CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP012875	Weissella cibaria strain CH2 plasmid pMKC02, complete sequence	0 crisprs	NA	0
NZ_CP012878	Weissella cibaria strain CH2 plasmid pMKC05, complete sequence	0 crisprs	NA	0
NZ_CP012876	Weissella cibaria strain CH2 plasmid pMKC03, complete sequence	0 crisprs	NA	0
NZ_CP012873	Weissella cibaria strain CH2 chromosome, complete genome	1 crisprs	cas3,DEDDh,csa3,DinG,cas14j,csa5gr11	5
NZ_CP012874	Weissella cibaria strain CH2 plasmid pMKC01, complete sequence	0 crisprs	NA	0
NZ_CP012877	Weissella cibaria strain CH2 plasmid pMKC04, complete sequence	0 crisprs	NA	0
NZ_CP012880	Weissella cibaria strain CH2 plasmid pMKC07, complete sequence	0 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP012873_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012873_1

250523-250630

Orphan

Consensus_repeat	Method
CGCTTGCGCATCTGAAACTGCCGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP012873_1

>merge|NZ_CP012873|1|250523-250630|CRISPRCasFinder
CGCTTGCGCATCTGAAACTGCCGTCACCGTTGAAAAGCCACTTGAATCCACGGCCTTCGCTGCTGTTTCAGCATTATCACGGGCCGTTTGCGCATCTGAAACTGCCGT

>NZ_CP012873|1|1|250523-250630|CRISPRCasFinder
CGCTTGCGCATCTGAAACTGCCGT	CACCGTTGAAAAGCCACTTGAATCCACGGCCTTCGCTGCTGTTTCAGCATTATCACGGGC
CGTTTGCGCATCTGAAACTGCCGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012873.1\|WP_060653705.1\|257328_260058_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236140
NZ_CP012873.1\|WP_060653710.1\|262907_263777_-\|NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224995
NZ_CP012873.1\|WP_043708082.1\|232243_232960_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012873.1\|WP_167715786.1\|240006_240435_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012873.1\|WP_060653707.1\|260213_261083_-\|WxL-domain-containing-protein	unknown	unknown	unknown
NZ_CP012873.1\|WP_052497153.1\|230212_230698_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|178209
NZ_CP012873.1\|WP_043708078.1\|229482_230145_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP012873.1\|WP_060653712.1\|264802_266296_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|368260
NZ_CP012873.1\|WP_060653687.1\|233887_235252_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341046
NZ_CP012873.1\|WP_060653694.1\|237337_238726_-\|Nramp-family-divalent-metal-transporter	unknown	unknown	gnl\|CDD\|234815
NZ_CP012873.1\|WP_060653703.1\|255564_257178_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340855
NZ_CP012873.1\|WP_010375198.1\|263882_264659_-\|glucose-1-dehydrogenase	unknown	unknown	gnl\|CDD\|131468
NZ_CP012873.1\|WP_060653708.1\|261315_262374_-\|DUF3324-domain-containing-protein	unknown	unknown	gnl\|CDD\|371730
NZ_CP012873.1\|WP_060653689.1\|235248_236202_-\|Dyp-type-peroxidase	unknown	unknown	gnl\|CDD\|367887
NZ_CP012873.1\|WP_060653699.1\|253357_253969_-\|stage-II-sporulation-protein-M	unknown	unknown	gnl\|CDD\|376676
NZ_CP012873.1\|WP_043708086.1\|236522_236777_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|153123
NZ_CP012873.1\|WP_060653682.1\|230826_231831_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|369561
NZ_CP012873.1\|WP_043708087.1\|236860_237319_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
NZ_CP012873.1\|WP_043708098.1\|262507_262750_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012873.1\|WP_060653701.1\|254050_255565_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340855

Protein	Function_ID	Function_description	E-value
NZ_CP012873.1\|WP_060653705.1\|257328_260058_-\|hypothetical-protein	gnl\|CDD\|236140	PRK08026, PRK08026, FliC/FljB family flagellin.	0.000703089
NZ_CP012873.1\|WP_060653710.1\|262907_263777_-\|NAD(P)-dependent-oxidoreductase	gnl\|CDD\|224995	COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism].	1.66745e-99
NZ_CP012873.1\|WP_010375198.1\|263882_264659_-\|glucose-1-dehydrogenase	gnl\|CDD\|131468	TIGR02415, Diacetyl_reductase, acetoin reductases. One member of this family, as characterized in Klebsiella terrigena, is described as able to interconvert acetoin + NADH with meso-2,3-butanediol + NAD(+). It is also called capable of irreversible reduction of diacetyl with NADH to acetoin. Blomqvist, et al. decline to specify either EC 1.1.1.4 which is (R,R)-butanediol dehydrogenase, or EC 1.1.1.5, which is acetoin dehydrogenase without a specified stereochemistry, for this enzyme. This enzyme is a homotetramer in the family of short chain dehydrogenases (pfam00106). Another member of this family, from Corynebacterium glutamicum, is called L-2,3-butanediol dehydrogenase (). [Energy metabolism, Fermentation].	2.11707e-85
NZ_CP012873.1\|WP_052497153.1\|230212_230698_-\|hypothetical-protein	gnl\|CDD\|178209	PLN02599, PLN02599, dihydroorotase.	0.0068255
NZ_CP012873.1\|WP_043708078.1\|229482_230145_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	5.64352e-06
NZ_CP012873.1\|WP_060653712.1\|264802_266296_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|368260	pfam05043, Mga, Mga helix-turn-helix domain. M regulator protein trans-acting positive regulator (Mga) is a DNA-binding protein that activates the expression of several important virulence genes in group A streptococcus in response to changing environmental conditions. This domain is found in the centre of the Mga proteins. This family also contains a number of bacterial RofA transcriptional regulators that seem to be largely restricted to streptococci. These proteins have been shown to regulate the expression of important bacterial adhesins. This is presumably a DNA-binding domain.	2.71108e-06
NZ_CP012873.1\|WP_060653687.1\|233887_235252_-\|MFS-transporter	gnl\|CDD\|341046	cd17503, MFS_LmrB_MDR_like, Bacillus subtilis lincomycin resistance protein (LmrB) and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of multidrug resistance (MDR) transporters including Bacillus subtilis lincomycin resistance protein LmrB, and several proteins from Escherichia coli such as the putative MDR transporters EmrB, MdtD, and YieQ. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. For example, MMR confers resistance to the epoxide antibiotic methylenomycin. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.85054e-54
NZ_CP012873.1\|WP_060653694.1\|237337_238726_-\|Nramp-family-divalent-metal-transporter	gnl\|CDD\|234815	PRK00701, PRK00701, divalent metal cation transporter MntH.	0
NZ_CP012873.1\|WP_060653703.1\|255564_257178_-\|glycosyltransferase	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	1.52674e-96
NZ_CP012873.1\|WP_060653708.1\|261315_262374_-\|DUF3324-domain-containing-protein	gnl\|CDD\|371730	pfam11797, DUF3324, Protein of unknown function C-terminal (DUF3324). This family consists of several hypothetical bacterial proteins of unknown function.	1.08553e-20
NZ_CP012873.1\|WP_060653689.1\|235248_236202_-\|Dyp-type-peroxidase	gnl\|CDD\|367887	pfam04261, Dyp_perox, Dyp-type peroxidase family. This family of dye-decolourising peroxidases lack a typical heme-binding region.	1.08402e-70
NZ_CP012873.1\|WP_060653699.1\|253357_253969_-\|stage-II-sporulation-protein-M	gnl\|CDD\|376676	pfam01944, SpoIIM, Stage II sporulation protein M. SpoIIM is on e of four stage II sporulation proteins that is necessary for the forespore inside the mother-cell to be properly internalized through the breakdown of peptidoglycans trapped between the membranes of the septum separating the forespore and the mother-cell. The four proteins working in sequence are SpoIIB, pfam05036, SpoIIM, SpoIIP, pfam07454, and finally SpoIID, pfam08486. D, M and P are in a complex with each other and the complex assembles in a hierarchical manner such that M, which serves as a membrane anchor, recruits P to the septum and P, in turn, recruits D to the septum.	0.00015168
NZ_CP012873.1\|WP_043708086.1\|236522_236777_-\|hypothetical-protein	gnl\|CDD\|153123	cd02432, Nodulin-21_like_1, Nodulin-21 and CCC1-related protein family. Nodulin-21_like_1: This is a family of proteins closely related to nodulin-21, a plant nodule-specific protein that may be involved in symbiotic nitrogen fixation. This family is also related to CCC1, a yeast vacuole transmembrane protein that functions as an iron and manganese transporter. .	1.41793e-11
NZ_CP012873.1\|WP_060653682.1\|230826_231831_-\|alpha/beta-hydrolase	gnl\|CDD\|369561	pfam07859, Abhydrolase_3, alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.	6.73834e-46
NZ_CP012873.1\|WP_043708087.1\|236860_237319_-\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	2.80476e-15
NZ_CP012873.1\|WP_060653701.1\|254050_255565_-\|glycosyltransferase	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	1.57129e-61

>NZ_CP012873.1|WP_167715786.1|240006_240435_-|hypothetical-protein
MLAYTVPQTVAVPGPVVTVTETGAPEYRWAGMPVASIDQATPVVGQTIGERTLAGAAAYRALDNKGARIQDRRVALSDINQTQQQDSHASLLRHGWRMPYYLSGRFMNDWHLNAANVATLLFFGTFLGWFFLPAKKKENEEE
>NZ_CP012873.1|WP_060653694.1|237337_238726_-|Nramp-family-divalent-metal-transporter
MENMTNGKHGLIQNAADDASLAEVNGTIVPPKNGSFWRKLWAFSGPGALVAVGYMDPGNWVTSVTGGATYHYLLLSIVLISSLIAMMLQYMAGKMGMVTGEDLAQATRNRTSKGGGIALWIITELALMATDIAEVIGGAIAVHLLFGWSMIVSVLTTAFDVLLLLLLMRFGFRKIEAIVITLITTILFVFLYLVILSRPDISAMFGGYLPKLQSVSTHGITGADSPLVMTLGIIGATVMPHNLYLHSSIAQTRKVNRENKEELKESVRFMAWDSNIQLSVAFVINSMLLILGAAMFFGHADSVGTFGQMYNALGDKTIAGAIASPILSTLFAVALLASGQNSTITGTLTGEIIMAGFLHLRVPMWLRRVITRGLALIPVVAFTLIYGGAEDKLDQLLVYSQVFLSVALPFAMAPLIWMTSSKKIMGKGFVISKWMTTIAWLVFLVLTALNIQLVIQIVGKLL
>NZ_CP012873.1|WP_043708087.1|236860_237319_-|universal-stress-protein
MALELSDIQTSYQHVLVGVDESEQGQVALASAVHQALEDQAKLTIATVLELGELSTTDVLSLAAVNKRREDLEKNLQTYKNFAIAQGVTNVETVLADGAKAGEVLAMELAPETKADLLIVGAHSKQGMWPSLGSQAVYIARHAKISSMIARR
>NZ_CP012873.1|WP_043708086.1|236522_236777_-|hypothetical-protein
MAKDKQTLAQRNNFIRASVMGANDGILSVSGIVIGVAGATTVAVALAGYLSALIGKGFASRTVKRNVIVGLLTIAIHYTIGLFF
>NZ_CP012873.1|WP_060653689.1|235248_236202_-|Dyp-type-peroxidase
MAEMDYTKAQDVWKDVGQSVEFVVLGLDRTRPLAELQDAITEFADRSQAINRSMNVRAADGNLKVAIGFSYTAWKTLFPNKPVPAELEEFKGLKGPKYSMPGTAGDIFIHVRANDMSIVYEVVRQYMTVLHDVTTVIDETKGFRNFEGRTIIGFIDGTEVPSASDSAEVAVIGDEDPEFVNGSYAFAQKWLHDMDFWGQLKTEVQEKAIGRHKYDDLELEDEEKFHNAHNVSAKVEIDGEERQIVRMNVPFSAPALNKTGTYFIGYSRYWSVTKAMLTQMVEMSDYLLTFSQLMSGQLYFVPSRELLGDIADGEWTE
>NZ_CP012873.1|WP_060653687.1|233887_235252_-|MFS-transporter
MSETKQLGKRERTLFVWMLLLTSFSFSISQSAMTTIYPVMANHFSVPISMVQWLTTGFMLVMTVTMPLSPWLLNRVPFKWFLAGIQAMFLLGTFIAINATGFGWVILGRVLEGAAVGFLFPSYQSVIMLITPEENRGASMGTVGLVMGAALATGPIVSGIISQWFNWQGVFVFFELVIGLLFLVNLFVGQNVIVKKDVHLDVPSLIGLFGFAMVLFGIQSLGHTTKLIGMIVMMMVGLVLSVYFVHRQGNLSQPMLDFKVFKQVGFTLGLLLTGASYIALIVMTVLMPLYYQNVLHTSKLVSGLLMVPPAAAMAVMNRRSGKLLDQKGLKVVMRIGAASIFIGYAGLALTFGLHNAVLAVIFATFGEVGNAFMMLPATTYANNQLPDNLITHGSAMISTARQFAGVIGVLVATTIVSGLGNGLHSAYIVFALGMAVMIVTVWRITAIYHGENSL
>NZ_CP012873.1|WP_043708082.1|232243_232960_-|hypothetical-protein
MFRNAKPTVLNLGILYAGGAVANVLVVMLLPLKAGLGVETFTLMNGVIAAVTLLPLNNLATDGSMLLNLVMNPEETVLHYTVSYFLTNEYTEKFDALLPQVLSILDGPLGKVQESHIIIYLSYLNYVCALKKGRLENEQKQLVNKVFNAVLSDKKMKSRYLSDYTIGEVITQRLINSEDSVNDYKGLHKLPVLLKRRIAYLLDPEDTGKKADYYREITTTAQGKATLMINGELSYLAL
>NZ_CP012873.1|WP_060653682.1|230826_231831_-|alpha/beta-hydrolase
MTTDEFTKRYRPGTTTSGYLDDRAKAEISAAGPSFDHQPTPAEIRAVMGWPAAHHEAVNELTVRAHKIAGVSVTEFVQQRYDDQVLPAVVFIHGGAFVGGSVANVAPILQQMADAGALRVFALDYSLAPEHPFPAGMLDVYRVVVALYQAAKQYGIDETQLSLAGDSAGGNLTYTVALLDQNLQSNYLHKLVAMYPAVYNGHDAEKEIDFSDIRAYGAQADQALIAQYIASFRESSLISDWYLRGVDDEQMAVSPINAPAAMLTELPASLLIIGEFDPLRLEGEAFFERVRDAGGTIAYIRYDGMVHAFVDKIGDYPQANQAVLDLVDFVLAES
>NZ_CP012873.1|WP_052497153.1|230212_230698_-|hypothetical-protein
MAKRPETIALENWLFARLNPRGKGRVSAYGATEVTLSTDASANKLGKGRKKAGYQGRVDFISIDTQRTVRAYEIKVSIQDFRTQAMKSWVGHYNYLVTTDELADKYRDEILAALPDGVGWLTPTQTVRRPKRHALQIDETWLVWLMMRRNAMVVRDSRLQD
>NZ_CP012873.1|WP_043708078.1|229482_230145_-|TetR/AcrR-family-transcriptional-regulator
MGRQRNEETIKQIRRAVWQLFLAKGYGKTSFSDVAQTAQLNRSIVQYYFAKKEDFSNMLMAQVSDQVLVIVDQQFPDASRLERYYLASQLYFAVFWHPELRHLLKEILENRKLADESMYNQVIWSVNILTDAVDEAKFEAAYIDVVDAWGGFAEVMYYSLQHDRQVDLARGLKRLVPLIAMIAGYEADVCDKVIATHTLTPEQRDELRDRILQQVNQENK
>NZ_CP012873.1|WP_060653699.1|253357_253969_-|stage-II-sporulation-protein-M
MTKIGTIWRETFRRYWRTMVIFAIINVVIWFVVLALVKFNAFGLHDLALKSIKANFVNDASSHKINHSGVFGGFVQLTWHNYLGGLATVAISLIPIPFWWVTAVMNPASIGYLLGLSPIPVTTFFAGIFPHSIVEMPMQWLEFSIAWETFRLIWRNIRTKQGWWHGVDWRRIITILIVVVLPMAIVAGAIESFITPALLNMAK
>NZ_CP012873.1|WP_060653701.1|254050_255565_-|glycosyltransferase
MNYFVSENVFTFNSGTEHAQAKRVQLFTEQGQSAQYVTRNYNRFLARDAEAIGLHAEQVLNMYDFFQGVTDVPREEVSLRLLPQIPLDEYHIEGHGPNYSTINHAGRELARINVMPATVGLVNDIVYYDRYGNTTARENFDWRGFKSSVDYFHPDGNLAVQKMLNLAGETVIEISHMKVNGTLYPTMWKLLNYKGHDWRFNTEDQLFLFFLNEITAEHPGSTLVSDRRSLDHVVADVQFATKKFAVLHDIHTLDIKNPIRGKLYDAYLNVLERRVRDFDAILVPTPEQQADLQKRYPGVDFRVVPDTFVPQAQLAAPRLRLPDRQAGNILFMGRLSPEKRPDQAIRALARVVKSVPSATLTFHGYPANAEILNELKALANQLGVTNSVIFGDYITGDALAAAYQRAQVIVQTSVAEGFGMNLVEAMSYGVPVVSYDITYGTREMIHDGVNGYVVANGAHGEMADRIVSILSDDGVWADLSAAAYDKAVTFNGQAMMAAWQQALQ
>NZ_CP012873.1|WP_060653703.1|255564_257178_-|glycosyltransferase
MNFFVNAMMPKQKSGIEHAQLKRFELFNNHQVDSRIVLRDWDPVAHVNANAAGIPDNQLINMFDYFQEAVAVTPKTLHAQEIEFGVPNVQFADEPANNRYLVTAQNGQLVARVNYDATADKRVRSTELFDGYNNLFRVDHYDSRGFASLIQWYTTDNQIGTETWVTPSGRTVIETFNKKTMAGEFVKSGWRLIEHGGHVMQFDTIEELTKHFFDRLNDDFWSEDQPNVFVLDRSHLGDWGLLRLRKPAYVVMHLHNSHAGDAQDPMHAILNNHYEFAMNALDEYDAVVSATHKQTHDVNERFQPKTRLFTIPVGVVPDRLLQSERVPVARREFGKVIAFARIAWEKHLDDLVRAVGIVHKEFPQVTLDLYGYADPADNYKARTSVEEAIREYGLKGVVTMKGYTTEIDVVENNAMMYGLTSRMEGFNLAIMEAISHGLIAFSYDVNYGPNEIVEDDVNGNVVPYEDYEAMAQAMLKVLRDPDLAQRYSTGAYESSERYSEENVWHAWRELLDDAAAVWPAKLAAMPAHAHDLNKEAE
>NZ_CP012873.1|WP_060653705.1|257328_260058_-|hypothetical-protein
MKNTRRLQAKVQHMALASIIIAGIVAPVTQLTTVFPGMSLQDVKAATTGTPDAETKAGVSYVNQRDNGAGDLGPALPTQLAGASGSVDGSWGLTPAATSMYAKGDFLLRYASINKSGDNQLFNGGQAKNTDTSVTPPDIMQNSVTDQSATYMAASPAIYPTNSSYYNQAVAVLVGTKGSWGTSGTPTKISDDKKVYRFKGPQYAYLHNPADTTGTQFTSIKGLFNTSYGPYVTVTFADGTQADASASSSKYSVSAFRYYYLDANTGAVMVQTGTLSGSKVIWSAGHIASSDADFTNNAGSPVASIKINGTTVQSPTSYKSIGWQMVVTGQVKMPNNGDTTAAAGEYRMFASGGVNNAGATVGGASAVVLPLSYSYDGGNAVNAAYDGKSAYRQTYQEAGFNILAETKKDLGTITHDESYTDANGKSVTTGSYTGSQLVQLDKFTNTQSSDTTGTYTIDTGSSSVGFASDAIVLQNKNGDDVSAAVNMSGVTYKDATGATVTDSSKAKTATFTATLPAGASFTVKSKLVANAGQPAGVTSTTTMAGKDANGDAVNLAGTFNWVPVTTVSGNITYVDATGATVATGKYADKQPGASTSDITAPITTDGYRYKFVSADKATYDGSDIKVTVAKIATGNINYVYNGKAVSSTPFTDQDSGKTIANIAAPAGTVDGLRYKLADATKSYAYPDKDGDVNVDLAAIVSGTIEFVDADNNNALVKQQAFTDQTPGEQISPLTLPDGYVLAVDANGDVQSTYNYPTTDAQVVTVKVQKLTTGNRNDGMELTEVPSFSSDNNTIGASDTTTLTATKDGVLSYLNLKGQKADIYMSATDLKSNGSALPIKTLKANLSAGLADVYAANQTDGYGHMIVNDTTSKKGSLTIPDLQMTLSNNNFAAGTYSGTINYTMVSDDLN
>NZ_CP012873.1|WP_060653707.1|260213_261083_-|WxL-domain-containing-protein
MMKQFLMSVVVLGAATALIAPAVSADTTAADQVNVANNQGDTTVTYVGDKTTDQTVVDPNPSDKGSTPEDGKNTTDNNGKQVKGLSLTAVPSFNFGQANKLAATTVATAKGATDLTNATAGMKEAAAAAENSGKSSIFVNDTRGGNTGFKVFAAGSSLYDAAGNQLNVSALHLTVNDGVANGNQGVITGSKGVDVYHATNLTTNTSAAGTDTAQDTKDVLSGGTQANDMFGKVAGYGNLIATGNDKSTGDTATGAVSADLTLKTANALDGQAYNGKITYTLQDATLTAN
>NZ_CP012873.1|WP_060653708.1|261315_262374_-|DUF3324-domain-containing-protein
MIGRKLWSSLAIATAALGALGVAKPAAAADYSNSNPEMGVMLSSIEDDTDTNNSTWELNTKPGKVLHGAVSVQNTSNESAKYTVSFEQARTNSQMNIMYSNGGTNKSVDPNMKLSKIAKVDGKDSATITVPANSTTALPVTLTMPAKEFDGYILGSVVVTKQVPKGYKVKDGFTNQFMYTKTVQITESIVNPTAVLTNTKKGGVKVVAGQQELQLRVKNNEPSYIGNMKMSAKITYKKTGDVVLTDKQTGRSVAPNSSFTYRLPSERVMRAGKYHYVVTMTNEKTKKSWTFSNDFVVSQASATSVGIGRSIAFIPTWIWQLLALFLVLIGFLFFLLWKRRKDEDDEDEANAK
>NZ_CP012873.1|WP_043708098.1|262507_262750_-|hypothetical-protein
MTIGRIYSDLKAMFELLAWITFIFVLFVLSSRYLYGMDYSVFLPLVVMLYAGVWVGLSVALVLTWIFSAGTAKQATQTTK
>NZ_CP012873.1|WP_060653710.1|262907_263777_-|NAD(P)-dependent-oxidoreductase
MKIGFIGTGVMGRGIINNLLQANYEVVVFNRTKAHAQSVLDNGATWADSPKEIAEAADLVITMVGYPKDVEEQYYGDNGLFAGSHAGQIFVDMTTSTPTLAEQLAVDGEKFDVKVLDAPVSGGDVGAKNGTLTIMAGGDEAAYDSLQPIFNMISKAANRFGVAGRGQHTKMANQIMIAATMLGMSEMMVYAKAADLDVAKVMATLSAGGAQNWSLDNYGPRVLAGDFEPGFYAKHLLKDLRIALDEAAKMNLSLPATDLAEALYTKLAEQKGLGDEGTQALVKLWAQFA
>NZ_CP012873.1|WP_010375198.1|263882_264659_-|glucose-1-dehydrogenase
MAEKVAIVTGGGQGIGEGIALRLAQDGYAVIVNGRTQTKLDNVVNKIVAAGGEATTFAGDVQQKSVNEEMVQLALTKYGRLDVFVANAGIDWVDTIEETPEEQVDNVFNINLKSQVWALQTAPAAMRKNGKQGGSIVLASSIAGMEGFEMLGIYSATKFATRGLVQAAAKELATDNIRVNAYNPGIVLTPMWDQIDARFAERKNVAIGETRQAFIDGILLGRGEEPDDIAKYVSFLVSDQADYITGQSLAVDGGVKFQ
>NZ_CP012873.1|WP_060653712.1|264802_266296_-|helix-turn-helix-domain-containing-protein
MHDKQDRNKLKLFRYMRTRGEAPVLQVMEDLDMSRYIVLSTTQQLAIDIEMITGMTDGILIEGGSDVRFSVPATVLDWESLGLHYLMTSIRGRMVHELFHEQVTSWEEFAFDVDVSVPKMYKERAQVAEDLAREGIRISRDYKLVGNEEHIRLFKFEMLTYYNGRRDSPFPLDVQEQAREVVNEIIVPECGTLRETQLVGLRHLYAIWWSRFRQRHFVSTGFTNRFLKPTAELSDRSRRLIHLLMERMSDTPDLPVETAASEARFIILTMHTLGLFPPEQMMTDVTDSVIQYWHYFERALKESYYCLFMLRADQVDIRSVTRVLEPEILRFFVFPYVGEEDYEYMTNVADIAPEYPLAYEFSKDVMRHFSEFTGVPARDLDNFMLPDLIATVMGYPNFYRAIPAVNITIDFGGHHGIEEVMAMSLNGLPGYKIQINHVLSEYTDILVTDAPQPKDEPYTALIWRGIGTPGQMTELLQEINRVKMKKFNARRDNNKHK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

7664 : 16543

Staphylococcus_phage(42.86%)

protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_043708935.1\|7664_8129_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.2e-27	46.0
WP_043708933.1\|8144_9338_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	5.9e-90	46.3
WP_043708931.1\|9343_9931_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	2.7e-27	43.2
WP_043710717.1\|9930_10956_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	1.8e-31	30.3
WP_010371280.1\|11417_11741_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_010371283.1\|11740_12067_-	multidrug resistance protein SMR	NA	NA	NA	NA
WP_153280279.1\|12165_12318_-	hypothetical protein	NA	NA	NA	NA
WP_043708927.1\|12324_12921_-	thymidine kinase	A0A249XZX5	Enterococcus_phage	3.6e-40	48.1
WP_060653499.1\|13179_13611_-	DUF1810 family protein	A0A2H4UVK5	Bodo_saltans_virus	4.5e-16	41.2
WP_043710719.1\|13666_14428_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_043708921.1\|14643_15492_-	DegV family protein	NA	NA	NA	NA
WP_060653501.1\|15700_16543_-	aldo/keto reductase	A0A1V0SDE7	Indivirus	2.6e-23	30.3

DBSCAN-SWA_2

1197107 : 1205749

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_043711455.1\|1197107_1197596_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	1.7e-19	41.0
WP_060654447.1\|1197588_1198707_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_060654449.1\|1198688_1199429_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3HWF9	Synechococcus_phage	2.2e-31	35.5
WP_043708231.1\|1199431_1199689_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_043708230.1\|1199690_1200374_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_043708228.1\|1200370_1202593_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.7e-138	40.9
WP_060654451.1\|1202577_1204113_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.4e-48	33.5
WP_043708226.1\|1204124_1205165_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F0L1	Synechococcus_phage	4.8e-56	41.2
WP_060654454.1\|1205155_1205749_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	8.4e-21	35.1

DBSCAN-SWA_3

1296468 : 1361531

Lactobacillus_phage(41.67%)

terminase,integrase,protease,tRNA,capsid,portal,head,lysis,tail

attL 1296393:1296412|attR 1337830:1337849

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1296393:1296412	attL	NA	NA	NA	NA
WP_060654526.1\|1296468_1297536_-\|integrase	site-specific integrase	A0A0P0IXL3	Lactobacillus_phage	1.4e-34	31.9
WP_167715826.1\|1297694_1298741_-	Abi family protein	A0A0N7IRA5	Lactobacillus_phage	4.2e-23	27.4
WP_060654530.1\|1298917_1299319_-	hypothetical protein	NA	NA	NA	NA
WP_003610500.1\|1299435_1299708_-	hypothetical protein	NA	NA	NA	NA
WP_060654532.1\|1299873_1300377_-	Ltp family lipoprotein	A0A0A1ERB0	Lactobacillus_phage	5.6e-10	69.6
WP_060654534.1\|1300447_1300846_-	hypothetical protein	NA	NA	NA	NA
WP_060654536.1\|1300849_1301197_-	XRE family transcriptional regulator	A0A141E1M3	Streptococcus_phage	2.5e-09	36.2
WP_145558329.1\|1301457_1301661_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_081276017.1\|1301673_1302381_+	ORF6C domain-containing protein	A0A097BYE0	Leuconostoc_phage	7.4e-40	42.2
WP_060654541.1\|1302383_1302671_+	hypothetical protein	NA	NA	NA	NA
WP_060654542.1\|1302667_1302865_+	hypothetical protein	NA	NA	NA	NA
WP_060654544.1\|1302861_1303050_+	hypothetical protein	NA	NA	NA	NA
WP_060654546.1\|1303046_1303265_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_167715828.1\|1303330_1303477_+	hypothetical protein	NA	NA	NA	NA
WP_060654548.1\|1303558_1304485_+	DUF1351 domain-containing protein	NA	NA	NA	NA
WP_060654551.1\|1304495_1305341_+	hypothetical protein	NA	NA	NA	NA
WP_060654554.1\|1305354_1306053_+	hypothetical protein	D7RWH3	Brochothrix_phage	4.9e-36	37.9
WP_081276018.1\|1306027_1306408_+	DNA replication protein	A0A0S2MYA8	Enterococcus_phage	2.3e-40	68.1
WP_060654556.1\|1306534_1307059_+	hypothetical protein	NA	NA	NA	NA
WP_060654559.1\|1307073_1307583_+	hypothetical protein	NA	NA	NA	NA
WP_167715831.1\|1307632_1307800_+	hypothetical protein	NA	NA	NA	NA
WP_167715834.1\|1307927_1308101_+	hypothetical protein	NA	NA	NA	NA
WP_060654561.1\|1308100_1308295_+	hypothetical protein	NA	NA	NA	NA
WP_060654562.1\|1308287_1308476_+	hypothetical protein	NA	NA	NA	NA
WP_060654563.1\|1308559_1308973_+	ArpU family transcriptional regulator	NA	NA	NA	NA
WP_065214038.1\|1309427_1309847_+	hypothetical protein	NA	NA	NA	NA
WP_060654564.1\|1309951_1310644_+	DUF3800 domain-containing protein	NA	NA	NA	NA
WP_060654565.1\|1311075_1311780_+	hypothetical protein	NA	NA	NA	NA
WP_060654566.1\|1312418_1312742_+	hypothetical protein	U5U409	Lactobacillus_phage	2.4e-06	43.5
WP_060654567.1\|1312769_1313309_+	HNH endonuclease	Q8LTL4	Lactococcus_phage	1.8e-38	46.3
WP_060654568.1\|1313493_1313976_+\|terminase	phage terminase small subunit P27 family	Q9AZT2	Lactococcus_phage	8.3e-35	48.1
WP_060654569.1\|1313965_1315846_+\|terminase	terminase large subunit	Q94MB3	Lactococcus_phage	7.0e-247	64.5
WP_043941329.1\|1315835_1316048_+	DUF1056 family protein	NA	NA	NA	NA
WP_150116736.1\|1316087_1317218_+\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	1.0e-120	57.1
WP_060654572.1\|1317204_1317906_+\|protease	Clp protease ClpP	Q9AZS8	Lactococcus_phage	6.3e-60	54.2
WP_060654574.1\|1317925_1319149_+\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	5.9e-138	63.6
WP_043941474.1\|1319165_1319483_+\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	5.1e-17	46.0
WP_060654576.1\|1319469_1319808_+\|head	phage head closure protein	NA	NA	NA	NA
WP_060654577.1\|1319810_1320236_+	HK97 gp10 family phage protein	A8YQJ5	Lactobacillus_phage	5.4e-22	45.9
WP_060654580.1\|1320232_1320604_+	DUF806 family protein	NA	NA	NA	NA
WP_060655590.1\|1320628_1321246_+\|tail	phage tail protein	Q9AZS2	Lactococcus_phage	3.1e-42	49.7
WP_060654582.1\|1321350_1321734_+	hypothetical protein	NA	NA	NA	NA
WP_167715837.1\|1321769_1321922_+	hypothetical protein	NA	NA	NA	NA
WP_060654584.1\|1321947_1326378_+	hypothetical protein	Q9AZL4	Lactococcus_phage	6.6e-94	51.8
WP_060654586.1\|1326382_1326769_+	hypothetical protein	NA	NA	NA	NA
WP_060654588.1\|1326829_1329331_+\|tail	phage tail family protein	NA	NA	NA	NA
WP_060654590.1\|1329343_1334356_+\|tail	phage tail protein	A0A1I9KKS3	Lactobacillus_phage	8.3e-45	32.9
WP_060654592.1\|1334365_1334767_+	hypothetical protein	NA	NA	NA	NA
WP_060654594.1\|1334939_1335518_+	hypothetical protein	NA	NA	NA	NA
WP_060654596.1\|1335569_1335821_+	hypothetical protein	NA	NA	NA	NA
WP_060654598.1\|1335827_1336088_+	hypothetical protein	NA	NA	NA	NA
WP_167715841.1\|1336087_1336264_+	hypothetical protein	NA	NA	NA	NA
WP_060654600.1\|1336295_1336610_+	hypothetical protein	NA	NA	NA	NA
WP_060654602.1\|1336611_1337628_+	hypothetical protein	I6PBG3	Weissella_phage	2.2e-13	39.2
WP_060654604.1\|1338039_1338996_+	TerC family protein	K7QKE8	Escherichia_phage	1.2e-40	35.3
1337830:1337849	attR	NA	NA	NA	NA
WP_010372845.1\|1339125_1339929_+	hypothetical protein	A0A288TXV9	Enterococcus_phage	6.8e-50	51.6
WP_060654605.1\|1340100_1340769_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_043708159.1\|1340930_1341434_+	ribosome maturation factor RimM	NA	NA	NA	NA
WP_043708158.1\|1341436_1342177_+\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_010372859.1\|1342294_1342651_+	50S ribosomal protein L19	NA	NA	NA	NA
WP_010372861.1\|1342847_1344134_+	cation:dicarboxylase symporter family transporter	NA	NA	NA	NA
WP_010372864.1\|1344348_1345305_+	YitT family protein	NA	NA	NA	NA
WP_003609051.1\|1345329_1345515_+	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_060654606.1\|1345613_1347119_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_060654607.1\|1347505_1348954_+	C40 family peptidase	D2KRB9	Lactobacillus_phage	2.3e-11	33.6
WP_010372451.1\|1349007_1349652_-	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	9.0e-45	45.0
WP_010372453.1\|1349869_1350265_-	large conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
WP_043709490.1\|1350445_1351285_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_060654608.1\|1351287_1351482_+	hypothetical protein	NA	NA	NA	NA
WP_043709493.1\|1351483_1352209_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_010372463.1\|1352385_1352805_+	hypothetical protein	NA	NA	NA	NA
WP_010372466.1\|1352898_1353306_+	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_043709503.1\|1353390_1353903_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_060654609.1\|1354225_1355743_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_010372475.1\|1355890_1356622_+	WxL domain-containing protein	NA	NA	NA	NA
WP_043711515.1\|1356723_1357836_+	DUF916 and DUF3324 domain-containing protein	NA	NA	NA	NA
WP_060654610.1\|1357835_1359803_+	WxL domain-containing protein	NA	NA	NA	NA
WP_060654611.1\|1359804_1360629_+	DUF916 domain-containing protein	NA	NA	NA	NA
WP_043709516.1\|1360760_1361531_+\|lysis	5-bromo-4-chloroindolyl phosphate hydrolysis family protein	NA	NA	NA	NA

DBSCAN-SWA_4

1399465 : 1451348

Lactobacillus_phage(25.0%)

integrase,terminase,tRNA,capsid,portal,head,tail

attL 1393071:1393087|attR 1423418:1423434

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1393071:1393087	attL	NA	NA	NA	NA
WP_043709039.1\|1399465_1400776_+\|tRNA	histidine--tRNA ligase	NA	NA	NA	NA
WP_043711550.1\|1400781_1402587_+\|tRNA	aspartate--tRNA ligase	NA	NA	NA	NA
WP_060654646.1\|1402754_1403120_+	hypothetical protein	NA	NA	NA	NA
WP_167715844.1\|1403182_1403980_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_010372988.1\|1404089_1404971_+	YitT family protein	NA	NA	NA	NA
WP_003610426.1\|1405103_1405289_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_043709047.1\|1405380_1405824_+	GatB/YqeY domain-containing protein	A0A0K2FLI9	Brevibacillus_phage	6.7e-15	37.3
WP_010372981.1\|1405919_1406909_+	PhoH family protein	H6X2N1	Pseudomonas_phage	9.9e-51	48.0
WP_010372976.1\|1406914_1407397_+	rRNA maturation RNase YbeY	NA	NA	NA	NA
WP_010372974.1\|1407380_1407809_+	diacylglycerol kinase family protein	NA	NA	NA	NA
WP_010372971.1\|1407860_1408769_+	GTPase Era	NA	NA	NA	NA
WP_060654650.1\|1408817_1409612_+	DNA repair protein RecO	NA	NA	NA	NA
WP_010372965.1\|1409677_1409851_+	hypothetical protein	NA	NA	NA	NA
WP_060654652.1\|1409996_1410731_+	nicotinamide mononucleotide transporter	A0A2K9VDE7	Lactobacillus_phage	1.0e-44	42.5
WP_060654654.1\|1411025_1411952_+\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
WP_043709056.1\|1411953_1414035_+\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_060654655.1\|1414085_1414829_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_060654657.1\|1415044_1416202_-\|integrase	tyrosine-type recombinase/integrase	A0A1S5S8Y2	Streptococcus_phage	5.1e-30	27.6
WP_060654659.1\|1416390_1417008_-	outer membrane protein assembly factor BamE	NA	NA	NA	NA
WP_060654661.1\|1417059_1417467_-	hypothetical protein	D6PSS8	Lactobacillus_phage	3.1e-06	30.1
WP_060654663.1\|1417459_1417801_-	helix-turn-helix transcriptional regulator	A0A059T6G1	Listeria_phage	1.0e-10	50.8
WP_060654665.1\|1418069_1418297_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_060654668.1\|1418299_1418581_+	hypothetical protein	NA	NA	NA	NA
WP_060654670.1\|1418618_1418801_+	hypothetical protein	NA	NA	NA	NA
WP_060654672.1\|1418913_1419114_+	hypothetical protein	NA	NA	NA	NA
WP_060654674.1\|1419110_1419296_+	hypothetical protein	NA	NA	NA	NA
WP_060654676.1\|1419292_1419478_+	hypothetical protein	NA	NA	NA	NA
WP_060654678.1\|1419478_1419784_+	hypothetical protein	NA	NA	NA	NA
WP_060654680.1\|1419859_1420051_+	hypothetical protein	NA	NA	NA	NA
WP_164239487.1\|1420050_1420212_+	hypothetical protein	NA	NA	NA	NA
WP_060654682.1\|1420213_1420912_+	AAA family ATPase	E9LUU1	Lactobacillus_phage	5.9e-50	46.9
WP_060654684.1\|1420914_1421487_+	DUF669 domain-containing protein	NA	NA	NA	NA
WP_060654686.1\|1421486_1422368_+	hypothetical protein	NA	NA	NA	NA
WP_060654688.1\|1422371_1423787_+	hypothetical protein	NA	NA	NA	NA
1423418:1423434	attR	NA	NA	NA	NA
WP_060654690.1\|1424035_1424521_+	RusA family crossover junction endodeoxyribonuclease	NA	NA	NA	NA
WP_060654692.1\|1424581_1424851_+	hypothetical protein	NA	NA	NA	NA
WP_060654694.1\|1424984_1425368_+	hypothetical protein	NA	NA	NA	NA
WP_060654696.1\|1425367_1425577_+	hypothetical protein	NA	NA	NA	NA
WP_167715847.1\|1425576_1425750_+	hypothetical protein	NA	NA	NA	NA
WP_060654698.1\|1425749_1426226_+	hypothetical protein	Q8LTB0	Lactobacillus_phage	5.6e-52	61.1
WP_060654700.1\|1426225_1426426_+	hypothetical protein	NA	NA	NA	NA
WP_060654702.1\|1426573_1426759_+	hypothetical protein	NA	NA	NA	NA
WP_060654704.1\|1426848_1427262_+	ArpU family transcriptional regulator	NA	NA	NA	NA
WP_060654706.1\|1427673_1428255_+	hypothetical protein	NA	NA	NA	NA
WP_167715850.1\|1428301_1428466_+	hypothetical protein	NA	NA	NA	NA
WP_060654709.1\|1429038_1429245_+	CsbD family protein	NA	NA	NA	NA
WP_060654711.1\|1429605_1430028_+\|terminase	terminase small subunit	A0A1Q1PVS8	Bacillus_phage	3.3e-11	35.4
WP_081276024.1\|1430020_1431301_+\|terminase	PBSX family phage terminase large subunit	Q4ZE37	Staphylococcus_virus	1.0e-140	57.6
WP_060654715.1\|1431309_1432857_+\|portal	phage portal protein	D2IYW2	Enterococcus_phage	7.5e-162	58.4
WP_060654717.1\|1432843_1433779_+\|capsid	minor capsid protein	D2IYW4	Enterococcus_phage	4.1e-62	42.8
WP_060654719.1\|1433896_1434472_+	DUF4355 domain-containing protein	A7J296	Streptococcus_phage	5.8e-11	41.4
WP_060654721.1\|1434489_1435392_+	hypothetical protein	D2IYW7	Enterococcus_phage	6.9e-83	56.1
WP_060654723.1\|1435410_1435701_+	hypothetical protein	NA	NA	NA	NA
WP_060654724.1\|1435711_1436053_+\|head,tail	phage head-tail connector protein	K4I470	Lactobacillus_virus	2.6e-19	42.1
WP_060654726.1\|1436052_1436337_+	hypothetical protein	NA	NA	NA	NA
WP_060654728.1\|1436339_1436702_+	hypothetical protein	A7J2A0	Streptococcus_phage	3.3e-12	38.1
WP_060654730.1\|1436698_1437067_+	hypothetical protein	NA	NA	NA	NA
WP_060654733.1\|1437075_1437690_+\|tail	phage major tail protein, TP901-1 family	A0A2K9VC22	Lactobacillus_phage	2.0e-57	57.3
WP_060654735.1\|1437774_1438221_+	hypothetical protein	D2IZN3	Enterococcus_phage	5.7e-14	33.1
WP_060654737.1\|1438313_1438520_+	hypothetical protein	D2IYX5	Enterococcus_phage	3.1e-07	46.0
WP_060654740.1\|1438536_1441671_+\|tail	phage tail tape measure protein	A0A2P0ZL32	Lactobacillus_phage	4.8e-06	51.0
WP_060654742.1\|1441680_1442577_+\|tail	phage tail family protein	D2IYX7	Enterococcus_phage	1.4e-51	40.7
WP_060654744.1\|1442586_1447977_+\|tail	phage tail protein	A0A1B1SDS2	Weissella_phage	5.8e-137	54.1
WP_167715853.1\|1447992_1448166_+	hypothetical protein	NA	NA	NA	NA
WP_167715856.1\|1448152_1448296_+	hypothetical protein	NA	NA	NA	NA
WP_060654746.1\|1448288_1448537_+	hypothetical protein	NA	NA	NA	NA
WP_060654748.1\|1448549_1448780_+	hypothetical protein	NA	NA	NA	NA
WP_060654750.1\|1448766_1449087_+	hypothetical protein	NA	NA	NA	NA
WP_060654752.1\|1449088_1450108_+	hypothetical protein	I6PBG3	Weissella_phage	2.9e-13	38.8
WP_010372950.1\|1450391_1451348_+	TerC family protein	I7HPH5	Enterobacteria_phage	9.6e-43	36.2

DBSCAN-SWA_5

2135537 : 2145301

Streptococcus_phage(25.0%)

transposase,integrase

attL 2133927:2133945|attR 2141997:2142015

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2133927:2133945	attL	NA	NA	NA	NA
WP_060655428.1\|2135537_2136542_-	hypothetical protein	I6PBG3	Weissella_phage	2.7e-11	41.2
WP_060655429.1\|2136543_2136864_-	hypothetical protein	NA	NA	NA	NA
WP_060472676.1\|2137414_2138209_+\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	6.1e-27	34.7
WP_043708826.1\|2138978_2139329_+	helix-turn-helix transcriptional regulator	M1PKY8	Streptococcus_phage	7.6e-14	41.7
WP_052497177.1\|2139315_2139738_+	ImmA/IrrE family metallo-endopeptidase	E3W8B8	Leuconostoc_phage	1.3e-12	34.4
WP_010374093.1\|2139957_2140323_+	phage protein	NA	NA	NA	NA
WP_060655430.1\|2140768_2141407_+	Arm DNA-binding domain-containing protein	Q6EVM3	Oenoccocus_phage	7.4e-23	32.8
WP_060655431.1\|2141408_2141837_+\|integrase	site-specific integrase	Q6EVM3	Oenoccocus_phage	4.3e-19	43.7
WP_010374216.1\|2141983_2142226_-	type B 50S ribosomal protein L31	NA	NA	NA	NA
2141997:2142015	attR	NA	NA	NA	NA
WP_043708823.1\|2142361_2144212_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	5.8e-20	24.9
WP_060655432.1\|2144479_2145301_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	6.3e-43	37.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage