity against 5'-XMP and 5'-TMP, and low activity against 5'-CMP. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	1.65401e-94
NZ_CP012646.1\|WP_060627376.1\|489837_490695_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197775	smart00530, HTH_XRE, Helix-turn-helix XRE-family like proteins.	2.79896e-11
NZ_CP012646.1\|WP_060627375.1\|489053_489704_+\|LysM-peptidoglycan-binding-domain-containing-protein	gnl\|CDD\|212030	cd00118, LysM, Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.	6.3303e-15
NZ_CP012646.1\|WP_060627378.1\|491952_494061_+\|amino-acid-ABC-transporter-permease	gnl\|CDD\|273736	TIGR01654, unnamed_protein_product, bacteriocin-associated integral membrane (putative immunity) protein. This model represents a family of integral membrane proteins, most of which are about 650 residues in size and predicted to span the membrane seven times. Nearly half of the members of this family are found in association with a member of the lactococcin 972 family of bacteriocins (TIGR01653). Others may be associated with uncharacterized proteins that may also act as bacteriocins. Although this protein is suggested to be an immunity protein, and the bacteriocin is suggested to be exported by a Sec-dependent process, the role of this protein is unclear. [Cellular processes, Toxin production and resistance].	8.20193e-151
NZ_CP012646.1\|WP_020902659.1\|487261_488134_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	gnl\|CDD\|129801	TIGR00718, Probable_L-serine_dehydratase_alpha_chain, L-serine dehydratase, iron-sulfur-dependent, alpha subunit. This enzyme is also called serine deaminase. L-serine dehydratase converts serine into pyruvate in the gluconeogenesis pathway from serine. This model describes the alpha chain of an iron-sulfur-dependent L-serine dehydratase, found in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of alpha chains from the homologous region of single chain forms such as found in Escherichia coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	9.14041e-107
NZ_CP012646.1\|WP_060627368.1\|478294_479155_+\|DUF4299-domain-containing-protein	gnl\|CDD\|339103	pfam14132, DUF4299, Domain of unknown function (DUF4299). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 275 and 313 amino acids in length. There are two conserved sequence motifs: RGF and DAY. There are two completely conserved residues (P and D) that may be functionally important.	7.63606e-114

>NZ_CP012646.1|WP_000273858.1|481945_482272_-|PadR-family-transcriptional-regulator
MYFPTSSALIEFLILAVLEQDDSYGYEISQTIKLIANIKESTLYPILKKLEGNSFLTTYSREFQGRMRKYYSLTNGGIEQLVTLKDEWALYTDTINGIIEGSIRHDKN
>NZ_CP012646.1|WP_060627371.1|481365_481959_-|DUF1700-domain-containing-protein
MTRTEYLTQLELYLKKLPETDRIEAMDYFRELFDDAGVEGEEELIASLGTPKEAAHEVLSNLLDKKINEAPAQKNNRQILHIALLALLAAPIGIPLGIAILVSLFAILVAALTVILAFFAVSILGIIGGFLFLVESFTVLAQAKSAFILIFGSGLLAIGASSLVLLGISYVARFFGLLIVRLVQFVLKKGKRGDQHA
>NZ_CP012646.1|WP_060627370.1|480458_481373_-|DUF4097-family-beta-strand-repeat-protein
MRKLTKGFLIFGVVTTVIGFILLFVGIQSDGIKSLLAMSKEPVYDSRMEELTFGKEVENLEITLHQHALTITDSFDDQIHISYHPTVSPHHDLVTNQNDKTLSLTDKKLSESPFLSSGIGGILHIASSYSRRFEEVILQLPKGRTLKGINVSANRGQTSITNASLENATINTNNGYLLRIEGSRIKNSKLTTPNIINIFDTDLTDSQLESTDKHFHAENIQVHGKVELTAKKYLRIILDQKENQRINWDISSNYGSIFQFTREEPKSRGTELSNPYKTEKTEAKDQLIARADNDIELISIPNRR
>NZ_CP012646.1|WP_060627369.1|479331_480396_-|hypothetical-protein
MKQEWFESNDFVKATSKNKPEEQAQEVADKAEETIANLDTPIEKNTQVEEEVSQAEVKLESQQEETIETPEDSEARTEIEEKKALDSTEEEQDLSGETEKVTIAEESQEALPQQKPTTKEPLLISQSLESPYIPDQAPKSTDRWKEQALDFWSWLVEAIKSPTSSLETSSTHSYTAFLLLILFSASSFFFSIYHIKHAYYGHIATMHNHFPEQFASLNLFSIISILVATTLFFFSFLLGSFVVRRFIYQEKDWTLEKVLQQYSQLLAIPIFLTTIASFFAFFDSLRFTALLCVISIGIILLASLHIITRPSQASETDSFYQLFLSVLVNGVIILLFFVAEVALIGDYLRILAFL
>NZ_CP012646.1|WP_060627368.1|478294_479155_+|DUF4299-domain-containing-protein
MTKTFFIPNKQSILGEQEILTAKSILALVDGLESHSYDAVYLRQPLNRLEYIECAIVGQSQFLFKVSYADGQKAYRVDLPDLLTKTDWEIIKTFLEALLAYTGTEIEGLDGFDFEAYFQASIQSYLADTAARFTICQGIFNPVFFGHEDLKSFLEENGLAQFEARVRAVQETDAYFARVSFYQDGEGQVHGVYHLAQGVKTVLPREPFVPAAYIEQLVDKEVQWEIDLVQITGDGSKPEDYEAIVRLDYAKFLESLPSASYHQLDANQLEVQPILDKDFKALAQEK
>NZ_CP012646.1|WP_060627367.1|477186_478173_+|rhodanese-related-sulfurtransferase
MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILIADEGINGTVSGDYETTQKYMDYVHSLPGMEDLWFKIDEENEQAFKKMFVRYKKEIVHLGLEDNDFDNDINPLETTGAYLSPKEFKEALLDEDTVVLDTRNDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHGGIATYGKDPEVQGELWDGKMYVFDERIAVDVNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEENEDKYLRGCSHECRVHPRNRYVSENELTQAEVVERLAAIGESLDQAATV
>NZ_CP012646.1|WP_060627366.1|476760_477057_+|bacteriocin-immunity-protein
MTPLKWFAGGSERRCEAMTIIDHLLEDIKDTPQLAPLKNLLVSYKRRLEDDGTSTPFILSQMNVDISRVLIDNKLMLSENQADQIKKLRELSAIRYGY
>NZ_CP012646.1|WP_060627365.1|476001_476691_+|CPBP-family-intramembrane-metalloprotease
MKKYRLLFKISAVFSYLFFVFGLSQLTLIVQNYWQFSSQIGNFVWIQNLLSLLFIGVMIWILVKTGHGYLFRIPRKKWLWYSILTVLVVVLQISFNVQTAKHVQSTAEGWAVLIGYSGTNFAELGIYITLFFLTPLMEELIYRGLLQHAFFKHSRFGLDLLLPSILFALPHFSSLPSLLDIFVFATSGIIFASLTRYTKSIYPSYAVHMMNNIFATLPFLLTFLHRVFG
>NZ_CP012646.1|WP_049488632.1|474287_475769_+|DUF3502-domain-containing-protein
MKNWKKYAFASASVVALAAGLAACGNLSGNKKAADSASGEKTVIKMYQIGDKPDNLDELLENANKIIGEKVGAKLDIQYLGWGDYDKKMSVITSSGENYDIAFASNYVVNAQKGAYADLTDLYKKEGAELYKALDPAYIKGNSINGKIYAVPVAANVASSQNFAFNGTLLAKYGIDISGVTSYETLEPVLKQIKEKAPDVVPFAVTKNFIPSDNFDYPVPNGLPFVIDLEGDTTKIVNRYEVPRFKEHLKTLHKFYEAGYIPKDVATSDTSFDLQQDTWFVREETVGPADYGNSLLSRVANKDIQIKPITNFIKKNQTTQVANFVISNNSKNKEKSMEVLNLLNTNAELLNGLVYGPEGKNWEKIEGKENRVKVLDGYKGNTHMGGWNTGNNWILYINENVTDQQIADSKKQLAEAKESPALGFIFNTDNVKSEISAISNTMQQFDTAINTGTVDPDKAIPELMEKLKSEGAYEKVLNEMQKQYDEFLKNKKS
>NZ_CP012646.1|WP_060627364.1|473261_474185_+|carbohydrate-ABC-transporter-permease
MAEKKIKKEKIDNVGIHSFSKKADIFFSTISGLVALSCILPFVFVIVISVTDEKSILQNGYSFFPSQFGLDGFEFLAQFKDKILQALFISVFVTVVGTITNVFITTTYAYAISRTTFKYRRFFTIFALLSMLFNAGLVPGYIVVTRLLQLGDTVWALIIPMLLSPFNIILMRSFFKKTIPEAILESARIDGASEARIFFQICLPLSLPGIATITLLTALGFWNDWFNALLYIKSDNLYPLQYLLMQIQQNMDYIAKAVGLSGQLGVALPKETGRMAMVVVATLPIAILYPFFQRYFVKGLTIGGVKE
>NZ_CP012646.1|WP_060627372.1|482410_483577_-|MFS-transporter
MKKQSLFFVPGIILIGVSLRTPFTVLPIILGDISQGLGVEVSSLGVLTSLPLLMFTLFSLFSTRLAQKIGLEHLFTYSLFFLTIGSLIRLINLPLLYLGTLMVGASIAVINVLLPSLIQANQPKKIGFLTTLYVTSMGIATALASYLAVPITQASSWKGLIILLTLLCLATFLVWLPNHRYNHKLAPQTKQKSKAKVMRNKQVWAVIVFAGFQSLLFYTAMTWLPTMAIHAGLSSHEAGLLTSIFSLISIPFSMTIPSLTTSLSTRNRQLMLTLVSLAGVVGISMLFFPIGNFFYWLASHLLIGTATSALFPYLMVNFSLKTSAPEKTAQLSGLSQTGGYILAAFGPTLFGYSFDLFHSWVPAVAALLLVDILMTVALFTVDRADKIL
>NZ_CP012646.1|WP_060627373.1|483731_484562_+|glycosyltransferase
MSEKQKISVLMSVYIKENPTFLKDAIESVQNQTLKPSELVLVEDGPLTPELYQVLDQLEAGSDIPVKRYPLEQNQGLGLALRQGVLQCQYDIIARMDTDDIAVPDRFEKQVQLMEKNNLDLLGGHIAEFIDNPDEIVSYRRVPTQHADIVAYQRMRSAFNHMTVMFKKDMVLKAGNYEDGLYMEDDLLWLNMIAAGAKTGNLDQILCKVRVGAGMFERRGGLRYLKLYRQARQRMLKRGQISYMEYAKSVAIQMVVALCPGFVRQFIFMKLLRKSK
>NZ_CP012646.1|WP_045605200.1|484647_486498_+|polysaccharide-biosynthesis-protein
MNKKLTDYVIDLVEILNKQQKQVFWGIFDILSMVVSIIVSYILFYGLINPAPVDYIIYTSLAFLFYQLMIGFWGLNASISRYSKITDFMKIFFGVTASSILSYSICYAFLPLFSIRFIVLFILLSTFLILLPRITWQLIYSKRKKGSGDGEHRRTFLIGAGDGGALFMDSYQHPTSELELVGILDKDSKKKGQKLGGIPVLGSYDDLPELAKRHQIERVIVAIPSLDPSEYERILQMCNKLGVKCYKMPKVETVVQGLHQAGGGFQKIDITDLLGRQEIRLDESRLGAELTGKTILVTGAGGSIGSEICRQVSRFNPERIVLLGHGENSIYLVYHELIRKFQGIDYVPVIADIQDYDRLLQVFEQYKPAIVYHAAAHKHVPMMERNPKEAFKNNIRGTYNVAKAVDEAKVPKMVMISTDKAVNPPNVMGATKRVAELIVTGFNQRSQSTYCAVRFGNVLGSRGSVIPVFERQIAEGGPVTVTDFRMTRYFMTIPEASRLVIHAGAYAKDGEVFILDMGKPVKIYDLAKKMVLLSGHTESEIPIVEVGIRPGEKLYEELLVSTELVDNQVMDKIFVGKVNVMPLEAIDQKIEEFRTLSGDELKQAIIAFANQTTHVE
>NZ_CP012646.1|WP_060627374.1|486607_487240_-|HAD-IA-family-hydrolase
MTSISAIFFDLDGTLVDSSIGIHNAFTHTFKELGVSSPDAKTIRGFMGPPLESSFATCLPKEQISEAVQIYRSYYKEKGIHEAQLFPQIVELLEELSSNYPLYITTTKNTPTAQDMTKNLGIYHFFDGIYGSSPEAPHKADVIRQALQTHQLKPEQVIIIGDTKFDMLGAQETGIQKLAVTWGFGEQADLLNYQPDYIAHKPIEVLAYFQ
>NZ_CP012646.1|WP_020902659.1|487261_488134_-|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha
MFYSIKELVEQADLDFQGNVAELMITTEFELTGREREEVFLLMERNLEVMKASVQLGLNENKSRSGLTGGDAAKLDHYIKNGKTLSDYTILSAARNAIAVNEHNAKMGLVCATPTAGSAGCLPSVLTAAIEKLDLSHEQQLDFLFAAGAFGLVIANNASISGAEGGCQAEVGSASAMSAAALTLASGGTPYQASQAIAFVIKNMLGLICDPVAGLVEVPCVKRNAMGASFAFIAADMALAGIESKIPVDEVIDAMYQVGASMPTAFRETAEGGLAATPTGRRLQKEIFGE
>NZ_CP012646.1|WP_000838912.1|488142_488814_-|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta
MKSLRFQSVFDIIGPVMIGPSSSHTAGAVRIGKIVSSIFDDTPTEVEFQLFNSFAKTYRGHGTDLALVAGILGMDTDDPEIPNSLEIAHKRGIKIVWTIQKDSNAPHPNTTKITVKNAHKTISVTGISIGGGNIQVTELNGFAVSLNMNTPTIIIVHQDIPGMIALVTEALSRYGINIAQMNVTREKAGEKAIMIIEVDSRNCDEAIEEIRKIPHLHNVNFFK
>NZ_CP012646.1|WP_060627375.1|489053_489704_+|LysM-peptidoglycan-binding-domain-containing-protein
MKSTTKKIKTTLAGVAALFAVFAPSFVSAQESSTYTVKEGDTLSEIAETHNTTVERLAENNHIDNIHLIYVGQELVIDGPVAPATTPAQTTYAAPAAQDETVSAPVAETTEVAEEAAPVASAPAAEETVTSTETSAPAATVSGSEAEAKEWIAQKESGGSYTATNGQYIGRYQLTDSYLNGDYSAENQERVADAYVAGRYGSWSAAKNFWLNNGWY
>NZ_CP012646.1|WP_060627376.1|489837_490695_+|helix-turn-helix-transcriptional-regulator
MHALLATRLKNKRKELGWSQKELAEGICQQTQISRMEQGKYMPGADLLYKLSEKMGLNMDYFFSGEISKEFLGLSAFKRLSETLLENQDYASLKYAFEGERKQQTSLSFDEKIYLDWIDAILTYQCEHQLKLAISKIEDILSRISIEKVDYLYILNTLLIFLGYDEDKEKFEQLYDQVSVALSKIDTSVREQIELYIKIKYNYCYHLWKQEEMDKSRAILLEIIKFCNKYHSSFRLADLYCLLGNVTENLDISVAKDYYMKAKVLYLIENNEVMTLKVEQYLMDK
>NZ_CP012646.1|WP_060627377.1|491079_491667_+|hypothetical-protein
MNYNLKYLLSGIFVIVFIGFLVWMRYFNQKKEEEHSDVSFEARLDSEVKTLYKQLALSEEPHYFLAYRYLHPWFNLAILPPTVEIFLTKIALVMVTPDELLIRNLGNGMTFTSEHHRDLRQGLIRIPKSEMKEFEIRNWKKFFVFGDFLTIKTSQHSYYLQVRDDGLQKGSLSTKHFSDLKRQDFLGLLTDKRTF
>NZ_CP012646.1|WP_060627378.1|491952_494061_+|amino-acid-ABC-transporter-permease
MKKISHLCMLLLLLCTTFFVLNVNVTREIVRIQEMGKTTYSFDLYLKDVTKPTETILQFFEEVASQDKVSIIKVDNGDEVVKAGVFDKETFPYQEFGLTSLDFSKNEKGVYSNQDLPNNLGTIPTFLKVKLIRLQTFQSYIEDKSHTVNGRYMITSSKEIDRDTILQKWSDFFQIDKTILLEPTYRSQVGVLNQALLLSIIIFILAILLVILMTVYQPMMEMKRVGVQKLLGFQSRAILAGFVKTNFYLLLGGSLIIDLGLFLVLDYRPKLLFPSLLLSQFLLLQLYLFISWLTYLMIQKMTVSSMLKGFSSVKLGLIFNYVMKIGTTILLTALLIGVGRSLEQENKELAYQQQWVSQGNYLTLETFQLNDNLWQEELAGSGKSTDYFYQFYQDLLAKIQVNYVRSASLPIKPVIKAEQVQQYQLPDKVDVYYANRQFLDSQGFKLPDTGTKKVILLPASDKGQEGKNQFLGKSIAYLSLRYEDQQKQTIEDMDVEIAYYEGDWSFFPYNNERKENLHNPIISLVNDQDMMWEEKTHLSTTGLNNPMKIENTEQNQKVITELIDNLSDGSYLKFSSIQAIQEEMVDTYRDSVRNFNVLFALFALLSMIVSYFLLVTTFLLKRRDIITKKFMGWKLVDRYRALLVLLLLGYSLPLLVLIFFAHAFLPLLLFAGFTCLDILFVLVLASRMEKRSLVELLKGGIL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP012646_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012646_2

1836682-1836880

Orphan

Consensus_repeat	Method
TTTGAAGTATATATGAGAAAGATGGGTTTTACAAGCATAACTGAATATA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP012646_2

>merge|NZ_CP012646|2|1836682-1836880|CRISPRCasFinder
TTTGAAGTATATATGAGAAAGATGGGTTTTACAAGCATAACTGAATATACAGAACATATGATGAGTATGGAAGATTTTGAAGTATATATGAGAAAGATGGGTTTTACAAGCATAATTGAATATATAGAACATATGATGAGTATGGAAGATTTTGAAGTATATATGAGAGAGAGGGGTTTGATAAGTATAATTGAAGATG

>NZ_CP012646|2|2|1836682-1836880|CRISPRCasFinder
TTTGAAGTATATATGAGAAAGATGGGTTTTACAAGCATAACTGAATATA	CAGAACATATGATGAGTATGGAAGATTTTGAAGTATATATGAGAAAGATGGGTTTTACAAGCATAATTGAATATATAGAACATATGATGAGTATGGAAGAT
TTTGAAGTATATATGAGAGAGAGGGGTTTGATAAGTATAATTGAAGATG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012646.1\|WP_000819520.1\|1849641_1850487_-\|carbohydrate-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223472
NZ_CP012646.1\|WP_060628690.1\|1831529_1831871_-\|DUF771-domain-containing-protein	unknown	unknown	gnl\|CDD\|368511
NZ_CP012646.1\|WP_060628692.1\|1833490_1834225_-\|DUF87-domain-containing-protein	unknown	unknown	gnl\|CDD\|224588
NZ_CP012646.1\|WP_049537159.1\|1826357_1826897_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012646.1\|WP_060628700.1\|1845512_1846517_+\|NADP-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|176191
NZ_CP012646.1\|WP_000032530.1\|1850488_1851391_-\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224096
NZ_CP012646.1\|WP_060628698.1\|1841798_1842887_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NZ_CP012646.1\|WP_060628701.1\|1848312_1849632_-\|glycoside-hydrolase-family-32-protein	unknown	unknown	gnl\|CDD\|224536
NZ_CP012646.1\|WP_060628697.1\|1840189_1840528_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP012646.1\|WP_000672744.1\|1841007_1841523_+\|DUF308-domain-containing-protein	unknown	unknown	gnl\|CDD\|225786
NZ_CP012646.1\|WP_060628696.1\|1837006_1840054_-\|SEC10/PgrA-surface-exclusion-domain-containing-protein	unknown	unknown	gnl\|CDD\|227588
NZ_CP012646.1\|WP_060628693.1\|1834208_1834859_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012646.1\|WP_000257122.1\|1828097_1828568_-\|DUF3013-family-protein	unknown	unknown	gnl\|CDD\|337951
NZ_CP012646.1\|WP_060628689.1\|1830342_1831485_-\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271189
NZ_CP012646.1\|WP_060628688.1\|1826999_1828079_-\|site-2-protease-family-protein	unknown	unknown	gnl\|CDD\|308008
NZ_CP012646.1\|WP_001062791.1\|1842896_1844186_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012646.1\|WP_001113233.1\|1828683_1829955_+\|replication-associated-recombination-protein-A	unknown	unknown	gnl\|CDD\|237355
NZ_CP012646.1\|WP_060628691.1\|1831946_1833179_-\|replication-initiation-factor-domain-containing-protein	unknown	unknown	gnl\|CDD\|367101
NZ_CP012646.1\|WP_060628699.1\|1844989_1845421_+\|Rrf2-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224870
NZ_CP012646.1\|WP_060628694.1\|1834869_1835166_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP012646.1\|WP_000819520.1\|1849641_1850487_-\|carbohydrate-ABC-transporter-permease	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	2.95844e-74
NZ_CP012646.1\|WP_060628690.1\|1831529_1831871_-\|DUF771-domain-containing-protein	gnl\|CDD\|368511	pfam05595, DUF771, Domain of unknown function (DUF771). Family of uncharacterized ORFs found in Bacteriophage and Lactococcus lactis.	3.00574e-26
NZ_CP012646.1\|WP_060628692.1\|1833490_1834225_-\|DUF87-domain-containing-protein	gnl\|CDD\|224588	COG1674, FtsK, DNA segregation ATPase FtsK/SpoIIIE and related proteins [Cell division and chromosome partitioning].	4.45612e-08
NZ_CP012646.1\|WP_060628700.1\|1845512_1846517_+\|NADP-dependent-oxidoreductase	gnl\|CDD\|176191	cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	7.37867e-110
NZ_CP012646.1\|WP_000257122.1\|1828097_1828568_-\|DUF3013-family-protein	gnl\|CDD\|337951	pfam11217, DUF3013, Protein of unknown function (DUF3013). This bacterial family of proteins with unknown function appear to be restricted to Firmicutes.	2.71327e-66
NZ_CP012646.1\|WP_000032530.1\|1850488_1851391_-\|sugar-ABC-transporter-permease	gnl\|CDD\|224096	COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism].	2.87997e-91
NZ_CP012646.1\|WP_060628701.1\|1848312_1849632_-\|glycoside-hydrolase-family-32-protein	gnl\|CDD\|224536	COG1621, SacC, Beta-fructosidases (levanase/invertase) [Carbohydrate transport and metabolism].	7.47182e-177
NZ_CP012646.1\|WP_060628697.1\|1840189_1840528_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	2.64034e-09
NZ_CP012646.1\|WP_060628698.1\|1841798_1842887_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	1.32436e-33
NZ_CP012646.1\|WP_060628696.1\|1837006_1840054_-\|SEC10/PgrA-surface-exclusion-domain-containing-protein	gnl\|CDD\|227588	COG5263, COG5263, FOG: Glucan-binding domain (YG repeat) [General function prediction only].	1.13373e-53
NZ_CP012646.1\|WP_000672744.1\|1841007_1841523_+\|DUF308-domain-containing-protein	gnl\|CDD\|225786	COG3247, HdeD, Uncharacterized conserved protein [Function unknown].	1.67498e-06
NZ_CP012646.1\|WP_060628689.1\|1830342_1831485_-\|site-specific-integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	3.52874e-34
NZ_CP012646.1\|WP_060628688.1\|1826999_1828079_-\|site-2-protease-family-protein	gnl\|CDD\|308008	pfam02163, Peptidase_M50, Peptidase family M50.	4.26644e-06
NZ_CP012646.1\|WP_001113233.1\|1828683_1829955_+\|replication-associated-recombination-protein-A	gnl\|CDD\|237355	PRK13342, PRK13342, recombination factor protein RarA; Reviewed.	0
NZ_CP012646.1\|WP_060628691.1\|1831946_1833179_-\|replication-initiation-factor-domain-containing-protein	gnl\|CDD\|367101	pfam02486, Rep_trans, Replication initiation factor. Plasmid replication is initiated by the replication initiation factor (REP). This family represents a probable topoisomerase that makes a sequence-specific single-stranded nick in the plasmid DNA at the origin of replication. Human proteins also belong to this family, including myelin transcription factor 2 and cerebrin-50.	2.5526e-14
NZ_CP012646.1\|WP_060628699.1\|1844989_1845421_+\|Rrf2-family-transcriptional-regulator	gnl\|CDD\|224870	COG1959, COG1959, Predicted transcriptional regulator [Transcription].	3.96877e-28

>NZ_CP012646.1|WP_060628694.1|1834869_1835166_-|hypothetical-protein
MNCLTLQTAGLLLGVSDSKDFETAVVVGATFQIGSRTANGRFTTHSIKVMNVNASDFIKYLDSVVTLTLSNTTISSYISGNSASLSIKADSVKVSQAS
>NZ_CP012646.1|WP_060628693.1|1834208_1834859_-|hypothetical-protein
MFKNKYRVAIDYFKKRTELEKFLLILVSLALLISFIYALPAILDLLLKMVVLLLIALPFAVWVGLNTKREEVYYDNSKLSLCFKQIVSRLDSDSKNRYLFQKWQAVRASKKKTAKIIEVVCVTDSNVKDFNSNEVEAQINIYLSEFLENHAMTSTNAESFSCQSVAVAEYNNVNYLFIRFLLAVNGNEASSFKKELDVYKAKQEKIVQVEDSDFSN
>NZ_CP012646.1|WP_060628692.1|1833490_1834225_-|DUF87-domain-containing-protein
MISVINAVLDAELLKRGIHFPLPIDVKKPHLAIFGSSGSGKTYASQLLLAKAVLSSAKLVVADFKGDLEFSFLENQEHFYRFERVGLFFDFVSDTLLKNRQSGQDESRSLIICFIDEMSAYFTMLEKKERDTRIRQLSRILMLGRSFNIHVWISQQRPDAEYFGKSRENIHNILLLGSFSKEVLNMLISDEKDVVNRKHSRGRGYLISSGEATKEIVVPIYNVAKVQSKILEGMYKSSEAVDSE
>NZ_CP012646.1|WP_060628691.1|1831946_1833179_-|replication-initiation-factor-domain-containing-protein
MSYKNEIEEYLQKNNNRKPVIMTSIDEATFVIKPTEDTVGEYPDNWHQIALSLSETVAEKLSLPVLFGDYIPLKTSPAGYTDGFTFQNLPYYFAIAWHQTNFTMGIILKFSASALSHYKASYQDYYSEAIDVHNIAQLLYADYYDLRLSRIDLAVDYFNYPMSVSELYQSMKGKRYIITNHKGRKNVSNISAQEVNGQAQTIYIGSKKKNVNALLRIYNKYQEQLDNQGRYMHLTKYCNSWVRMEASYKGTYSNQILALLLDIDSPQDLSKLIVNKMIDKYCFHDTKTGQLLPFTSDLLKGFGSFPELESLNSRNNDLLATISYLLKGSGFYPLLKKIEEIWGTQARNHFIIRLIQEYEWNYLPNQDVELWINKFGSELSQLNYKEYFEDSFNLFYQKNNITPKRPKNKE
>NZ_CP012646.1|WP_060628690.1|1831529_1831871_-|DUF771-domain-containing-protein
MTEINKITVDLINIEIQLPEDKIIVDRKEYDNLQHNSSQGRYMTLSDVLQLLSVSRPWLLDNVLYNPKIRREIDVELNPNGFVKYPENQGGRYFFLASKTKQWFEENFREIMI
>NZ_CP012646.1|WP_060628689.1|1830342_1831485_-|site-specific-integrase
MATFRQRTKGGTWDYRIVDSDKKLVASKGGFRTKKEAEKEALAIELKLMSGAKINSQASLYELWEEWFDVVVRPLGKSESTLFKHMKRGDLIKELFQDRSATSIRFSQYQRALNSYAERVTKDTVARLNSEIRKVIQFAQRDQLDIVDFTDGAIISGMKKSKTTDEKYIDNIEDYYKILVHLKSHLNYSKSVIPYLLFVSFKTGMRFGEILGLTWDCVDFENQVIHTYRRYYNYKWRPPKTDTSVRDVPIDEETSEVLKLLKKEQKIVYKNQGIKEKENFLFYDTVYGVPSNNAVNQSLQTILKKLEIFPYNLTATGIRHTYASMLLAKGIDIWVVAHVMGHKNIKQVTETYGHLLKEKKEKEHQIIRNLLSEYPLVEQK
>NZ_CP012646.1|WP_001113233.1|1828683_1829955_+|replication-associated-recombination-protein-A
MPDNLALRMRPKTIDQVIGQEHLVGQGKIIRRMVEANRLSSMILYGPPGIGKTSIASAIAGTTKYAFRTFNATVDSKKRLQEIAEEAKFSGGLVLLLDEIHRLDKTKQDFLLPLLESGLVIMIGATTENPFFSVTPAIRSRVQIFELEPLSNQEVKEALQIALSNPERGFDFPVELDEDALDFIATSTNGDLRSAFNSLDLAVLSTPENDKGIRHITLDIMENSLQRSYITMDKDGDGHYDVLSALQKSIRGSDVDASLHYAARLIEAGDLPSLARRLTVIAYEDIGLANPEAQIHTVTALDAAQKIGFPEARILIANVVIDLALSPKSNSAYVAMDKALADLKTSGHLPIPRHLRDGHYSGSKELGNAQDYLYPHNYPGNWVKQDYLPEKIRNHHYFQAEDTGKYERALAQRKEAIDRLRKI
>NZ_CP012646.1|WP_000257122.1|1828097_1828568_-|DUF3013-family-protein
MATYGFLDVLEEELEKNFPFDFEISWDKRNHAVEVSFLLEAQNAAGVEMVDEDGEVSSDDILFEEAVLFYNPAKSTVNEEDYLTVIPYLPKKGFSREFLAYFALFLKDTAEVGLDALMDFLEDPEAEEFVMEWNQEVFEEGKVGLEEGEFYPYPRY
>NZ_CP012646.1|WP_060628688.1|1826999_1828079_-|site-2-protease-family-protein
MKKIGIYLVYVLAVVFIMLAFACGTIAFAELGYSALLVFSFGYAFAFLSMYVILILHELGHAFCGYLTGYRLVAFGLGHFILTKKLGRFHLSRTAILKNVGAQYIGLKEDESDQRIILMLSGGLMVHLSLILLAIVFGFLTRSWYFAGTWIFLNLSFFLNNILPVGITDGAKIWELLQHPENTKYAYLMLRHSAQTLLAPQEYDLKDFIMPVDEEVRGSFAESVQTLQGLVFILDDNIELAKQQFQSVLDKTDNPMSKTSSQLYLLQVALMEGDNKKAEEYASIRGVKSFLSLKTADMQVIQAWYQFKVKKDVVQTHKAMKIARQKMNSSRMLRDEKSYYQNWLEELEKEIHEENSVVS
>NZ_CP012646.1|WP_049537159.1|1826357_1826897_-|hypothetical-protein
MFHIFKQLFRKISPNSQEYGISLPRNRFENLDFERVLKCESRRFFNEGGLYDESAKIMELEFSEGFGEFEFLIYFKTGEEKQFEQLIASLNDFDNAIQSSLEREFQNSIPQNKKKLNNSRERREKYFYFHPWILSCEEAPPSLRYVADNVNDEFTVYFSKNQGRWQAYWDLDCQKLIQE
>NZ_CP012646.1|WP_060628696.1|1837006_1840054_-|SEC10/PgrA-surface-exclusion-domain-containing-protein
MKKSTIAMTAAAAATVSLFNTVGAEEVAPKSVNVEAPKAEVVETTAPAVATKEEVATKEAEAKKADQDVVEAKQAVKDAKRATNEADSLVNEKTEAVKKAEDFAKKASPAVITEAEKAVVKAEAKVPAKAEALKNAEAKATEASQAVSAQEAVVAEKEDTQATKEKALTSATEAVQIATDAVNGKGLENAKEAQKEAVEAEKTSKQAQTDAETALKEAEKANQATKAQIKNTQADIATKTQAVSDAKAEQEKADKAVTDLTAEYNQAVSALKAIQNTKQGTITLAPKFIEAVKARVALLKAVENGEYNDRLDEVPVKFKETRAEILKTQLENAQINHFVPVESDSKDTKKYDLNSLPEDFKRDLTLYAADLTNQMRRQLGLSDVKVTEDSFHFADKIAREYEKDGVTPELLDSYRAKKNGHGHYAVGINKVAKEYGLNDGMSETDRKEGEGRGLQSYENSVNFIETNPKKKFELEYLTKSEIRTKLYESLVMFVSTENDYGHTRGTLGFEKGDTTLYYGGFGASQVAGMYTLHTVPGIPETFMANSTFSRTEVENPYTKARDTDSVKKAEDLVATKKAEKAQAEETLKTANQTVAEAETALQTANSNLKAQEAKLVDTVALKQALQSATTTHNQAVVALSNANALVATLSATKADKEAKLAELKATAKQAEKEFNQAKAETKAEKATLSSLQAKAEEATKAVSVAKEALNQAKAQVVSSKELVQDLKVAAKELETRKAELKDAEEALKEAKANQATAQETLEAKEKEAKEANKAYATAKASYEAEELKKHPVTDKGIPEVRPALPEFVLPTTPSVPSVPNAPVSPVAPVVPVVSTTSRVEVPVVNNNGGVSGQDKAKVDVVAKQKTETKNTKDSQAGNWIESAGRWWYQHEDGSYTSNGWEQIKGTWYYFDNTGWMQTGWVKTGGSWYYLNETGSLATGWVKDNGTWYYLKENGKMATGWVKDNNTWYYLDSAGAMKTGWFTVSGKWYYAYSSGALAVNTTTPDGYTVNANGEWV
>NZ_CP012646.1|WP_060628697.1|1840189_1840528_+|helix-turn-helix-transcriptional-regulator
MTNNKNNLQDYISKRIRLLRLERGYTQEQLEEMADLGTNYIYKLENLSTNLKIQTLEKVMEALEVDLDTFFDIQLKEEDPKISILVDELKTLPTEQRSRVLDALILILKEIR
>NZ_CP012646.1|WP_000672744.1|1841007_1841523_+|DUF308-domain-containing-protein
MKFSNRLSLFLAGVVFVLLGLFLFTNPVANLVAYSWWIAFGLLVSSIAAILGYFSVPKELRSPAHLFQGIVNLLLALYLVAYGFVTLPVVIPTILGIWLIVEAIIVFFKGNRLGLIFPIIGNHIMWIALLAFLLGLVILFNPVATSVFVVYVVAFAFLIVGFTYILDAFRK
>NZ_CP012646.1|WP_060628698.1|1841798_1842887_-|AI-2E-family-transporter
MNLVKKYTPLILFIGLVTLVILNASSFISGAVSLFEVTSTLIYGAVIAFVLNVPMKKIEQYLVKLKVKAGLRRPIAMVLVFLSLILIVICLLVLVLPTLAQTISQLGAVLSTVLTQLGKLLDSSEFVTKDMLSTIVSGIQGQSSSISQALITFLSGLTSNIGNIFSSIMNAFLIIVFTFLFLSSKEHLAAMTSRLLKVIFPEKVVTKLTYIGQVALETYDQFLMSQLIEAVIIGVMIAVGYSLFGLPYGVMTGIFAGVLSFIPYVGPMIACVVGAIFIFTVSPTQALLSLLLYQVIQLIEGNLIYPRVVGQSIGLPAIFTLAAASIGGNLFGLLGMIFFTPIFAVIYRLVKEFVVAKENQLD
>NZ_CP012646.1|WP_001062791.1|1842896_1844186_-|hypothetical-protein
MAKILSLGLTGKKLLAQGFLFVLLGLILMVTGTWLPVTVIRLVLFLAWIATVVDLLLRVFKKSQSTDTLGVALVKLLVLGYLLGSNLATDVPIYILALVIGVYQIFHASINLVTYVLYRKNKIRPRFRLLLDGLVLVFLGGTSLLSSTGNSVFQLFVLGAYFFLYGLSNIRDGFLFEGEIGKNHLKRRIRISLPIVLAALIPARTLAKINKFMQENADEREDIHLGMVKSGKTAELEIFVHTAETSLFSAIGHVDICYQGRVISYGNYDPSSETLFGMVGDGVLYFCDRDKYIDLCKRESQKTLFGYGIDLTPEMEKAVQKKLAELKQLTIPWEPSADKIMTGDGKEDYTYAYKIRHETDGELYKFIKSKFKSYFVLSTNCVLLADTIVGQAGTDILSPKGFIAPGTYQAYLDREFEKPNSIVVSKHVY
>NZ_CP012646.1|WP_060628699.1|1844989_1845421_+|Rrf2-family-transcriptional-regulator
MDTKFSVALHILTMINESKETLSSQALAISVGTNASYIRKVISLLKNANLIHSQQGKTGYQLSKPPKKMTLLEIYYATQEINHISLFPVHQNSNPDCPVGKHIQGAVSPLFASAESQLEEELANQTLEDVIDNLYKQAKQVRN
>NZ_CP012646.1|WP_060628700.1|1845512_1846517_+|NADP-dependent-oxidoreductase
MKAAQHTTYNKNNITLNITEIAKPSITEKEVLVKVTAAGVNPLDNMISRGEVKMIVPYKLPQTAGNEVVGIVEATGRQVKNFKVGDRVFGRLPLDHIGAFAEYVAVDSQALAKAPDYLSDEETAAVPLTALTIMQALDLMGAQAGKTIFISGGTGGVGGMAIPIAKAKGLKVIINGSGDSAERVLKLGADRFIDYKTEDYTKTVSQVDYVLDTLGGAETEKQMSIMKKGGHLVSLRAMPNGAFAKRMNLPKWKQIILGLAGRKFDKMAEKYGVHYHFIFVESNGAQLQEVADLFSKLEIKPSIDTVYPFEEVNSALDKVANGRSRGKTVLSFKK
>NZ_CP012646.1|WP_060628701.1|1848312_1849632_-|glycoside-hydrolase-family-32-protein
MINKTFTVEKANRFIAENKHLVNTQYKPEEHFSAEIGWINDPNGFVYFRGEYHLFYQFYPYNSVWGPMHWGHAKSKDLVTWEHLPVALAPDQDYDRNGCFSGSAIVKDDRLWLMYTGHIEEETGVRQVQNMAFSDDGIHFEKIEQNPVATGADLPDELIAADFRDPKLFEKDGRYYSVVAAKHKDNVGCIVLLGSDNLVEWQFESIFLKGVEHQGFMWECPDYFELDGKDCLIMSPMRYQREGDSYHNINSSVLFTGKVDWGEKRFIPESVQEIDHGQDFYAPQTLLDDQNRLILIAWMQTWGRTLPTHDQEHKWACAMTLPRILRLEDGKLRQFPVKKGQYQIQIDKNCHYHLGNDTDYLEFGYDSNAQQVYIDRSHLVQKILGEEEKDTSRRYVDIEAKELEVVLDKNSIEIFVNQGEASLTATYYLTVPAELSRID
>NZ_CP012646.1|WP_000819520.1|1849641_1850487_-|carbohydrate-ABC-transporter-permease
MKRFKPTTILEYILLTLLAGLFLFPMVWMVVSAMKPEADVYKNLTSWQAFLPSLNPADWFKPYQEVFERFSIFTYLGNSIFYAGTFAIGSIIVNALAGFAFAKVNFSGKKILFGFLLALLIIPVETVLIPQFTIINSLGLVNNRLAVIIPGLASVFNIYLFRNFFIAIPEEILESAKMDGASIVRIFFRIMLPMSKPAVATVGVLSFISSWNDYIWPLMVLTDSSKFSMQVAITTINTTQPVYINQVMAVLTISTIPLILVYVVAQKYIVQGLGGSGTGIK
>NZ_CP012646.1|WP_000032530.1|1850488_1851391_-|sugar-ABC-transporter-permease
MSKETVVDTKRREKIKDNILGYSFLAPALILLGIFLVIPVGMVIYYAFTDYYLLTPDERKFVGLENFIRLIKDPIFLKSFLNTLKFVVWIIPVQLGAALGMALIVNKKRKGNMFFKVAFFAPVVMSLVVISILWLYLLNPNSGLLNAILNKVGIASQPFLTSPKQAMYAIVFVSAWQGAGYQMLLFLGGMQNIPQDVYEAAELDGFSKWAQFRYITMPLLKPTALFVLLTTLISAFKLIVQPMVMTQGGPLNSTITMVYYIYQQGFTDRLVGYSSSIALVFTTLIGMISLVQRRVLKEDD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

315113 : 326586

Synechococcus_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060627287.1\|315113_315668_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	9.9e-24	35.2
WP_060627288.1\|315664_316687_-	phosphoribosylformylglycinamidine cyclo-ligase	R9TMC7	Synechococcus_phage	4.7e-64	43.4
WP_060627289.1\|316730_318173_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.3e-54	34.9
WP_060627290.1\|318266_321992_-	phosphoribosylformylglycinamidine synthase	A6N228	Microbacterium_phage	3.6e-37	26.0
WP_060627291.1\|322192_322900_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A1D7SE76	Cyanophage	1.3e-41	39.7
WP_060627292.1\|323070_324420_-	HlyD family secretion protein	NA	NA	NA	NA
WP_060627293.1\|324432_326586_-	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	2.3e-44	28.7

DBSCAN-SWA_2

394911 : 403658

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_049521113.1\|394911_396390_+	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	7.5e-95	40.5
WP_000266678.1\|396439_397537_-	DNA replication/repair protein RecF	NA	NA	NA	NA
WP_045612493.1\|397539_397908_-	S4 domain-containing protein YaaA	A0A1X9I5V8	Streptococcus_phage	6.3e-19	60.0
WP_045612492.1\|398066_399317_+	insulinase family protein	A0A1X9I714	Streptococcus_phage	5.4e-94	42.3
WP_060627328.1\|399313_400597_+	insulinase family protein	A0A2L2DIR8	Acanthamoeba_polyphaga_mimivirus	2.8e-13	28.5
WP_045612488.1\|400638_401454_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_000712127.1\|401464_402010_+	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_045612486.1\|402006_402834_+	energy-coupling factor transporter ATPase	G9BWD6	Planktothrix_phage	9.6e-23	32.9
WP_060627329.1\|402818_403658_+	energy-coupling factor transporter ATPase	A0A2K9L3Z8	Tupanvirus	2.7e-17	30.7

DBSCAN-SWA_3

476001 : 526622

Planktothrix_phage(22.22%)

protease,tRNA,transposase,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060627365.1\|476001_476691_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_060627366.1\|476760_477057_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_060627367.1\|477186_478173_+	rhodanese-related sulfurtransferase	NA	NA	NA	NA
WP_060627368.1\|478294_479155_+	DUF4299 domain-containing protein	NA	NA	NA	NA
WP_060627369.1\|479331_480396_-	hypothetical protein	NA	NA	NA	NA
WP_060627370.1\|480458_481373_-	DUF4097 family beta strand repeat protein	NA	NA	NA	NA
WP_060627371.1\|481365_481959_-	DUF1700 domain-containing protein	NA	NA	NA	NA
WP_000273858.1\|481945_482272_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_060627372.1\|482410_483577_-	MFS transporter	NA	NA	NA	NA
WP_060627373.1\|483731_484562_+	glycosyltransferase	NA	NA	NA	NA
WP_045605200.1\|484647_486498_+	polysaccharide biosynthesis protein	A0A2P1ELS8	Moumouvirus	1.3e-27	30.5
WP_060627374.1\|486607_487240_-	HAD-IA family hydrolase	NA	NA	NA	NA
WP_020902659.1\|487261_488134_-	L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha	NA	NA	NA	NA
WP_000838912.1\|488142_488814_-	L-serine ammonia-lyase, iron-sulfur-dependent, subunit beta	NA	NA	NA	NA
WP_060627375.1\|489053_489704_+	LysM peptidoglycan-binding domain-containing protein	A0A288TY55	Enterococcus_phage	1.1e-26	58.2
WP_060627376.1\|489837_490695_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_060627377.1\|491079_491667_+	hypothetical protein	NA	NA	NA	NA
WP_060627378.1\|491952_494061_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_060627379.1\|494057_494687_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.3e-23	35.9
WP_060627380.1\|495279_496401_+\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_060627381.1\|496541_496997_+	NUDIX hydrolase	NA	NA	NA	NA
WP_060627382.1\|497005_497437_+	NUDIX hydrolase	NA	NA	NA	NA
WP_060627383.1\|497426_499340_+\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
WP_000331983.1\|499378_501058_-	ribonuclease J	S0A5H7	Cellulophaga_phage	1.5e-06	29.9
WP_000639575.1\|501059_501293_-	DNA-dependent RNA polymerase auxiliary subunit epsilon family protein	NA	NA	NA	NA
WP_000282478.1\|501573_501789_+	hypothetical protein	NA	NA	NA	NA
WP_000974044.1\|502091_502244_-\|bacteriocin	fratricide two-peptide bacteriocin subunit CibB	NA	NA	NA	NA
WP_000180841.1\|502245_502431_-\|bacteriocin	fratricide two-peptide bacteriocin subunit CibA	NA	NA	NA	NA
WP_060627384.1\|502622_503306_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_060627385.1\|503302_503740_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_060627386.1\|503729_504740_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.7e-61	41.3
WP_060627387.1\|504843_505707_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_004254985.1\|505937_506222_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_060627388.1\|506343_507570_+	MFS transporter	NA	NA	NA	NA
WP_001224323.1\|507713_508340_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_000036821.1\|508339_508852_+	DUF308 domain-containing protein	NA	NA	NA	NA
WP_000659743.1\|509092_509788_+	AzlC family ABC transporter permease	NA	NA	NA	NA
WP_000253937.1\|509777_510101_+	AzlD domain-containing protein	NA	NA	NA	NA
WP_004254995.1\|510310_511141_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_060627389.1\|511294_512149_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_060627390.1\|512248_513622_+	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_060627391.1\|513614_514676_+	methionine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.7e-29	35.7
WP_000444642.1\|514677_515370_+	ABC transporter permease	NA	NA	NA	NA
WP_060627392.1\|515399_515969_-	MptD family putative ECF transporter S component	NA	NA	NA	NA
WP_060627393.1\|516103_516718_+	DUF624 domain-containing protein	NA	NA	NA	NA
WP_172672636.1\|516719_518366_+	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	1.1e-09	25.2
WP_060627394.1\|518377_519664_+	response regulator transcription factor	NA	NA	NA	NA
WP_060627395.1\|519724_520258_+	hypothetical protein	NA	NA	NA	NA
WP_049543128.1\|520335_520800_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	NA	NA	NA	NA
WP_060627396.1\|520846_521305_-	DUF3021 domain-containing protein	NA	NA	NA	NA
WP_060627397.1\|521301_521742_-	response regulator transcription factor	NA	NA	NA	NA
WP_060627398.1\|521947_523897_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	3.8e-70	31.9
WP_060627399.1\|524025_524619_+	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_060627400.1\|524628_525192_+	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_155455657.1\|525273_526622_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	6.9e-63	51.9

DBSCAN-SWA_4

688284 : 693346

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060627534.1\|688284_688971_+	helix-turn-helix transcriptional regulator	A0A1S5SAF1	Streptococcus_phage	1.0e-54	49.2
WP_060627536.1\|688974_690390_+	Y-family DNA polymerase	M1Q231	Streptococcus_phage	7.2e-196	71.1
WP_060627538.1\|690386_690749_+	hypothetical protein	M1PLN9	Streptococcus_phage	1.5e-25	49.2
WP_060627543.1\|690741_691035_+	hypothetical protein	Q6DMX6	Streptococcus_phage	2.3e-19	55.1
WP_045612268.1\|691177_691654_-	glutathione peroxidase	Q6VZR0	Canarypox_virus	5.7e-20	36.5
WP_000711244.1\|691650_692229_-	DUF3278 domain-containing protein	NA	NA	NA	NA
WP_060627547.1\|692593_693136_-	DUF3278 domain-containing protein	NA	NA	NA	NA
WP_001082470.1\|693151_693346_-	helix-turn-helix transcriptional regulator	A0A142LP09	Marinitoga_camini_virus	5.5e-06	37.1

DBSCAN-SWA_5

1070980 : 1078258

Streptococcus_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060627956.1\|1070980_1071475_+	GNAT family N-acetyltransferase	M1PSC3	Streptococcus_phage	1.9e-42	52.1
WP_060627958.1\|1071474_1071993_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	2.7e-47	55.6
WP_060627960.1\|1071998_1072355_+	arsenate reductase family protein	M1PLC0	Streptococcus_phage	2.6e-33	57.3
WP_001103449.1\|1072512_1073313_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_000590982.1\|1073312_1074056_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.7e-29	40.5
WP_000926599.1\|1074133_1074358_+	DUF4059 family protein	NA	NA	NA	NA
WP_060627963.1\|1074423_1075335_+	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	2.9e-89	51.5
WP_060627964.1\|1075373_1076102_-	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
WP_045611905.1\|1076146_1076758_-	peptide deformylase	E3SLL2	Synechococcus_phage	4.9e-16	42.4
WP_080976377.1\|1076932_1078258_+	CapA family protein	A0A0N9SJ77	Staphylococcus_phage	2.4e-31	28.0

DBSCAN-SWA_6

1124641 : 1173747

Indivirus(12.5%)

protease,transposase,holin,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060628046.1\|1124641_1126132_-\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	1.3e-89	39.6
WP_060628049.1\|1126269_1126887_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_060628052.1\|1126886_1127369_-\|tRNA	aminoacyl-tRNA deacylase	NA	NA	NA	NA
WP_060628054.1\|1127368_1128211_-	DUF368 domain-containing protein	NA	NA	NA	NA
WP_060628056.1\|1128305_1129106_-	glycoside hydrolase family 25 protein	B6D7J9	Listeria_phage	6.0e-14	26.3
WP_060628057.1\|1129260_1130640_+	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A0G2Y8M0	Acanthamoeba_polyphaga_mimivirus	4.1e-34	33.7
WP_060628060.1\|1130649_1131195_+	NUDIX hydrolase	NA	NA	NA	NA
WP_060628063.1\|1131206_1131518_+	hypothetical protein	NA	NA	NA	NA
WP_060628066.1\|1131534_1132227_+	5'-methylthioadenosine/adenosylhomocysteine nucleosidase	NA	NA	NA	NA
WP_000021242.1\|1132303_1132795_+	chromosome segregation protein RocS	NA	NA	NA	NA
WP_060628069.1\|1133047_1133638_+	3'-5' exonuclease	NA	NA	NA	NA
WP_060628072.1\|1133646_1135410_+	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
WP_060628076.1\|1135482_1135782_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_060628078.1\|1136004_1137051_-	hypothetical protein	NA	NA	NA	NA
WP_049547095.1\|1137055_1137520_-	hypothetical protein	NA	NA	NA	NA
WP_060628081.1\|1137553_1138408_-	N-acetylmuramoyl-L-alanine amidase family protein	NA	NA	NA	NA
WP_060628084.1\|1138609_1139197_-	recombinase family protein	B8Q5B2	Abalone_shriveling_syndrome-associated_virus	4.0e-15	29.7
WP_001808393.1\|1140443_1140728_-	type B 50S ribosomal protein L31	NA	NA	NA	NA
WP_060628090.1\|1140781_1141717_-	bifunctional oligoribonuclease/PAP phosphatase NrnA	NA	NA	NA	NA
WP_001162125.1\|1141820_1142264_+	flavodoxin	A7KUZ7	Bacillus_phage	4.6e-08	29.9
WP_020902342.1\|1142378_1142645_+	chorismate mutase	NA	NA	NA	NA
WP_060628091.1\|1142641_1143016_+	fluoride efflux transporter CrcB	NA	NA	NA	NA
WP_060628094.1\|1143009_1143339_+	fluoride efflux transporter CrcB	A0A2H4PQR0	Staphylococcus_phage	5.3e-09	37.8
WP_001068669.1\|1143457_1143805_+	50S ribosomal protein L19	NA	NA	NA	NA
WP_060628097.1\|1144607_1145474_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_060628099.1\|1145707_1146265_+	CYTH domain-containing protein	NA	NA	NA	NA
WP_000023507.1\|1146982_1147789_-	sugar-phosphatase	NA	NA	NA	NA
WP_060628102.1\|1147801_1149106_-	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	6.8e-31	35.1
WP_080983350.1\|1149177_1149555_+	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_000402062.1\|1149645_1149978_+	putative DNA-binding protein	NA	NA	NA	NA
WP_060628105.1\|1149980_1150196_+	hypothetical protein	NA	NA	NA	NA
WP_060628108.1\|1150213_1151785_+	signal recognition particle protein	NA	NA	NA	NA
WP_060628761.1\|1151880_1153164_-	uracil permease	Q9KX94	Enterobacteria_phage	5.2e-60	35.5
WP_060628111.1\|1153368_1154082_-	16S rRNA (guanine(527)-N(7))-methyltransferase RsmG	NA	NA	NA	NA
WP_060628116.1\|1154175_1154736_+	LemA family protein	A0A1X9IGG1	Lactococcus_phage	2.0e-11	32.5
WP_060628119.1\|1154737_1155637_+\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA
WP_033686116.1\|1155868_1156333_+\|transposase	IS200/IS605 family transposase	W0UUZ0	Sulfolobus_monocaudavirus	2.3e-18	40.5
WP_060628122.1\|1156544_1158104_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2I4R674	Erysipelothrix_phage	3.2e-27	24.0
WP_060628125.1\|1158554_1159097_+	DUF177 domain-containing protein	NA	NA	NA	NA
WP_050261485.1\|1159096_1159726_+	endonuclease III	NA	NA	NA	NA
WP_000644747.1\|1159936_1160458_+	bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR	NA	NA	NA	NA
WP_060628127.1\|1160476_1161400_+	aspartate carbamoyltransferase catalytic subunit	M1HGA5	Paramecium_bursaria_Chlorella_virus	6.7e-25	32.0
WP_000166853.1\|1161449_1162529_+	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	6.3e-59	35.9
WP_060628132.1\|1162865_1166042_+	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
WP_045611831.1\|1166111_1166921_-\|holin	phosphorylcholine transferase LicD	A0A1V0SD50	Indivirus	3.5e-09	31.7
WP_060628135.1\|1166922_1167726_-\|holin	phosphorylcholine transferase LicD	A0A1V0SD50	Indivirus	4.0e-10	34.1
WP_060628138.1\|1167735_1169223_-	type IV teichoic acid flippase TacF	NA	NA	NA	NA
WP_060628142.1\|1169557_1170265_+	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	NA	NA	NA	NA
WP_060628145.1\|1170269_1171292_+	alcohol dehydrogenase catalytic domain-containing protein	NA	NA	NA	NA
WP_060628148.1\|1171308_1172178_+\|holin	choline kinase LicA	NA	NA	NA	NA
WP_000791828.1\|1172167_1173046_+	DMT family transporter	NA	NA	NA	NA
WP_020902399.1\|1173057_1173747_+\|holin	CTP--phosphocholine cytidylyltransferase	G3MA50	Bacillus_virus	9.5e-08	46.1

DBSCAN-SWA_7

1234742 : 1243099

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060628224.1\|1234742_1235918_+	A/G-specific adenine glycosylase	G3CB03	Aeropyrum_pernix_spindle-shaped_virus	5.2e-22	30.2
WP_049539286.1\|1235973_1236681_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.8e-39	39.2
WP_060628226.1\|1236673_1238023_+	cell wall metabolism sensor histidine kinase VicK	W8CYF6	Bacillus_phage	4.0e-34	33.7
WP_060628228.1\|1238024_1238834_+	MBL fold metallo-hydrolase	A0A2H4J3R0	uncultured_Caudovirales_phage	3.1e-34	35.9
WP_060628229.1\|1238867_1239215_-	bacterocin transport accessory protein	NA	NA	NA	NA
WP_060628231.1\|1239325_1241044_-	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	6.1e-274	83.9
WP_060628233.1\|1241197_1243099_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	6.6e-51	29.7

DBSCAN-SWA_8

1474071 : 1484361

Streptococcus_phage(70.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060628481.1\|1474071_1474950_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	6.0e-116	76.1
WP_000358228.1\|1474952_1475270_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.9e-28	60.0
WP_060628482.1\|1475309_1476200_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	7.5e-74	52.0
WP_060628483.1\|1476196_1476835_-	dTMP kinase	M1PSC7	Streptococcus_phage	1.8e-74	66.7
WP_045611449.1\|1476948_1477746_-	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	6.1e-59	50.9
WP_060628484.1\|1477749_1479012_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	3.5e-141	65.0
WP_080998522.1\|1479021_1480152_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.2e-116	59.2
WP_060628486.1\|1480231_1482115_-\|holin	phosphorylcholine esterase CbpE	I2E8W4	Clostridium_phage	5.8e-15	25.2
WP_060628487.1\|1482117_1483005_-	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	1.7e-09	28.6
WP_000745688.1\|1482994_1483456_-	signal peptidase II	NA	NA	NA	NA
WP_001025692.1\|1483452_1484361_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	4.0e-06	27.0

DBSCAN-SWA_9

1815035 : 1823557

Streptomyces_phage(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001029581.1\|1815035_1815350_+	thioredoxin	A0A1J0GW78	Streptomyces_phage	8.6e-17	47.2
WP_060628679.1\|1815551_1816205_+	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	1.2e-60	54.7
WP_000464573.1\|1816204_1816648_+	6-carboxytetrahydropterin synthase QueD	J9PV91	Bacillus_phage	6.9e-44	62.2
WP_060628680.1\|1816640_1817357_+	7-carboxy-7-deazaguanine synthase QueE	A0A1U9WRB6	Streptococcus_virus	2.8e-63	47.3
WP_000082587.1\|1817375_1817867_+	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	E7DN65	Pneumococcus_phage	7.6e-44	60.2
WP_060628681.1\|1818122_1818791_-	aquaporin	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.3e-05	26.1
WP_000048147.1\|1819046_1819811_+	(S)-acetoin forming diacetyl reductase	NA	NA	NA	NA
WP_060628682.1\|1819918_1820710_-	DUF2785 domain-containing protein	NA	NA	NA	NA
WP_000182730.1\|1820721_1821054_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_060628683.1\|1821203_1821593_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_060628684.1\|1821760_1823557_-	oligoendopeptidase F	A0A1X9I5X5	Streptococcus_phage	4.4e-105	37.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP012646

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection