CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP012042	Burkholderia pseudomallei strain Bp1651 chromosome 2, complete sequence	4 crisprs	cas3,csa3,PD-DExK,DinG	1	2	4	0
NZ_CP012041	Burkholderia pseudomallei strain Bp1651 chromosome 1, complete sequence	0 crisprs	DinG,csa3,DEDDh,cas3,WYL,RT	0	0	276	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP012042_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012042_1

1193854-1193946

Orphan

Consensus_repeat	Method
GCGCGTCGGCGCGCGCGGCGGCGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP012042_1

>merge|NZ_CP012042|1|1193854-1193946|CRISPRCasFinder
GCGCGTCGGCGCGCGCGGCGGCGATCAGCCGCTCGCGCTCGGCGGCGGCCTGCGCGAGCGCGTCCTTCAGCGCGTCGTCGCGCGCGGCGGCGA

>NZ_CP012042|1|1|1193854-1193946|CRISPRCasFinder
GCGCGTCGGCGCGCGCGGCGGCGA	TCAGCCGCTCGCGCTCGGCGGCGGCCTGCGCGAGCGCGTCCTTCA
GCGCGTCGTCGCGCGCGGCGGCGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012042.1\|WP_017881689.1\|1190578_1191427_-\|F0F1-ATP-synthase-subunit-gamma	unknown	unknown	gnl\|CDD\|376304
NZ_CP012042.1\|WP_004524995.1\|1178327_1179401_+\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|235136
NZ_CP012042.1\|WP_060547502.1\|1188746_1189250_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012042.1\|WP_038770633.1\|1183898_1185734_+\|response-regulator	unknown	unknown	gnl\|CDD\|237425
NZ_CP012042.1\|WP_082249729.1\|1197908_1198166_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012042.1\|WP_004187346.1\|1194409_1195111_-\|F0F1-ATP-synthase-subunit-A	unknown	unknown	gnl\|CDD\|237383
NZ_CP012042.1\|WP_004524989.1\|1188179_1188689_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012042.1\|WP_060547504.1\|1198297_1200091_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|213656
NZ_CP012042.1\|WP_004524990.1\|1186073_1187639_-\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|185008
NZ_CP012042.1\|WP_004530237.1\|1195408_1195909_-\|AtpZ/AtpI-family-protein	unknown	unknown	gnl\|CDD\|378198
NZ_CP012042.1\|WP_004524993.1\|1182624_1183749_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223912
NZ_CP012042.1\|WP_004529178.1\|1189326_1190352_-\|alcohol-dehydrogenase-AdhP	unknown	unknown	gnl\|CDD\|176257
NZ_CP012042.1\|WP_004524980.1\|1200101_1201505_+\|bifunctional-enoyl-CoA-hydratase/phosphate-acetyltransferase	unknown	unknown	gnl\|CDD\|236180
NZ_CP012042.1\|WP_038728004.1\|1196350_1197937_-\|F0F1-ATP-synthase-subunit-beta	unknown	unknown	gnl\|CDD\|183615
NZ_CP012042.1\|WP_004187193.1\|1194164_1194413_-\|F0F1-ATP-synthase-subunit-C	unknown	unknown	gnl\|CDD\|184067
NZ_CP012042.1\|WP_060547501.1\|1179397_1182622_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP012042.1\|WP_004549747.1\|1195107_1195416_-\|membrane-protein	unknown	unknown	gnl\|CDD\|274462
NZ_CP012042.1\|WP_060547503.1\|1191423_1193418_-\|F0F1-ATP-synthase-subunit-alpha	unknown	unknown	gnl\|CDD\|183987
NZ_CP012042.1\|WP_004540302.1\|1201501_1202680_+\|acetate/propionate-family-kinase	unknown	unknown	gnl\|CDD\|235922
NZ_CP012042.1\|WP_041221408.1\|1195905_1196361_-\|F0F1-ATP-synthase-subunit-epsilon	unknown	unknown	gnl\|CDD\|184057

Protein	Function_ID	Function_description	E-value
NZ_CP012042.1\|WP_017881689.1\|1190578_1191427_-\|F0F1-ATP-synthase-subunit-gamma	gnl\|CDD\|376304	pfam00231, ATP-synt, ATP synthase.	5.09814e-34
NZ_CP012042.1\|WP_004524995.1\|1178327_1179401_+\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|235136	PRK03598, PRK03598, putative efflux pump membrane fusion protein; Provisional.	1.83012e-39
NZ_CP012042.1\|WP_038770633.1\|1183898_1185734_+\|response-regulator	gnl\|CDD\|237425	PRK13557, PRK13557, histidine kinase; Provisional.	4.48941e-132
NZ_CP012042.1\|WP_004524980.1\|1200101_1201505_+\|bifunctional-enoyl-CoA-hydratase/phosphate-acetyltransferase	gnl\|CDD\|236180	PRK08190, PRK08190, bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated.	0
NZ_CP012042.1\|WP_004187346.1\|1194409_1195111_-\|F0F1-ATP-synthase-subunit-A	gnl\|CDD\|237383	PRK13421, PRK13421, F0F1 ATP synthase subunit A; Provisional.	1.54059e-122
NZ_CP012042.1\|WP_060547504.1\|1198297_1200091_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|213656	TIGR01838, Poly-beta-hydroxybutyrate_polymerase, poly(R)-hydroxyalkanoic acid synthase, class I. This model represents the class I subfamily of poly(R)-hydroxyalkanoate synthases, which polymerizes hydroxyacyl-CoAs with three to five carbons in the hydroxyacyl backbone into aliphatic esters termed poly(R)-hydroxyalkanoic acids. These polymers accumulate as carbon and energy storage inclusions in many species and can amount to 90 percent of the dry weight of cell. [Fatty acid and phospholipid metabolism, Biosynthesis].	8.42225e-179
NZ_CP012042.1\|WP_004524990.1\|1186073_1187639_-\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|185008	PRK15048, PRK15048, methyl-accepting chemotaxis protein II; Provisional.	2.47951e-79
NZ_CP012042.1\|WP_004530237.1\|1195408_1195909_-\|AtpZ/AtpI-family-protein	gnl\|CDD\|378198	pfam09527, ATPase_gene1, Putative F0F1-ATPase subunit Ca2+/Mg2+ transporter. This model represents a protein found encoded in F1F0-ATPase operons in several genomes, including Methanosarcina barkeri (archaeal) and Chlorobium tepidum (bacterial). It is a small protein (about 100 amino acids) with long hydrophobic stretches and is presumed to be a subunit of the enzyme. It carries two transmembrane helices and is a magnesium or calcium uniporter. The atp operon of alkaliphilic Bacillus pseudofirmus OF4, as in most prokaryotes, contains the eight structural genes for the F-ATPase (ATP synthase), which are preceded by an atpI gene that encodes a membrane protein with 2 TMSs. A tenth gene, atpZ, has been found in this operon, which is upstream of and overlapping with atpI.	4.39073e-17
NZ_CP012042.1\|WP_004524993.1\|1182624_1183749_+\|ABC-transporter-permease	gnl\|CDD\|223912	COG0842, COG0842, ABC-type multidrug transport system, permease component [Defense mechanisms].	3.93708e-26
NZ_CP012042.1\|WP_004529178.1\|1189326_1190352_-\|alcohol-dehydrogenase-AdhP	gnl\|CDD\|176257	cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD). These alcohol dehydrogenases are related to the cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Cinnamyl alcohol dehydrogenases (CAD) reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	0
NZ_CP012042.1\|WP_004540302.1\|1201501_1202680_+\|acetate/propionate-family-kinase	gnl\|CDD\|235922	PRK07058, PRK07058, acetate/propionate family kinase.	0
NZ_CP012042.1\|WP_038728004.1\|1196350_1197937_-\|F0F1-ATP-synthase-subunit-beta	gnl\|CDD\|183615	PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Provisional.	0
NZ_CP012042.1\|WP_004187193.1\|1194164_1194413_-\|F0F1-ATP-synthase-subunit-C	gnl\|CDD\|184067	PRK13468, PRK13468, F0F1 ATP synthase subunit C; Provisional.	4.45015e-37
NZ_CP012042.1\|WP_060547501.1\|1179397_1182622_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	3.73408e-92
NZ_CP012042.1\|WP_004549747.1\|1195107_1195416_-\|membrane-protein	gnl\|CDD\|274462	TIGR03165, F1F0_chp_2, F1/F0 ATPase, Methanosarcina type, subunit 2. Members of this protein family are uncharacterized, highly hydrophobic proteins encoded in the middle of apparent F1/F0 ATPase operons. We note, however, that this protein is both broadly and sparsely distributed. It is found in about only about two percent of microbial genomes sequenced, with the first ten examples found coming from the Euryarchaeota, Chlorobia, Betaproteobacteria, Deltaproteobacteria, and Planctomycetes. In most of these species, surrounding operon appears to represent a second F1/F0 ATPase system, and the member proteins belong to subfamilies with the same phylogenetic distribution as the current protein family.	3.91378e-10
NZ_CP012042.1\|WP_060547503.1\|1191423_1193418_-\|F0F1-ATP-synthase-subunit-alpha	gnl\|CDD\|183987	PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional.	0
NZ_CP012042.1\|WP_041221408.1\|1195905_1196361_-\|F0F1-ATP-synthase-subunit-epsilon	gnl\|CDD\|184057	PRK13447, PRK13447, F0F1 ATP synthase subunit epsilon; Provisional.	3.58683e-62

>NZ_CP012042.1|WP_060547503.1|1191423_1193418_-|F0F1-ATP-synthase-subunit-alpha
MTPTPDAPAAADAATGAGWLARRRGALARVALAPVAQAIGRVERVADGIAFVSGLEDTMLNEVLRFEGGVTGFAHTLDEDLISVVLLDPDAGVRAQTAVARTGAVLEVPAGPQLLGRVVDPLGRPLDGGAPLDAAHTLPIERAAPAIIERDLVSEPLDTGVLIVDALFTIGRGQRELIIGDRATGKTSLAIDAIVNQRHSDVICVYVAIGQRASAVRRVIDAVRRYGAPERCVFVVAPAACAPGLQWIAPFAGFSIAEYFRDRGQHALVVVDDLTKHAATHRELALLTREPPGREAYPGDIFYVHARLLERAAKLSAALGGGSLSALPIAETDAGNLAAYIPTNLISITDGQIVLDSALFAANQRPAVDVGLSVSRVGGKAQHPALRAASGRLRLDYAQFLELEAFTRFGGLTDARLRAQITRGERIRALITQPRFRALRTLDEVVLLKALAAGALDAMSPDLVAPLRERLPAWLDARIAALTPALAPPRDWLADDAALDALAESVDELIERIAADAAHRATAGMPTEDAAGDIGGAFGGEQARGDADRDADHGANREVSREVSPEASREVSREVSREVSHEADRDAAADAARVAGRAPGRAEPDRAAPRAMPDGPPRAQADGDRASASRPRPDARGDAARTAPSPQGGADANVDAEAEARHKR
>NZ_CP012042.1|WP_017881689.1|1190578_1191427_-|F0F1-ATP-synthase-subunit-gamma
MSDKLAAIEARTDTARQLQTVIGAMQGVAAARAHEAQQRLPGIRASAATVGAAIGDALSAGARSGETAAGARAAPRARLVVVLCSEQGFVGAYNAQLIEHATRPEPSVSREYMMVGSRGAMLADAGGVPLVWRTPMAARADDVVHLANRITDALYAQLAKRGAQPVSIVHAMPGGAARLEVTERRLLPFDYARFDTAPRAQPPLVHLPPATLLAELAQAYVFVELCEAAMLAFAAENEARTRAMIAARESVERALGDLLQAYRIARQDEITADIVELAASGL
>NZ_CP012042.1|WP_004529178.1|1189326_1190352_-|alcohol-dehydrogenase-AdhP
MAQYMKAAVVHAFGEPLRIEEVPVPTPGAGQILVNVKASGVCHTDLHAADGDWPVKPTLPFIPGHEGVGFVAAVGEGVRHVKEGDRVGVPWLYTACGHCEYCQTGWETLCHEQQNTGYSVNGSYAEYVLADPNYVGHLPSNVAFDEIAPILCAGVTVYKGIRVTDTRPGQWIAISGIGGLGHVAVQYAKAMGLHVVAVDVAPQKLELARKLGAAFVVDASKDDPAAVIQKEIGGVHGVLVTAVSRGAFAQALGMVRRGGTVSLNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESLDFAAEGLVRAHIHRDKLEHINGVFSALREGKVDGRIVLTGQ
>NZ_CP012042.1|WP_060547502.1|1188746_1189250_-|hypothetical-protein
MRGAGRASPSRARRYENVSKEPNTHREARAPVHRYRLQVRNMNGECRTYELRLSSLDDGYTLEIDEWLNFPDMHLGDVTPVHVSRPVQFAVPADEFYRRRRAFRTELIESVAAALRAGEVVRMRDSPDEYPGGHAGNPWVNWIRADLRANPGGRPPPVGDDMQDLIH
>NZ_CP012042.1|WP_004524989.1|1188179_1188689_+|hypothetical-protein
MRRIYFLLPDADTARAIVDELLLKRIEWRHIHVVANDRVPLENLPEASIAQSSDLLPALARGTAAGGVTGALAGLAAIAFPPAGLTIAGGAVVAFAIAGAGFGAWVGTMIGVSVPNTRLKHFEDAVDNGELLMMIDVHRDRVEEIEALVKQHHPNAHLEGTDPTIPAFP
>NZ_CP012042.1|WP_004524990.1|1186073_1187639_-|methyl-accepting-chemotaxis-protein
MPTLSFRQKLWLPLVISLIALLLVSISSAWLSYQTRMEERRNDLTNVAHVGLSIVREYAALAQRGVLTDAQARKEALERLRSVRYGSDGYFIVIDSSPRMIMHPIKPDTVGKDLRHVADADGRHHYLTFASVAQSPQGGFVDYVFAHPNAHPAKAVDKLGYVIRYAPWDWIISTGAYIDDIQAAFAKSLCLSAGVFALLAALLALSVVYTNRGIERMIGGDPRIAAHMAGVIASGDLATPFATRREDRSSLMFAISQMRDALANAVAQIRASAGYVATTAGEIADSNMDLSSHTECQATALQQAASSMQRLTERVRDTADRARAASELAGSAARITDRGGDMVVRVVAAMNDIRAESRKMVDIIGVIEGIAFQTNILALNAAVEAARAGNEGRGFAVVASEVRVLAQRSASAAKDIRALIGRAAERVGNGAELVEATGATIGEAQHAICRVTGIVQDIAAAATDQSQGLEQINAAVSQMDSVTRRNATLVEHAAIAAQSLNEQSRCLQDAVAAFRTEALGC
>NZ_CP012042.1|WP_038770633.1|1183898_1185734_+|response-regulator
MHVEVFAQHPSCPGWHGEMARRIRAFDWSATELGPLERWPASLVAAVRTVLASPVPLVMLWGAAGYMLYNDAYAAFAGGRHPYLLGQPVELGWPEVADFNRNVMRTCLAGGALSYRDKALVLLRNGRPEEVWMDLYYSPLAGDDGAPAGVLAVVVETTERVLAARHRDRAKAALHETNAELRRLTETLEQRVADAITERASIEEQLRQAQKMEAIGSLTGGIAHDFNNVLQVVSSNLQMLSAELGEDARAQRRIASAANAVARGAQLASHLLAFARRQPLAPAVLEPRGLIDGMREMLHRALGESVHVDADLRDDVWNVLADRHQFENALLNLAINARDAMRGEGTLKITACNIVLEAGRHARRNGLPPGEYVAFDIADNGVGMTPDILERVFEPFFTTKPDGQGTGLGLSMVFGFVKQSGGHTSIESAPGRGTTVRLLLPRCREAPAGEPAAQRRLPAEGGRETILVVEDDADVRLAVVDMLAQLGYKVITASDGEAGLLALESGAPIDLLFTDVIMPGRIKGGELARRAAQRVPPVPVLFTSGYTRDEIFHAGRLDPGVMLLGKPYRRDELAHKVRSVLDAHASARRAHGARHAQADPRAKTAAARVQR
>NZ_CP012042.1|WP_004524993.1|1182624_1183749_+|ABC-transporter-permease
MRRLAIVYRLGVKELWSLVRDPILLVLIAYTFTASIYSAATARPDTLHMAPIAIIDEDASPLSARIASAFFPPQFALPRMVTLAEADRGMDAGDFTFALDIPPNFQRDVLAGRPAQIQLNVDATRMSQAFTGNGYVQQIVSGEIDDFARRYRANTAPPVDIAMHMRFNPNLDQTWFGSLMEVINNVTLLSMVLTGAALIREREHGTIEHLLVMPVTPGEIMLAKVWSMGLVVACAAAFSLAFVVRGALHVPIEGSVALFVIGMAIHLFATTSMGIFLATLVRSMPQFGMLLVLVLLPLQLLSGSLTPRESMPFAVQNIMLAAPTTHFVEIGQAILYRGAGIETVWRQFLILAVIGTALFLLSLKRFRKTIGQMA
>NZ_CP012042.1|WP_060547501.1|1179397_1182622_+|ATP-binding-cassette-domain-containing-protein
MSAPSVVRFSDVSLRYGKTVALERITLEIPAGLTIGLIGPDGVGKSSLLALAAGARALQTGAVDALGGDMRSRRHRERVCRRIAYMPQGLGKNLYPTLSVEENLQFFARLFGHDADERRRRIDALTRSTGLFAFLSRPAGKLSGGMKQKLGLCCALIHDPDLLILDEPTTGVDPLARAQFWDLIARIRSERPAMSVIVATAYMDEAQRFDWLIAMDAGRVLATGAPAELLARTGCDSLEAAFIALLPEDERRGHKPVTLEPLRADAQTGTAIEARGLTMRFGDFTAVDHVSFRIRRGEIFGFLGSNGCGKSTTMKMLTGLLPATEGTAQLFGKTVDPKDINTRRRVGYMSQAFSLYSELTVRQNLVLHARLFGVPAAEIDARVDEMARRFGLADIYDMLPDSLPLGMRQRLSLAVAMVHKPELLILDEPTSGVDPVARDSFWQLMIDLARRDRVTIFISTHFMNEAQRCDRISLMHAGRVLASDAPAALVRARGAATLEEAFIGYLVDASAQEAQDAQEAQGGAGERPGSSERTAGESLAGRGAATDGDADGAHARPAACANGAAQHRAPDADAAGTDVAAETGARDDARTAHAAGHSAGNDVRATVGSEVGSEVASEAGLAAGAEVGSERGVAHGAERAREPAADAGAAIDVEPGASAESATAAVAPARHTESAATSPRAGNAPAGTPFAAAPAEPPHRAFSAQRALSYMWREMLELRRDPVRATLALIGSLVLMCVIGIGISLDVEDLTYAVLDRDQTELSHDYALNLSGSRYFVERPPIADYAALDRRMRDGELSLAIEIPPNFARDVERGAPAQIGMWIDGAMPQRAETIRGYAIGMHTMWLADKARHRLGVTLAPRAEVVTRYRYNPDVKSLPAMIPAVMPLLLLMLPAMLTALAVVRERELGSILNLYVTPVTRTEFLIGKQVPYVVLAMLNFLLMTMLARIAFDVPVKGSFMTLLLAVLIFNVVATGIGLLASTFTRSQVAAIVMTIIGTMIPTVQFAGLLTPLSSLEGTGRLIGLVYPATYMLSISRGVFNKALSLHDLYSQFWPLAACVPVILGATILLLKKQER
>NZ_CP012042.1|WP_004524995.1|1178327_1179401_+|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit
MIQVTRKQIVAAAAVVVVALGAYYGWTLLRHQGPGDGFASGNGRIEATEIDVATKLPGRIDAILVDEGDFVKAGQPLANMQIQVLRAQYDEATAQRQRALNTAAGVQSQVAQRKSDKAAAQAMVVLRESELDAAERRLARSQTLSREGASSLQELDDDRARARSAQAAVSAAAAQVAAAQAAIEATEAQLVAAHSAVTAADATVARVQADIDDSQLASPRDGRVQYRVAQPGEVLPAGGKVLNLVDLSDVYMTFFLPETVVGRVALGADARIILDAAPNYVIPATVSFVSSTAQFTPKTVETANERQKLMFRVKARIDRELLQKHLKLVKTGLPGVAWVRVDPSKPWPAQLMVKVPQ
>NZ_CP012042.1|WP_004187193.1|1194164_1194413_-|F0F1-ATP-synthase-subunit-C
MNNLIEVVSIAAAALAVSFGAIGPALAEGRAVGAAMDAIARQPDASGTVSRTLFVGLAMIETMAIYCLVVALLLLFANPFVK
>NZ_CP012042.1|WP_004187346.1|1194409_1195111_-|F0F1-ATP-synthase-subunit-A
MNASPLSTVPLFSVGPVGISAPVLATWAIMAVLVALALVARRRLSVDAPSRLQSVLELFVATVDAQIADTMQTPPARYRALIGTIFVLVFCANGASLVPGVEPPTAHLETDAALALVVLAATLYYGVRARGVRGYLATFAEPTWVMIPLNVVEQLTRTFSLIVRLFGNVMSGVFVIGIVLSLAGLFVPIPLMALDLLTGTVQAYIFMVLSMVFIGAAVSGDETSAPRRGQENT
>NZ_CP012042.1|WP_004549747.1|1195107_1195416_-|membrane-protein
MIEMWETARASFDGIAAAIGLALGFAAGACHFVSLGWNSRLFVAGRAGVALALQLARVALAVAVLVVLARAGFGMLVAGSAGFFAARAIAVRRAAALTGARR
>NZ_CP012042.1|WP_004530237.1|1195408_1195909_-|AtpZ/AtpI-family-protein
MMKRRPPEVKREAREARDDAARGDARHAGAGAAPDDPRGAARRDPPPGSRAARGGATHPAARAAEPAAPKPAADRVERAAHTAAARAARGARDPEPSLGRRLAQIGVLGWTIVAPTLAALALGRWLDRMFATRVFFSAPLLMLGAALGLWLAWRWMKAQQHGDRDD
>NZ_CP012042.1|WP_041221408.1|1195905_1196361_-|F0F1-ATP-synthase-subunit-epsilon
MGAELRVTIATPARVCVDDLPIVSLRAEDASGAFGIRASHVDFVTLLRASVVRWRTADGATHYAALDGGVLRVTRGARIEIACRDAVLGESLAELEAVVRGVRATQLDEKRRARVDETRLHAQAVRRLLTYLRPEHAKDGVHAPLKPETLE
>NZ_CP012042.1|WP_038728004.1|1196350_1197937_-|F0F1-ATP-synthase-subunit-beta
MADPQATNGTGAACAERDASDVGDARDEGAGRVVAVRGAVVDVAFDGGALPALNEALTIPVDGAAPILAEVHAHLSDAAVRALALGPTGGLRRGAAVRATGGPIRVPVGDAVLGRLLSVTGAPGDDGAALAADVERRPIHRGAPPLAEQKSANALFATGIKVIDLLAPLAQGGKAAMFGGAGVGKTVLVMELIHAMVERYRGISVFAGIGERSREGHEMLLDMRGSGVLGRTVLVYGQMNEPPGARWRVPLTALAIAEYFRDERAQNVLLLMDNVFRFVQAGAEVSGLLGRLPSRVGYQPTLASEVAALQERIASVEGAAVTAIEAVYVPADDFTDPAVTAIAAHVDSMVVLSRAMAAEGMYPAIDPVASSSILLDPLVVGEAHVEVAIEVRRVIEHYRELQDVIALLGIDELGADDRRLVGRARRLQRFLTQPFAVTEAFTGQAGASVEIADTIAGCRAILRGDCDDWRESSLYMVGTLDDARRKEAAAREADARREAAAAASGAGPGTTSDPASGSAEPQGARHGR
>NZ_CP012042.1|WP_082249729.1|1197908_1198166_+|hypothetical-protein
MPFVACGSATVAPVWLVRRWLHHNGARRPPADLGQKTGNRQTKRGIAQSETIDASASGADTVRAASIVDSNQIPQTYAWLQWPCQ
>NZ_CP012042.1|WP_060547504.1|1198297_1200091_+|alpha/beta-fold-hydrolase
MDTRHAPESGAPDAPLPAHPPASYAPESPYRIFDLAKEASVAKLTSGLSPASLQLALADWLIHLAAAPGKRAELATLALRHAALLGQYPLEAATGRTPAAPAQPSPGDRRFRAGAWQLEPYRFWHQSFLLAEQWWRAATRDVPGVSPHHEDVVAFSARQMLDTFAPANYVATNPEIAQRTALTGGANLAQGVWNYLDDVRRLITKQPPAGAEQFELGRNLATTPGRVVFRNHLIELLQYSPTTPDVYAQPVLIVPAWIMKYYILDLSAHNSLIRYLVGEGHTVFCISWRNVDASDRDLSLDDYRKLGVMDALDTIGAIVPGEKIHATGYCLGGTLLSIAAAAMANTGDDRLASVTLLAAQTDFAEPGELQLFIDDSEIHFLESMMWERGYLGAHQMAGSFQLLMSNDLIWSRVIHDYLLGERTPMIDLMAWNADSTRMPYRMHSEYLRHLFLDNDLATNRYVIDGQTVSVHNIRAPFFVVGTEHDHIAPWRSVYKIHYLSGSDVTFVLTAGGHNAGIVSEPGHAKRHYRMKMTAAAAPSISPDEWLAGATDFEGSWWPAWHAWLARHSSPQRVAPPPLGKPGAHTLGDAPGTYVFQK
>NZ_CP012042.1|WP_004524980.1|1200101_1201505_+|bifunctional-enoyl-CoA-hydratase/phosphate-acetyltransferase
MDREILQNRPFDSLAIGDSASLVRTASRDDIDLFAAMSGDVNPAHLDAAFAAHDLFGHVVVHGMWTGALVSAVLGTKLPGPGTIYLDQTLEFRHPVAPGDTITATVTVAEKRPEKRIVLLDTRCTNQDGHVVLRGTATVIAPDTPITWERVPGPEVAVRRHDRYETFVRDAREQPPLRTAIVHPCSPDALRAAIDARDANLIEPILIGPQAKIRAIADAAGVDLAGVPIEAVEHSHAAAARAVEMGGAGEVAALMKGSLHTDELLAAVIGPASRLRTERRISHVYAMDVPAYPKPLLITDAAINIAPTLEQKRDICQNAVDLLHVLGVERPRVAVLAAVETVNPKMPSTLDAAALTVMAARGQIAGAIVDGPLAFDNAVSAVAAMSKGIASPVAGDADVLLVPDLEAGNMLAKQLMYFAGADAAGLVLGARLPIILTSRADSLRVRIASAALAKLVAERTRAGALAS
>NZ_CP012042.1|WP_004540302.1|1201501_1202680_+|acetate/propionate-family-kinase
MSEPLLLTFNAGSSTLKIGLYSVANGEPAPLGRGKIDFNRAPLQFEYANGGEAHAVPLAAPVTDDLHAVLDEALGWIDAHLSVHELVSVGHRVVHGGDTFDGPVRIDERTLDAIAALVPLAPLHQPQSVRLIRALRHVRPHLPQVASFDTAFHRTQSDLVRRFALPRALFDAGIKRYGFHGLSYRYVAGRLRERHPSIARGKVVAAHLGSGASLCALDAGVSRDTSMGFSTLDGIPMATRCGALDAGVVLHLQKTLGRTLDDVEQMLYHRSGLLGVSGVSGDARALLADPSAGARDALELFAFRIAGETARLAATLGGLDALVFTAGIGEHQPQTRAAVCERLRWLGVELDAHANARNAETVSRDGSRVAVLVVPTDEEQVIARDAASVLHA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP012042_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012042_2

1623715-1623800

Orphan

Consensus_repeat	Method
CGGAATGCCCGATCATCGGGATGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP012042_2

>merge|NZ_CP012042|2|1623715-1623800|CRISPRCasFinder
CGGAATGCCCGATCATCGGGATGCCTGCTCGCCGAAGCACTCCACCGCAGAGGCGCCGCCGCCGGAATACCCGATCATCGGGATGC

>NZ_CP012042|2|2|1623715-1623800|CRISPRCasFinder
CGGAATGCCCGATCATCGGGATGC	CTGCTCGCCGAAGCACTCCACCGCAGAGGCGCCGCCGC
CGGAATACCCGATCATCGGGATGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012042.1\|WP_060547573.1\|1633102_1633432_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012042.1\|WP_004532536.1\|1610688_1611732_-\|alpha-ketoacid-dehydrogenase-subunit-beta	unknown	unknown	gnl\|CDD\|223101
NZ_CP012042.1\|WP_004200705.1\|1634337_1634991_+\|SagB/ThcOx-family-dehydrogenase	unknown	unknown	gnl\|CDD\|380318
NZ_CP012042.1\|WP_004548017.1\|1617364_1617955_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012042.1\|WP_004187469.1\|1622602_1622998_-\|conjugal-transfer-protein-TraR	unknown	unknown	gnl\|CDD\|224648
NZ_CP012042.1\|WP_038733422.1\|1620196_1622470_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|369639
NZ_CP012042.1\|WP_060547569.1\|1625883_1627725_+\|ribonucleotide-reductase-like-protein	unknown	unknown	gnl\|CDD\|180772
NZ_CP012042.1\|WP_060547826.1\|1615000_1616116_-\|sterol-desaturase	unknown	unknown	gnl\|CDD\|378454
NZ_CP012042.1\|WP_060547572.1\|1631156_1632974_+\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|223732
NZ_CP012042.1\|WP_011853975.1\|1636441_1639363_+\|molybdopterin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|239164
NZ_CP012042.1\|WP_060547570.1\|1627797_1629609_+\|bifunctional-aminoglycoside-phosphotransferase/ATP-binding-protein	unknown	unknown	gnl\|CDD\|225098
NZ_CP012042.1\|WP_004532579.1\|1613648_1614251_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012042.1\|WP_004529498.1\|1635058_1635493_-\|Hsp20/alpha-crystallin-family-protein	unknown	unknown	gnl\|CDD\|223149
NZ_CP012042.1\|WP_009969572.1\|1618014_1619913_+\|GMC-family-oxidoreductase	unknown	unknown	gnl\|CDD\|225186
NZ_CP012042.1\|WP_004187137.1\|1633435_1633885_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341411
NZ_CP012042.1\|WP_060547568.1\|1624386_1625658_+\|polyhydroxyalkanoate-depolymerase	unknown	unknown	gnl\|CDD\|130908
NZ_CP012042.1\|WP_004523279.1\|1630128_1631160_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236122
NZ_CP012042.1\|WP_004523292.1\|1611737_1612970_-\|3-methyl-2-oxobutanoate-dehydrogenase-(2-methylpropanoyl-transferring)-subunit-alpha	unknown	unknown	gnl\|CDD\|223997
NZ_CP012042.1\|WP_004557971.1\|1614222_1614663_+\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176863
NZ_CP012042.1\|WP_004523291.1\|1616413_1617349_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176109

Protein	Function_ID	Function_description	E-value
NZ_CP012042.1\|WP_004532536.1\|1610688_1611732_-\|alpha-ketoacid-dehydrogenase-subunit-beta	gnl\|CDD\|223101	COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion].	0
NZ_CP012042.1\|WP_004200705.1\|1634337_1634991_+\|SagB/ThcOx-family-dehydrogenase	gnl\|CDD\|380318	cd02142, McbC_SagB-like_oxidoreductase, oxidase similar to the microcin B17 processing protein McbC. This family is the oxidase domain of NRPS (non-ribosomal peptide synthetase) and other systems that modify polypeptides by cyclizing a thioester to form a ring. These include EpoB, part of the epothilone biosynthesis pathway; TubD, part of the tubulysin biosynthesis pathway, MtsD, part of the myxothiozol biosynthesis pathway; IndC, part of the indigoidine biosynthesis pathway and TfxB, part of the trifitoxin processing pathway. All are FMN-dependent and oxidize the product of the cyclization of thioesters in short polypeptides.	6.31252e-20
NZ_CP012042.1\|WP_060547570.1\|1627797_1629609_+\|bifunctional-aminoglycoside-phosphotransferase/ATP-binding-protein	gnl\|CDD\|225098	COG2187, COG2187, Uncharacterized protein conserved in bacteria [Function unknown].	3.3814e-74
NZ_CP012042.1\|WP_038733422.1\|1620196_1622470_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|369639	pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase. This family includes both class I and class II oxidoreductases and also NADH oxidases and peroxidases. This domain is actually a small NADH binding domain within a larger FAD binding domain.	8.12414e-57
NZ_CP012042.1\|WP_060547569.1\|1625883_1627725_+\|ribonucleotide-reductase-like-protein	gnl\|CDD\|180772	PRK06948, PRK06948, ribonucleotide reductase-like protein; Provisional.	0
NZ_CP012042.1\|WP_009969572.1\|1618014_1619913_+\|GMC-family-oxidoreductase	gnl\|CDD\|225186	COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism].	4.08722e-35
NZ_CP012042.1\|WP_060547572.1\|1631156_1632974_+\|STAS-domain-containing-protein	gnl\|CDD\|223732	COG0659, SUL1, Sulfate permease and related transporters (MFS superfamily) [Inorganic ion transport and metabolism].	6.38492e-108
NZ_CP012042.1\|WP_011853975.1\|1636441_1639363_+\|molybdopterin-dependent-oxidoreductase	gnl\|CDD\|239164	cd02763, MopB_2, The MopB_2 CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site. These members belong to the molybdopterin_binding (MopB) superfamily of proteins.	0
NZ_CP012042.1\|WP_004187469.1\|1622602_1622998_-\|conjugal-transfer-protein-TraR	gnl\|CDD\|224648	COG1734, DksA, DnaK suppressor protein [Signal transduction mechanisms].	1.7869e-14
NZ_CP012042.1\|WP_004529498.1\|1635058_1635493_-\|Hsp20/alpha-crystallin-family-protein	gnl\|CDD\|223149	COG0071, IbpA, Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones].	9.00264e-33
NZ_CP012042.1\|WP_060547826.1\|1615000_1616116_-\|sterol-desaturase	gnl\|CDD\|378454	pfam10604, Polyketide_cyc2, Polyketide cyclase / dehydrase and lipid transport. This family contains polyketide cylcases/dehydrases which are enzymes involved in polyketide synthesis. It also includes other proteins of the START superfamily.	1.90825e-11
NZ_CP012042.1\|WP_004187137.1\|1633435_1633885_-\|CBS-domain-containing-protein	gnl\|CDD\|341411	cd17775, CBS_pair_bact_arch, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains present in bacteria and archaea. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	1.39507e-50
NZ_CP012042.1\|WP_060547568.1\|1624386_1625658_+\|polyhydroxyalkanoate-depolymerase	gnl\|CDD\|130908	TIGR01849, unnamed_protein_product, polyhydroxyalkanoate depolymerase, intracellular. This model represents an intracellular depolymerase for polyhydroxyalkanoate (PHA), a carbon and energy storing polyester that accumulates in granules in many bacterial species when carbon sources are abundant but other nutrients are limiting. This family is named for PHAs generally, rather than polyhydroxybutyrate (PHB) specificially as in Ralstonia eutropha H16, to avoid overcalling chemical specificity in other species. Note that this family lacks the classic GXSXG lipase motif and instead shows weak similarity to some [Fatty acid and phospholipid metabolism, Degradation].	1.17003e-114
NZ_CP012042.1\|WP_004523279.1\|1630128_1631160_+\|hypothetical-protein	gnl\|CDD\|236122	PRK07877, PRK07877, Rv1355c family protein.	3.7258e-30
NZ_CP012042.1\|WP_004523292.1\|1611737_1612970_-\|3-methyl-2-oxobutanoate-dehydrogenase-(2-methylpropanoyl-transferring)-subunit-alpha	gnl\|CDD\|223997	COG1071, AcoA, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion].	5.32689e-143
NZ_CP012042.1\|WP_004557971.1\|1614222_1614663_+\|SRPBCC-family-protein	gnl\|CDD\|176863	cd07821, PYR_PYL_RCAR_like, Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins. The PYR/PYL/RCAR-like family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. PYR/PYL/RCAR plant proteins are receptors involved in signal transduction. They bind abscisic acid (ABA) and mediate its signaling. ABA is a vital plant hormone, which regulates plant growth, development, and response to environmental stresses. Upon binding ABA, these plant proteins interact with a type 2C protein phosphatase (PP2C), such as ABI1 and ABI2, and inhibit their activity. When ABA is bound, a loop (designated the gate/CL2 loop) closes over the ligand binding pocket, resulting in the weakening of the inactive PYL dimer and facilitating type 2C protein phosphatase binding. In the ABA:PYL1:ABI1 complex, the gate blocks substrate access to the phosphatase active site. A conserved Trp from PP2C inserts into PYL to lock the receptor in a closed formation. This group also contains Methylobacterium extorquens AM1 MxaD. The mxaD gene is located within the mxaFJGIR(S)ACKLDEHB cluster which encodes proteins involved in methanol oxidation. MxaD may participate in the periplasmic electron transport chain for oxidation of methanol. Mutants lacking MxaD exhibit a reduced growth on methanol, and a lower rate of respiration with methanol.	7.66567e-25
NZ_CP012042.1\|WP_004523291.1\|1616413_1617349_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176109	cd08417, PBP2_Nitroaromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of dinitrotoluene and similar compounds, such as DntR, NahR, and LinR. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. Also included are related LysR-type regulators clustered together in phylogenetic trees, including NodD, ToxR, LeuO, SyrM, TdcA, and PnbR. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.07132e-61

>NZ_CP012042.1|WP_004187469.1|1622602_1622998_-|conjugal-transfer-protein-TraR
MAAFDEHQLQVLGALLRACRQALQADVRAGERQRADEPYANLAGPAPDEGDEANADLFVDVDHALLGMKLAELRDVDAALQRIARRDYGCCADCGQPIAYERLLARPTALRCAPCQRAHERRFATQPRPSL
>NZ_CP012042.1|WP_038733422.1|1620196_1622470_-|FAD-dependent-oxidoreductase
MREFDYLLVGGGIASVTAARTLRGEDASASIAILCGEPVLPYQRPPLSQEWLMGAVQPASITLHDAAFYAAQRIDIALGVRAEQLDRAKRIVRTSSGATFRYGKLLIATGASAKAPALPGFGLDGVHVLHTFAQAQALKDAAAHARRATVLGGGFLGVEIAATLQALGLQVTLVERAPGVMPSLRAPALGGHFEALCRARGIDVLTRCEVRRVLGAQCVEAVETSDGGTRPCDLFVAAVGVTPNCGWLDGSGLALGDGVEVDAFLQTADPDVFAAGDVAHFDDPIFGVRRRIEHWDNAVRQGRIAARNMLGHRLPYRDVSIFYGSVFGLSYNLLGYPVGATETIERGAFDEASYMQLYLADDVLRAAFTIDRPAVEIAALNDAIRLHVNVAARKTKLSDPNYPLDKLPVQTILILQGGGALGAFECGAVKALEQHGVRPDVISAVSIGAFNGAIVASHPKGATKALEAFWRELSIALPLPYESQWREAWLSSYVLSFGVPNFLKPQWSQLGFDADRLRAKWTSFFDATAIEQLIARYVDFDSLGMSPTRLLIGAVDVETGEPRIFDSYVDRLSPAHVLASGSLPPGMPWTVVDGRPYWDGGVVSNSPLDLVIARCGQIGGRVFIVDLFSGSKALPTNLVEVMLRREEIAYMDRVRNDLRFEEYASDFRDLVDGILAHVDAPSANEIRQQPLYIRLMGNRAAIDIARITLNREGRLSFIEDYDFSSDAIAQLQQQGYDAALVALANGRSRRRRGRRRA
>NZ_CP012042.1|WP_009969572.1|1618014_1619913_+|GMC-family-oxidoreductase
MLGATRSTLWGSRERPRIAAARAPGAVASRMREEARECAGPRGAGRAPHRATAAGGKTGRRTVRAPSRARAGSNNQKVNRMKQQSYDYDYVVVGSGFGGSVSALRLSEKGYRVLVIEQGRRWTPENLPESTWNLSRWQWRPALGLRGFFSMRFFRHVVVLHGNAVGGGSITYANTLLVPPDKVWREGTWAGLEDWERVMPAHYATAKRMLGVVTNRRMDAADFRLKDMAKLIGVEKSFYPTEVGVFFGDDADAPGTRYADPYFGGAGPERTSCIGCGGCMVGCRHGAKNTLDRNYLYLAERLGAQVREQTKVVDVRPLDARADGAAGYAVEAVSLAAGARGAKSRLTCRGVVFAASSLGTQDLLMRLKEKGSLPRLSDALGKRVRTNAESLIGVRFPKSRVDLSKGVAIGSGIYIDEHTHIEATRYPSGSDTMGLLTTVLTRGAPGGLRVLVWLGALAKLVLTRPLSAWRMIDPRGFARETMIFLCMQTLEGHLTMRLKRRWFWPFSKQLATSGAKIPAYIPAANDFAQKAARALGGVPMTSLTEILLNVPMTAHCMGGAAMARDARDGVCDGRSRVFGYRNMYVCDGSVLGANLGVNPSLTITALAEHAMSHVPAAREQRWDSTAETLVAA
>NZ_CP012042.1|WP_004548017.1|1617364_1617955_+|hypothetical-protein
MCRARGIGRQARGNATAPSPIAAAAIGARPRSAPRGPRISDAGRLAAARSAFAMHQERRKRNADRHGTHPYDADSRAAPREAPRFEHEPKKQRDAAQHEVDRDRAAREIRERIEHKARPDVRRAERPISQDVAQTPIGAAGAISPSTAHSIFLEIGLALAGRPIQVRRNRAPFTHGTPRRRPARGPTARTASPAPV
>NZ_CP012042.1|WP_004523291.1|1616413_1617349_+|LysR-family-transcriptional-regulator
MIQNLRQLDLNLLLVFDALMQEQNLSRAAIRLHMSQPAVSNALTRLRQQLGEPLFTRTARGMTPTAQARTLYEPVRQALYLLQIGLGPQADFEPDTHHLFKLSMNDYGQTVLLPDLLAHIKSRAPNVMLSVQSDDAGSIPAQLTTGTLDLAIDYLHFDNPELCYEPLHEEHLVVIGRAGHPAFAGGLALRGYEESGHVSIQPRDRRGSPLEIVLGSARVRRVVHLQVPHYLTIPALVAKSDLLGTIPRRLAERFADVYALQIAPLPIDIAPIQVSLIWHRQQDAQPGLRWLREQVVLTHRAIIGCDEHAPA
>NZ_CP012042.1|WP_060547826.1|1615000_1616116_-|sterol-desaturase
MTQDVTVFRARYRASVHPRYNAWLHGGFVLAYGCAAIAFFLKDVARVSAVQWASVPAAFLLFNWLEFTVHRHVGHVKRRFGAMFYRRHTGDHHSFFANEQIAYREARDWRVILFPAWLIVVFSLGLFALHAVLGRFDANVAGLFASTMLGGYLLYECVHACEHLPDAHPLAKWPWIRQMRVLHRVHHRDALMRSCNFDVIWPLMDWLHGTLRWSEAPGADMSTRMRHEIDIACAGADVLAYASDASRWPEWHPSSLRVDGPAGSLAAGSRFDEDVRAAGRVDRLHWDVVRNEPGVMWQARAANTAGSLRILLTYECSGGPRGARFVRTLHYHSPNPLLRLANALVMRGRIERESAYSLTLLKRRLEAARDA
>NZ_CP012042.1|WP_004557971.1|1614222_1614663_+|SRPBCC-family-protein
MKQQRIEIAEEFDAPVHQVFRFFSEHENLKSIFSPARIRRISDGEPARNGVGSAREMRVPGAPPFVETVTAYQENELIEYRITRGSPLRDHLGVMRFVPIDERRTYFHYVITFEGKVPFVAPVVRHVLEGSIRRGLGKVATRRLWG
>NZ_CP012042.1|WP_004532579.1|1613648_1614251_+|hypothetical-protein
MNSILAPDNAPPAPANRTSPLMSALARAVVTAPLPGSDRAAEASTRVSTMRAQSASAIRVRSCRRSRSSRHGLPESPACRRKSPARPRSRRAPRPLADHTRMRFSPPRLGVRTARPPPAGRSKPARGASAIRLRVQRRSSRLTMTLINVIVIARAPQTAIVAHRGIGPRAIGRLTARRRAARPSTLETRPSYETATHRNR
>NZ_CP012042.1|WP_004523292.1|1611737_1612970_-|3-methyl-2-oxobutanoate-dehydrogenase-(2-methylpropanoyl-transferring)-subunit-alpha
MSQYGPLRLHVPEPTGRPGCKTDFSYLRLSPAGKVRKPPIDVAPADTSDLAYGLVRVLDEHGRAVGPWAPDLDPDILRKGIRAMLKTRIFDARMQIAQRQKKISFYMQCLGEEAIAVAHTLALERGDMCFPTYRQQGILMVREYPLVDMMCQLMSNERDPLKGRQLPVMYSTRDAGFFSISGNLATQFIQAVGWAMASAIKGDTRIASAWIGDGATAEADFHTALTFAHVYRAPVILNVVNNQWAISTFQAIAGGEGATFAGRGVGCGIASLRVDGNDFLAVYAASRWAAERARRNLGPTLIEWVTYRAGPHSTSDDPTKYRPGDDWTNFPLGDPLERLKRHMIGIGVWSEQDHEDTKAALEAEVLAAQKEAERYGTLADEHVPNVASIFEDVYKEMPAHLRRQRQQLGV
>NZ_CP012042.1|WP_004532536.1|1610688_1611732_-|alpha-ketoacid-dehydrogenase-subunit-beta
MTTASREGPAASPMTMIQALRSAMDVMLERDGNVVVFGQDVGYFGGVFRCTEGLQNKYGKSRVFDAPINEGGIVGAAVGMGAYGLRPVCEIQFADYFYPASDQIVSEAARLRYRSAAEFIAPLTIRMPCGGGIYGGQTHSQSPEAMFTQVCGLRTVMPSNPYDAKGLLISAIENDDPVIFLEPKRLYNGPFDGHHERPVTPWSKHPASLVPDGYYTVPLDSAAIVRAGGDVTVLTYGTTVHVSLAAAEETGIDAEVIDLRSLWPLDLDTIVESVRRTGRCVVVHEATRTCGFGAELIALVQEHCFHWLEAPVERVTGWDTPYPHAQEWAYFPGPNRVGDALRRAMEN
>NZ_CP012042.1|WP_060547568.1|1624386_1625658_+|polyhydroxyalkanoate-depolymerase
MLYAWLEAQREFFRACQPWAGAAQRAGAGAGARPAGWPTWGPMARAADAVPAPPPFAIASIEIDGAAVPVDECVVDDTPFCALRKFSRRLRGDAAARPAVFLCTPLAGHHAVMLRETVETILATRDVYVTDWRNARDVPLEAGAFGLDDYVCTLERFVAGAAGDGLHMMAVCQATVPALAAVALLAARDVHVTSVALLGGPVDTRSHPTLIDRFALEHDLDWFRRTAIDIVPPPYAGAGRRVYPGFIQHAAIIVAHPQRRASLESRYWAAWMTGDFAAAARCLREMNEYGAVLDMTERYFLDTIRVIFHERLLAQGRWSIGRRLVAPRRLTRTALCTIEGGRDDIAGAGQTHAAHALCDAVPDAVRERITEPDCDHYDLFLGARWRRTIHPALDAFWTRAEAARAAAGEPRPTAERAERRIAH
>NZ_CP012042.1|WP_060547569.1|1625883_1627725_+|ribonucleotide-reductase-like-protein
MRTINKRTRAIAHADSFVRMIGDMDDQPICDAVFADRYALPGEHSRAQACARVARALALAEPMATRSGAARRFYRNLLNGAFGAGRIMARAGAAPDQTMASCFVHPIRAPAALTRFHPNLDEALDDARLALAMGADIGYDFSAIPPAGARPDADHPDSPGVCAALDRFDRIGTQAGERDGRRRAQLAVLRCDHPDLLAFAAAKHRHAGRHARWTTLELAVAATDAFMQAVEQDLPWTLRHTAPPRDAPGGALPGADGAWTYASVPARHVWREIVSAARDGAGPSLVFVDAIDAADPLRGRERIGATSPCGAQPLPPYGSAMLGAIDLSRFVRNPFGAGGEPRFDFAAFDTAVRIEVRLLDNALDVTRWPLAAHARESYQKRRIGVGVTGLADMLAMMRLRYDSPAAREMARYIASDLRHHAYAASAELAAERGAYPLCDRHAHLDALRAGPPLPHAVCHAIERDGLRHSHLTSFAPVIGVSLAFGDHCSPGIEPARAWIEHRPVRAGAAGAPGMRAENHAHRLFRSLRGERAALPDYFATDADVAPGERLAMRVALQPYVDAGIDNTLTLANHYSLEEVNALLFAAWRAKLKSVAIRRADLARDAQPSDDDGV
>NZ_CP012042.1|WP_060547570.1|1627797_1629609_+|bifunctional-aminoglycoside-phosphotransferase/ATP-binding-protein
MTTGAVAARRLPRRGTARGRRAPSRAFTIHGGDEMRRSRQPKPAKPAAVRRRPHGAARAHAIRGNGPQRRAVRERAARRLSRDIDAALRRASTYPHPAGPIVRIETHLSVVYLVGRFAYKRLKPFDFGFANFSELAARRRACEAELALNRPLAAPIYLAAGPLVRRARGLRLFGAGAAVDHVVRMRRFDERMLFSRLLARGALDAADIDAAATRLAAYHLHAPRDIPRRAYGSARELRRQLDDMLAPLARALGAALPASLRAWCVRRCDELAAHLDARRADGYVRACHGDLHLNNVVKRGRDALMFDCIDFDDALRWIDVINDLSFLLMDLHAHDRAALAHRLLNRWLDETGDFAGLAALPLYVAYRALVRALVATMRAGGDAAARAARIERARRYVDVAAHAARARRPCLLLCHGYSGSGKSVASRALADVSGAIRLSSDSERKRARPFAAVDARPLPASAYTPQQIDAQYERLRALARDVLRAGYTALVDATFLSHARRARFFALARELGVPVYVLDFHASRACLERRVDARAAARDDRSDAGAAVLATQRASADPLDADERARTIGFDTDVPLATLRSAGYWRPVLDALDAARVDAQATR
>NZ_CP012042.1|WP_004523279.1|1630128_1631160_+|hypothetical-protein
METSPLKTTTPEAIPPFDPSASVEDKLRLAIHYAILAPSSHNTQPWRFMVGDGSVMLCADRLRALSVVDPYDRELLISCGAALLNLRVALSRFGFAYVIDMFPSPSDPDVIALVRLDPHGYHDESLVPLFDAILERVTTRTPYANEAVPCDVQRALVDAGAAEGAEIACVDAPHALDEIAELIADADRLQFADPRFRRELANWVHPRRHDDGMPAFAAGVPALLDFATPVVASAIRTFDLGGGLAAMHHKLVDGSPLIVGISTASDDRDAWVAAGQALERVLLVAAAAGLTASYLNQPIEIDALRERLRPLLHVDAHPQLLLRIGRGPVVAHAPRRPLMDVVS
>NZ_CP012042.1|WP_060547572.1|1631156_1632974_+|STAS-domain-containing-protein
MTERERAARGRNDARRGGGDSGGDDEAWRRWLPGIATLRTYRRAWLARDLYAGVALTAVLVPVGMSYAQAAGLPVIAGLNASIAALVGYAIFGPSRILVLGPDSALAALIAGAIAPLAHGEPAHAVALAAALALMSGGFCVLAGLLKLGFVTDLLSKPIQYGYLNGLALTLIASQLPSLLGTVPLGGTFVDQVASLAATVAQGRIDFASLALGGGCLAGIALLRRVAPAWPGMLIAVAGASIVAAWLGAAPDAGGAHAHVAYAHVALVGSLAGTLPPLGLPSISLADASRLIAGALAIAMVSVADISVLSHVFAQHDGSETDRNQELCALGAANLLAGMLRGCAVSSSASRTPVALAAGARTQLTSLVAAACIALLLIAPTLLARVPLAALAAVVVYSANALVDVRAIVRLYRVRRGECAVSVLCFAGVVLLGVVPGILLAVGLSLLSFVWRAWHPYDAVLGRVEGMHGYHDVSRHPGAALTRGLVAFRWDAPLFHANATIFRDHVRDAIAEADAPVRCVVIAAEPITDVDVTAADMLATLRDELAARRIALVFAEMKGPVKDRLRTYGLFEKIGADHFFPTVTDAIEHFTRMRKDVATARRARR
>NZ_CP012042.1|WP_060547573.1|1633102_1633432_-|hypothetical-protein
MLSSRLVSSRLAPCCVYIDIQGEGDVDVDAEGNGNGNIDVIDSKRCEPSGVEPVERAVRRPRYRAQSGCLSCIHRNGIVMPDPMPPTNRFDRLRASAVIVDRTKPRRSP
>NZ_CP012042.1|WP_004187137.1|1633435_1633885_-|CBS-domain-containing-protein
MNAAEICTREVVACRRTDTVLDAAHLMRDRHVGDLIVVDDAGHAHAPVGMLTDRDIVLSLIAKEVDPAALFVGEIMSAPAAVVHEHDSLWTIAQRMRLTGVRRMPVVNADGALVGMVSVDDLLASVAALFDEIASISRRQIHFEEKARD
>NZ_CP012042.1|WP_004200705.1|1634337_1634991_+|SagB/ThcOx-family-dehydrogenase
MSDPELLTYQPIAVALPGPAEAGAPAVIDLPPPDLGAGLPLMSALSLRASTREFSSAALAPTTLGELLWAADGVNRPTTGGRTAPSAHAFNEIDIYAALPDGVYRYDAALHRLLLKHAVDARNLTGYQDFVGAAPLDLIYVVRMSRLLSMPKPLRETFSAVAAGAIAQNVALYCASTGLGCVVRGWINHRLLAEALSLNEDELPILAQTVGKPAAHP
>NZ_CP012042.1|WP_004529498.1|1635058_1635493_-|Hsp20/alpha-crystallin-family-protein
MSNVTRYDPFSLEPVSDLFQGLFRPLRGIADADDEKLASMKIDVTENDQAYAVKAELPGVDKNDINVQIDGNTVSISAKVERNKELKEGERVIRRERYSGEFARTFSLANELDRDAASAQYQDGVLSLTLPKKASSEKKKLTIG
>NZ_CP012042.1|WP_011853975.1|1636441_1639363_+|molybdopterin-dependent-oxidoreductase
MDDRARSGGEAREVKTTTCYMCACRCGIRVHLRNGEVRYIDGNPDHPLNQGVICAKGASGIMKQYSPARLTQPLMRKAGAERGSAQFEPVSWDVAFSVLEQRLAHLRATDPKRFALFTGRDQMQALTGLFAKQYGTPNYAAHGGFCSANMAAGMIYTVGGSFWEFGGPDLDRAKLFFMIGTAEDHHSNPLKIAISKFKRAGGRFVAINPVRTGYAAIADEWVPIRPGTDGALFMAMIRELIETGGYDRDFVTRYTNAAELLDMRAEADTFGLFVRDASRPERNPLFPQNHLWWDLGSGRAVAHHTRGATPALDGRYALDDGTPVAPSFALLRERVAECTPQWAERITGIPAATIRRLAHEMADVARDHKITLPIRWTDAWGETHDTVTGNPVAFHAMRGLAAHSNGFQSIRALAVLMSLLGTIDRPGGFRHKSPYPRAVPPSAKPPNGPDAVRPNTPLAAGPLGWPAAPEDLFVDEQGGPVRIDKAFSWEYPLAVHGLMHSVITNAWRGDPYPIDTLMIFMANMAWNSSMNTVEVRRMLADRHDNGDYKIPFIVVCDAFQSEMTAFADLILPDTTYLERHDAMSMLDRPISEFDGPVDSVRIPVVPPTGECKPFQEVLIELASRLKLPAFTNADGTRKFRDYPDFVINYQTAPDSGVGFLIGWRGEDGGDALVGAPNPRQWDEYEKHGCVFHYTLPDTLQYMRGCNGPYLKWAVEKGFRKYDAPIVIHLYSDVLQKFRLAAQGRTRGRQPPEHLRARIARHFDPLPFWYEPLELGATDLQRYPLAAVTQRPMAMYHSWDSQNAWLRQIHGENALFVNPKVARDAGIDDGGWIYVESQWGKVRCRARYSEVVEPGTVWTWNAIGKAAGAWNLGPDANESQRAFLLNHVITDELPGEGAHAPRISNSDPITGQAAWYDVRVRIYPAEADADHTLPQFAPMPALPGVTGAVRRIVQTYFAGRGEFAARLRDAAKRR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP012042_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012042_3

2045999-2046156

Orphan

Consensus_repeat	Method
GACTCGAAGGACTCGAAGGACTCGAAGGACTCGA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP012042_3

>merge|NZ_CP012042|3|2045999-2046156|CRISPRCasFinder
GGTTCGATGAACTCGATGAACTCGATGAACTCGATGAACTCGATGAGTCAGATGAGTTCGATGGACTTGAGACTCGAAGGACTCGAAGGACTCGAAGGACTCGAAGGACTCGAAGGACTCGAAGGACTCGAAGGACTCGAAGGACTCGAAGGACCCGA

>NZ_CP012042|3|3|2045999-2046156|CRISPRCasFinder
GGTTCGATGAACTCGATGAACTCGATGAACTCGA	TGAACTCGATGAGTCAGATGAGTTCGA
TGGACTTGAGACTCGAAGGACTCGAAGGACTCGA	AGGACTCGAAGGACTCGAAGGACTCGAAG
GACTCGAAGGACTCGAAGGACTCGAAGGACCCGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012042.1\|WP_004529784.1\|2040170_2041184_+\|low-specificity-L-threonine-aldolase	unknown	unknown	gnl\|CDD\|236710
NZ_CP012042.1\|WP_004529796.1\|2057161_2057989_+\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|223629
NZ_CP012042.1\|WP_004202259.1\|2056062_2057151_+\|extracellular-solute-binding-protein	unknown	unknown	gnl\|CDD\|270267
NZ_CP012042.1\|WP_004537019.1\|2035615_2035783_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|176167
NZ_CP012042.1\|WP_004523486.1\|2047801_2048728_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|226928
NZ_CP012042.1\|WP_004533856.1\|2054992_2056036_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226361
NZ_CP012042.1\|WP_004188780.1\|2052687_2052915_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012042.1\|WP_004523490.1\|2041152_2042130_-\|ArgP/LysG-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|237357
NZ_CP012042.1\|WP_004188492.1\|2045117_2045936_-\|heme-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|184132
NZ_CP012042.1\|WP_004523487.1\|2046339_2047461_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP012042.1\|WP_009975129.1\|2048724_2049876_-\|hemin-degrading-factor	unknown	unknown	gnl\|CDD\|226243
NZ_CP012042.1\|WP_004529783.1\|2037119_2038127_-\|cytochrome-d-ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|376764
NZ_CP012042.1\|WP_004523480.1\|2054139_2054988_+\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|224098
NZ_CP012042.1\|WP_038726669.1\|2053076_2053973_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|182990
NZ_CP012042.1\|WP_004188612.1\|2044460_2045069_+\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NZ_CP012042.1\|WP_004537102.1\|2042306_2044448_+\|PBP1A-family-penicillin-binding-protein	unknown	unknown	gnl\|CDD\|273955
NZ_CP012042.1\|WP_024430682.1\|2049932_2052212_-\|TonB-dependent-hemoglobin/transferrin/lactoferrin-family-receptor	unknown	unknown	gnl\|CDD\|273808
NZ_CP012042.1\|WP_004188183.1\|2038162_2039575_-\|cytochrome-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|376587
NZ_CP012042.1\|WP_038732931.1\|2035813_2036209_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|176167
NZ_CP012042.1\|WP_004523495.1\|2036442_2036637_+\|YqaE/Pmp3-family-membrane-protein	unknown	unknown	gnl\|CDD\|376592

Protein	Function_ID	Function_description	E-value
NZ_CP012042.1\|WP_004529784.1\|2040170_2041184_+\|low-specificity-L-threonine-aldolase	gnl\|CDD\|236710	PRK10534, PRK10534, L-threonine aldolase; Provisional.	5.43517e-164
NZ_CP012042.1\|WP_004529796.1\|2057161_2057989_+\|ABC-transporter-permease-subunit	gnl\|CDD\|223629	COG0555, CysU, ABC-type sulfate transport system, permease component [Posttranslational modification, protein turnover, chaperones].	6.35769e-29
NZ_CP012042.1\|WP_004202259.1\|2056062_2057151_+\|extracellular-solute-binding-protein	gnl\|CDD\|270267	cd13549, PBP2_Fbp_like_3, Substrate binding domain of an uncharacterized ferric iron transporter, a member of the type 2 periplasmic binding fold superfamily. The periplasmic iron binding protein plays an essential role in the iron uptake pathway of Gram-negative pathogenic bacteria from the Pasteurellaceae and Neisseriaceae families and is critical for survival of these pathogens within the host. This periplasmic domain (Fbp) has high affinity for ferric iron and serves as the primary receptor for transport. After binding iron with high affinity, Fbp interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The ferric iron-binding proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	7.6244e-122
NZ_CP012042.1\|WP_004537019.1\|2035615_2035783_-\|hypothetical-protein	gnl\|CDD\|176167	cd08478, PBP2_CrgA, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA, contains the type 2 periplasmic binding domain. This CD represents the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	5.27283e-11
NZ_CP012042.1\|WP_004523486.1\|2047801_2048728_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|226928	COG4558, ChuT, ABC-type hemin transport system, periplasmic component [Inorganic ion transport and metabolism].	1.0379e-76
NZ_CP012042.1\|WP_004533856.1\|2054992_2056036_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226361	COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism].	1.24667e-119
NZ_CP012042.1\|WP_004523490.1\|2041152_2042130_-\|ArgP/LysG-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|237357	PRK13348, PRK13348, HTH-type transcriptional regulator ArgP.	1.128e-151
NZ_CP012042.1\|WP_004188492.1\|2045117_2045936_-\|heme-ABC-transporter-ATP-binding-protein	gnl\|CDD\|184132	PRK13547, hmuV, heme ABC transporter ATP-binding protein.	1.28978e-151
NZ_CP012042.1\|WP_004523487.1\|2046339_2047461_-\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	5.01803e-77
NZ_CP012042.1\|WP_009975129.1\|2048724_2049876_-\|hemin-degrading-factor	gnl\|CDD\|226243	COG3720, HemS, Putative heme degradation protein [Inorganic ion transport and metabolism].	2.26071e-140
NZ_CP012042.1\|WP_004529783.1\|2037119_2038127_-\|cytochrome-d-ubiquinol-oxidase-subunit-II	gnl\|CDD\|376764	pfam02322, Cyt_bd_oxida_II, Cytochrome bd terminal oxidase subunit II. This family consists of cytochrome bd type terminal oxidases that catalyze quinol-dependent, Na+-independent oxygen uptake. Members of this family are integral membrane proteins and contain a protohaem IX centre B558. One member of the family, Klebsiella pneumoniae CydB, is implicated in having an important role in micro-aerobic nitrogen fixation in the enteric bacterium Klebsiella pneumoniae. The family forms an integral functional unit with subunit I, family Bac_Ubq_Cox, pfam01654.	2.03645e-97
NZ_CP012042.1\|WP_004523480.1\|2054139_2054988_+\|ABC-transporter-permease-subunit	gnl\|CDD\|224098	COG1177, PotC, ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism].	1.23088e-42
NZ_CP012042.1\|WP_038726669.1\|2053076_2053973_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|182990	PRK11139, PRK11139, DNA-binding transcriptional activator GcvA; Provisional.	3.7756e-68
NZ_CP012042.1\|WP_004188612.1\|2044460_2045069_+\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	1.98681e-60
NZ_CP012042.1\|WP_004537102.1\|2042306_2044448_+\|PBP1A-family-penicillin-binding-protein	gnl\|CDD\|273955	TIGR02074, Includes:_Penicillin-insensitive_transglycosylase, penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	0
NZ_CP012042.1\|WP_024430682.1\|2049932_2052212_-\|TonB-dependent-hemoglobin/transferrin/lactoferrin-family-receptor	gnl\|CDD\|273808	TIGR01786, hemoglobin-haptoglobin-binding_protein, TonB-dependent hemoglobin/transferrin/lactoferrin receptor family protein. This model represents a family of TonB-dependent outer membrane receptor/transporters acting on iron-containing proteins such as hemoglobin, transferrin and lactoferrin. Two subfamily models with a narrower scope are contained within this model, the heme/hemoglobin receptor family protein model (TIGR01785) and the transferrin/lactoferrin receptor family model (TIGR01776). Accessions which score above trusted to this model while not scoring above trusted to the more specific models are most likely to be hemoglobin transporters. Nearly all of the species containing trusted hits to this model have access to hemoglobin, transferrin or lactoferrin or related proteins in their biological niche. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	3.65501e-123
NZ_CP012042.1\|WP_004188183.1\|2038162_2039575_-\|cytochrome-ubiquinol-oxidase-subunit-I	gnl\|CDD\|376587	pfam01654, Cyt_bd_oxida_I, Cytochrome bd terminal oxidase subunit I. This family are the alternative oxidases found in many bacteria which oxidize ubiquinol and reduce oxygen as part of the electron transport chain. This family is the subunit I of the oxidase E. coli has two copies of the oxidase, bo and bd', both of which are represented here In some nitrogen fixing bacteria, e.g. Klebsiella pneumoniae this oxidase is responsible for removing oxygen in microaerobic conditions, making the oxidase required for nitrogen fixation. This subunit binds a single b-haem, through ligands at His186 and Met393 (using SW:P11026 numbering). In addition His19 is a ligand for the haem b found in subunit II.	0
NZ_CP012042.1\|WP_038732931.1\|2035813_2036209_-\|transcriptional-regulator	gnl\|CDD\|176167	cd08478, PBP2_CrgA, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA, contains the type 2 periplasmic binding domain. This CD represents the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.09103e-45
NZ_CP012042.1\|WP_004523495.1\|2036442_2036637_+\|YqaE/Pmp3-family-membrane-protein	gnl\|CDD\|376592	pfam01679, Pmp3, Proteolipid membrane potential modulator. Pmp3 is an evolutionarily conserved proteolipid in the plasma membrane which, in S. pombe, is transcriptionally regulated by the Spc1 stress MAPK (mitogen-activated protein kinases) pathway. It functions to modulate the membrane potential, particularly to resist high cellular cation concentration. In eukaryotic organisms, stress-activated mitogen-activated protein kinases play crucial roles in transmitting environmental signals that will regulate gene expression for allowing the cell to adapt to cellular stress. Pmp3-like proteins are highly conserved in bacteria, yeast, nematode and plants.	0.00193796

>NZ_CP012042.1|WP_004188492.1|2045117_2045936_-|heme-ABC-transporter-ATP-binding-protein
MLNADHLHVARDGRAILNDLSIRIAPGCVTALLGRNGAGKSTLLGVLAGDLPAGGLARGATVRGGVALNGEPLHAIDAPRLARLRAVLPQASRPAFAFSAREIVLLGRYPHARRAGALTHADGEIASQALALAGATALDARDVTTLSGGELARVQFARVLAQLWPPPGAAQPPRYLLLDEPTAALDLAHQHQLLDTVRRLSRDWNLGVLTIVHDPNLAARHADRIAMLADGAIVAQGAPADVLRPEPIARCYGFRVRLVDAGDGVAPVIVPA
>NZ_CP012042.1|WP_004188612.1|2044460_2045069_+|trimeric-intracellular-cation-channel-family-protein
MHTLYLIAIVAEAMSGALMGMQRGMDRFGLALVGAVTALGGGTVRDVLLGRYPLTWVAHPEYLLLTLAAATFASMTATHVARLKSLFTAVDALGLAAFSIIGCDVAAAVNGSPVVIVLAGAITGVCGGMLRDLLCNEMPLVLRKELYASIALLTGGLYVGMKAIGAAQGFATVVALAVGFALRMLAVRRGWRLKAFQAADAG
>NZ_CP012042.1|WP_004537102.1|2042306_2044448_+|PBP1A-family-penicillin-binding-protein
MTDHTPHSSPPASPTPPQGPAPKRRRYFRTLAGLVLGAAIAGGAVGTWTLHRIWTALPSVEPLAVYRPALPLRIFSREGELLAEYGVERREFVPLDRIPPLVRHALLAAEDAQFYTHGAVDIGGLARATVANVVTGQPGQGGSTITMQVARNFFLTREKVLSRKLAEILMSYKLERAYSKDKLLELYMNEIYLGERAYGFAAAASVYFGKPLDALTPGEAAVLAGLPKAPSAFNPVVNPARATMRRNYVLGRMRALGYLDEAAYRQAADAPIALATTPPPGILAAPYVAERARRMMVERFHDDAYTLGLDVTTTIAMREQRAADAALARGLAQVGRRDAKDALEGALVSIDAATGDILALVGGADFSHNVFDHALQAYRQPGSSFKPFVYSAALEKGMFPGVLIDDTQRTLSRDETGANPWRPRNFGNHYEGFIPVRRGLMRSKNLVAVSLMQVARPDFVQQHAARFGFEPLRNPASLPLALGAGSATPLEVASAYGVFANGGVRMEPRLIESVRQRHGGALFDAQPAPGVRVISARNAFVMDSMLRDVVAHGTARRAVALKRADAAGKTGTSNGSKDVWFAGYSSGVVSVVWMGYDAPRSLGRATGSSAALPVWVDYMKTAVDGRGAIERTPPADVALVDGDFVYAEYANGDKCAPSLPPFVRSPFACGAARGAPADGGAPASAAGAAGAPTPAAVDAAERARVLELFRTED
>NZ_CP012042.1|WP_004523490.1|2041152_2042130_-|ArgP/LysG-family-DNA-binding-transcriptional-regulator
MTIDPKQAAALVAVADTGSFEQAAARLHVTASAVTQRVRALEASLGAPLLLRTRPCRPTAAGQRVLQHLRRMALLQVDLQAELEAERGSTIAVAIALNSDSLGSWFLPALTSVLAGERMLFELIVEDQDHTFALLESGMAIGCVTTQSKPMRGCFATPLGTMRYRLIAAEEFAARWFAQGLTRESAREAPVVAHGRRDTLQSSFLRDKLGLPDGAFPCHYVPGTHAHFAAVRHGLGYAMVPELLLGTTPLAEQRLVDLAPAHSTDVSLYWHAWTVQSPKMESLSSRVVEAAQQLLAPPPRGAAAAGGRAAAAPAPVKRANARNTR
>NZ_CP012042.1|WP_004529784.1|2040170_2041184_+|low-specificity-L-threonine-aldolase
MIDLRSDTVTRPSAPMLAAMTAAEVGDDVWGDDPTVARLQAVVAERAGKEAALFFPSGTQSNLAALMSHCERGDEYIVGQAAHTYKYEGGGAAVLGSIQPQPIENAADGTLPLEKIAAAIKPIDDHFARSRLFTLENTIGGKVLPAGYVDEAVALARSRGLAAHLDGARVCNAAVASGRAIAELCAPFDSVSICFSKGLGAPVGSVLVGSGALIERAHRWRKVLGGGMRQAGVLAAACLYALEHNVERLADDHANAERLAQGLARIEPVKVLSQATNMVFAQFPEADCAPLEAWLKERGILTQMLYASRFVTHCDVSRDDIDTAVAAISAYFARSRA
>NZ_CP012042.1|WP_004188183.1|2038162_2039575_-|cytochrome-ubiquinol-oxidase-subunit-I
METAFSALDLARVQFAFTVSFHIVFPALSIGLASFIAVLEYRWLKTGKAYYKSLCLFWSKIFAVAFGMGVVSGVVMAYQFGTNWSGFSSFAGSVTGPLLMYEVMTAFFLEAGFLGIMLFGWNRVSPRAHFGATLMVAIGTLISTFWILASNSWMQTPQGFEIVDGQVVPTDWFAIIFNPSFPYRLAHMAIAAFVVAALVVAATAAWHLLKGRRDKAVKKMFSMSLWLLLVLAPLQAVIGDQHGINTLRHQPAKLAAIEGLWETEPGGTALNLFGIPDMKAQTTRYAVSIPHLGSLILTHSWDGEIRGLKSFPPQDRPNSTVVFWSFRIMVGLGLAMIGLAALAWLLRRRGRLYEAKWFHRFALAMGPTGFVSLLAGWVTTEVGRQPWVVYGVMRTSHAVSPLSTQQVSVSLMTFVVVYFLVFGTGVYYMLKLMRKGPALPGDTPDDAHDARPERTARRPLSAANQLIDAA
>NZ_CP012042.1|WP_004529783.1|2037119_2038127_-|cytochrome-d-ubiquinol-oxidase-subunit-II
MDVTVIWAAIIALGLFMYVVLDGFDLGIGIVFPFFPAEQERDLMMNTVAPVWDGNETWLVLGGAGLFAVFPIVYSTVLSALYLPLVFMLVCLIFRGVSFEIRAKARRTKHLWDLAFIGGSTGATFFQGVALGAFLQGIPVDGGRFAGDAFGWLTPFSLLTGLGLIATYALLGCCWLVAKTEGDLQRRLHRVVWPLTVVLLGFIAVVSLWTPLQDTNIAQRWFATGLFWRLLPVPFLVAGCAVLMRRAVRERHDTTPFALALALVFLGYVGLLASLWPYAIPQSVTLWEAAAPRSSQTFTLIGAAVIIPVILAYTTMGYWVFRGKVRHEDQHYYHH
>NZ_CP012042.1|WP_004523495.1|2036442_2036637_+|YqaE/Pmp3-family-membrane-protein
MRLLLALLLPWLQFFTIGRPFAGIICLILQITLIGWLPAAIWSVYALSQYKTDRKIEEALGRRS
>NZ_CP012042.1|WP_038732931.1|2035813_2036209_-|transcriptional-regulator
MRGYRERFPRVELELNSNEGVIDLLERRTDVAIRIGRLKDSTLHSRLTGNSRLRILASPAYLDAQGRPRKAGDLGKHALLGFNQPESLNVWPTSARTASLAGSSRPCGRRAARRSNSSRSTARASSAGRIS
>NZ_CP012042.1|WP_004537019.1|2035615_2035783_-|hypothetical-protein
MQILARHTQDVRQPIHAVYYRNTAISSRIASFVDYLIDALGGGNAAQKAAAWTRP
>NZ_CP012042.1|WP_004523487.1|2046339_2047461_-|iron-ABC-transporter-permease
MSLAARRHSARPISAERGSTCASRALAALRRRRARWTLAALIAALAAASIAALCIGAYRLSPAQLLGALTATDAQLAGDAALRQARAVLVDIRAPRVVLALFVGAGFGAAGAAMQALFRNPLADPGLIGVSSGAALGASALIVLGPLFAARLALGLLPVAAFAGALAVAALVYRLAVARGRLALPLLLLAGIAINALAGAGIGLLTYLADDAQLRSLTFWSLGSVGGAQWRTIAAVAPFALAGCVLLARERHALNALQLGEAEAMHLGVPVPRVKRRVLVGTAMCVGALVSCTGAIGFIGLVAPHCVRLAAGADQRIVMPGAALFGALLAVAADLAARTLAAPAEIPLGILTALIGAPFFLALLWKRRGALGG
>NZ_CP012042.1|WP_004523486.1|2047801_2048728_-|ABC-transporter-substrate-binding-protein
MSKPARIDARRRAWLAGTGALVFAAAHPGAFARAPASAPPKRVVAIGGALAETIYALGGARTARYELVGTDTTCTYPEAARRLPKVGYQRALSTEGLLSLRPDVVLASAEAGPAAALSQLARAGVAVTTFDEAHDVESVRRKIRGIANALSLQATGDMLLARFDRDWLAARAAADAAPPRGRERTPARVLFVLNHTGNQALVAGQQTAADAMIRYAGAHNAMQGFDRYKPLTAEALVAAAPDVVLITDEGLQAAGGRDALLAAPGFGATPAGRARRVVSLDALFLLGFGPRLPQAVTALQRRLNSVLA
>NZ_CP012042.1|WP_009975129.1|2048724_2049876_-|hemin-degrading-factor
MMNTAAPAASPARALAPDELRDAFLHLKETRKLRNRDVAQLLGVSEGEALAAFAGERVVRLESSFVELFEEMPRLGGVMALTRNAAAVHEKDGAFEQMSHDGPVGLALGAIDLRIFYRNWAAGFAVYEPTAHGVMKSLQFFDAQGDAVHKVYLRKHSDHAAFDAFVSRWRMPVQSPAFAVEPAPPAHVERPDGEIDAAGLRAAWDAMTDTHQFHGVVRRHGVSRTQALRLAGASRAHRVATDAARRVLERAAQTRLPIMVFVGNRGMIQIHTGTVTNIRRMGTWINVLDEDFNLHLREDLVASAWVVRKPTSDGAVTSVELFDAAGDNIAMLFGARKPGQPELAGWRELAGALPRLDTADAADAATVAHAADVPVATDAGAAR
>NZ_CP012042.1|WP_024430682.1|2049932_2052212_-|TonB-dependent-hemoglobin/transferrin/lactoferrin-family-receptor
MARRPLRAALFGAFGLYAAAARAAGPASEPAAAASAASTSQVRHAAIAAARKDAPALDPITVTATRTASAASRTAASVSVITDSDLEEQQADNIKDALRYEPGVTVRRTAYRPANAALGGGRDGDSSINIRGLEGNRVLLMEDGIRLPSAFSFGPLEAGRGDYADLDTLARIEILRGPASALYGSDGLTGAVNFITKDPSDLLSIHRKKTYFSFRPSYDSVDRSIGATVTAAGGNDRVQAMLIASGRRGHELDTHGDDNSASTRRTRANPQDVYTESLLGKLTITPTARDTIKLAAETVRRRIDTNVLSAINPPTTLGLTANDRLERNRFSIDYDLRDAAARGFQTAHVQFYYQESTQDQDAFETRGGRLQSRSRSNHYSERALGGSAFAESGFATGPLAHKLLYGVDGSIDRIKSLREGTVASPGESFPNKAFPDTDYSLFGAFVQDQIGFGKLLVTPGLRFDAYRLSPSSGDPLFTGKTVSSSDHELSPRVAMLYEVSPALIPYAQYAHGFRTPTPDQVNNSFSNPIYGYTSIGNPNLKPETSDTLEAGLRGTLGTGYGPLRYSVAAFAGRYRNFISQRTVGGSGRPNDPLVFQYVNFANARIHGFEGRAEWVMPNGFTLKTAMAFTKGTTQDNGAASEPLDTVNPFSAVFGVRYEPSERWFAQADLLWQAGKRGRDVSSAACQKKTCFTPPSSFVVDLRGGYRFNKHVSAYLGIHNLFDRKYWNWSDVRGIAADSNVLDAYTAPGRSVAVSMKVDF
>NZ_CP012042.1|WP_004188780.1|2052687_2052915_-|hypothetical-protein
MNVQTLSGVLHAQELLFVSLIRVLPLETRQALADEFDRQIQLAETSRLEAPHDREAHDAFLAHVRKLLIRLESMA
>NZ_CP012042.1|WP_038726669.1|2053076_2053973_-|LysR-family-transcriptional-regulator
MKHLYPNVAELHAFASSAKHLNFSYAARELGLTPSAVSRQIASLEALLGVKLFVREGRNLALTRAGQVYQARVAGPLREIGNASLELLSAREDSNLLTIASVPTFTTKWLVPRLPRFLETAPDITLSFRRHLAPGDLFPLGLDAAIRYGDGRWEGVQCDYLDGRTFVPVCAPGFAERHALREPADIAAAPRLVHEQAECAWLAWADRHRATQMNALAGPRFEQYSVLIQAAQAGLGIALIPAFLIRAPLAAGTLVQPLDAPVDVDEQSHYLCYAPERLQASASLRLLREWMLGECACA
>NZ_CP012042.1|WP_004523480.1|2054139_2054988_+|ABC-transporter-permease-subunit
MRSSTTAGFAGGIPFRRGKRRPSFGAIVVNGVVALFALYLLMPIVLLLIGSIGQSWTNTLLPAGFTWRWFAELAADPSLRRAFGVSFVVALACCALDTLAGVPLAYALHHRALRGRGVAARVVMLTPIGVPALTLGFGYIVVFGGDALPWLGTLPLMIAAHAVLTLPYLLQTLLSDLRHLDLAKLEACAATLGAPPLRQFFTIVLPNLRQSLFSGLVMVAALSIGEFQVSNLIAGFRYRNFPVVLLQAFYGASGIACAASVVLLLLAVLATLASTHTVQRLK
>NZ_CP012042.1|WP_004533856.1|2054992_2056036_+|ABC-transporter-ATP-binding-protein
MSLEFDNVSFRYPGGAHGVDAVTLHAQPGELLAVIGRSGSGKSTLLRLSAGLLDGYAGRIAIGGADMAGVPVWRREVGMVFQQYALFPHLSVADNVAYGLRMRGVAAAERRRRALEMLERVGLAAHAARSTTQLSGGQQQRVALARALVIEPALLLLDEPLAALDAGIRHQLRDEIRALQRACRATTLFVTHDQDEALSMADRVAIVDGGRVLQVGTPRSLYERPVSAQVARFIGHSTILRGRVQAGGTIDVRFATLCADTGAHRPGAEVDVLVRPEHVEPDPPAQCVNRIEGALGEVRYFGATHRYDFLPHGAAHPLLCEGRVLAARGVAIEPRHLLVLPASGGAR
>NZ_CP012042.1|WP_004202259.1|2056062_2057151_+|extracellular-solute-binding-protein
MSENRPLLTALRRAALAFGMCATLVANGASAEPLYAGEDALYAKAADEGLVVSFDTGPEWANWKALFAAFRKRYPKVELTYNDIGSAATVVALDKSRRRPQADTAYYFAASALDAAGKDVVAPFKPVNFDKLPPVFREADGRWFTVHSLNVAFLVNRKLVKNVPRRWSDLLKPEYRNAVVYLDPRSTGQGQVVVFAAASALGGGVDDPKPGAEFFGKLKHAGNVLRIEGTTPYAKFVKGEIPILIGYENDGLKAKYADGLGDAVDVVIPQDGSVCAPYAMSLVKNGPNPAAAQLWLNFVMSDAGQALFAHGYVRPAVPGVALAPDVAAKMPNAPQVRALDVAKAAARKAEVDRLWSQAALGQ
>NZ_CP012042.1|WP_004529796.1|2057161_2057989_+|ABC-transporter-permease-subunit
MQRSFLERSLLRRFGAAPAGGLLALFFVLPLAALVSAAFAEGGRAFAAVLHDPLVGDAIGRSLALAVGTGTLSTCVGVPLALSFAEQPPARRRWLLALLGVPLAFSGLVIAYGFILTFGRAGFVTTLLAGLGADAAKVGGVIYTTFGLVVAYAYYLIPRVALMLFPAFANLERRPLEAAMSLGAKPWRAWLDVAWRELWPSVMAAWCLVTAIALGTYGTALALAGTQINILPLLMYLKLSDGQTDFSQAAVLSIVLTALCTCVLAMGEYVGRRHR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP012042_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012042_4

3107612-3107776

Orphan

Consensus_repeat	Method
GCGAGCGCGGCGAGCGCGGCCGCG	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP012042_4

>merge|NZ_CP012042|4|3107612-3107776|PILER-CR
GCGAGCGCGGCGAGCGCGGCGGACAGGCCGCTCGCGACATAGCTCGACGCGACGTAGCGGCGCGCGTCGACGCCCGCGGCGAGCGCGGCCGCGCGATGGGCGCCGAGCGCGTGCAGCGCGAGCCCGTAACGGGTGCGATGGGCGAGCGCGGCGAGCACGGCCGCG

>NZ_CP012042|4|1|3107612-3107776|PILER-CR
GCGAGCGCGGCGAGCGCGGCGGAC	AGGCCGCTCGCGACATAGCTCGACGCGACGTAGCGGCGCGCGTCGACGCCCGCG
GCGAGCGCGGCCGCGCGATGGGCG	CCGAGCGCGTGCAGCGCGAGCCCGTAACGGGTGCGATGGGCGAGCGCG
GCGAGCACGGCCGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012042.1\|WP_004197868.1\|3119444_3120134_-\|heavy-metal-response-regulator-transcription-factor-IrlR	unknown	unknown	gnl\|CDD\|130454
NZ_CP012042.1\|WP_004524116.1\|3101815_3102325_+\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|171561
NZ_CP012042.1\|WP_060547782.1\|3096767_3097763_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197666
NZ_CP012042.1\|WP_028358983.1\|3117665_3117938_+\|DUF4148-domain-containing-protein	unknown	unknown	gnl\|CDD\|379321
NZ_CP012042.1\|WP_011205506.1\|3102321_3103326_+\|FecR-family-protein	unknown	unknown	gnl\|CDD\|236622
NZ_CP012042.1\|WP_004199294.1\|3098632_3099154_+\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|237123
NZ_CP012042.1\|WP_060547784.1\|3103452_3106137_+\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|273805
NZ_CP012042.1\|WP_028358984.1\|3110248_3111259_-\|sugar-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380528
NZ_CP012042.1\|WP_004528275.1\|3099150_3099975_+\|anti-sigma-factor	unknown	unknown	gnl\|CDD\|227949
NZ_CP012042.1\|WP_004549393.1\|3114897_3116367_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340929
NZ_CP012042.1\|WP_060547783.1\|3101314_3101542_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012042.1\|WP_060547781.1\|3095887_3096592_-\|fumarylacetoacetate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223257
NZ_CP012042.1\|WP_060547785.1\|3106355_3107336_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119321
NZ_CP012042.1\|WP_038803101.1\|3111321_3111819_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012042.1\|WP_060547786.1\|3108410_3110252_-\|sugar-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224053
NZ_CP012042.1\|WP_004198472.1\|3116784_3117033_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012042.1\|WP_041195455.1\|3113006_3113258_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012042.1\|WP_004528277.1\|3100958_3101318_+\|lipoprotein	unknown	unknown	gnl\|CDD\|226765
NZ_CP012042.1\|WP_004184766.1\|3118053_3119448_-\|heavy-metal-sensor-histidine-kinase-IrlS	unknown	unknown	gnl\|CDD\|273593
NZ_CP012042.1\|WP_004206353.1\|3111977_3112670_+\|isoprenylcysteine-carboxylmethyltransferase-family-protein	unknown	unknown	gnl\|CDD\|224931

Protein	Function_ID	Function_description	E-value
NZ_CP012042.1\|WP_004197868.1\|3119444_3120134_-\|heavy-metal-response-regulator-transcription-factor-IrlR	gnl\|CDD\|130454	TIGR01387, Transcriptional_regulatory_protein_PcoR, heavy metal response regulator. Members of this family contain a response regulator receiver domain (pfam00072) and an associated transcriptional regulatory region (pfam00486). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc. Most members encoded by genes adjacent to genes for encoding a member of the heavy metal sensor histidine kinase family (TIGRFAMs:TIGR01386), its partner in the two-component response regulator system. [Regulatory functions, DNA interactions].	2.40938e-111
NZ_CP012042.1\|WP_004524116.1\|3101815_3102325_+\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|171561	PRK12528, PRK12528, RNA polymerase sigma factor; Provisional.	7.12237e-71
NZ_CP012042.1\|WP_060547782.1\|3096767_3097763_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|197666	smart00342, HTH_ARAC, helix_turn_helix, arabinose operon control protein.	5.91253e-24
NZ_CP012042.1\|WP_028358983.1\|3117665_3117938_+\|DUF4148-domain-containing-protein	gnl\|CDD\|379321	pfam13663, DUF4148, Domain of unknown function (DUF4148).	5.60207e-08
NZ_CP012042.1\|WP_011205506.1\|3102321_3103326_+\|FecR-family-protein	gnl\|CDD\|236622	PRK09774, PRK09774, fec operon regulator FecR; Reviewed.	1.59756e-74
NZ_CP012042.1\|WP_004199294.1\|3098632_3099154_+\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|237123	PRK12511, PRK12511, RNA polymerase sigma factor; Provisional.	2.21088e-40
NZ_CP012042.1\|WP_060547784.1\|3103452_3106137_+\|TonB-dependent-receptor	gnl\|CDD\|273805	TIGR01783, Ferrienterobactin_receptor, TonB-dependent siderophore receptor. This subfamily model encompasses a wide variety of TonB-dependent outer membrane siderophore receptors. It has no overlap with TonB receptors known to transport other substances, but is likely incomplete due to lack of characterizations. It is likely that genuine siderophore receptors will be identified which score below the noise cutoff to this model at which point the model should be updated. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	1.40234e-86
NZ_CP012042.1\|WP_028358984.1\|3110248_3111259_-\|sugar-ABC-transporter-substrate-binding-protein	gnl\|CDD\|380528	cd06305, PBP1_methylthioribose_binding-like, similar to methylthioribose-binding protein of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type 1 periplasmic binding protein (PBP1) superfamily. Proteins similar to methylthioribose-binding protein of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type 1 periplasmic binding protein (PBP1) superfamily, which consists of two alpha/beta globular domains connected by a three-stranded hinge. This Venus flytrap-like domain undergoes transition from an open to a closed conformational state upon ligand binding. The sugar-binding domain of the periplasmic proteins in this group is also homologous to the ligand-binding domain of eukaryotic receptors such as metabotropic glutamate receptor (mGluR), DNA-binding transcriptional repressors such as LacI and GalR.	6.09776e-121
NZ_CP012042.1\|WP_004528275.1\|3099150_3099975_+\|anti-sigma-factor	gnl\|CDD\|227949	COG5662, COG5662, Predicted transmembrane transcriptional regulator (anti-sigma factor) [Transcription].	1.07062e-18
NZ_CP012042.1\|WP_004549393.1\|3114897_3116367_-\|MFS-transporter	gnl\|CDD\|340929	cd17371, MFS_MucK, Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.06027e-36
NZ_CP012042.1\|WP_060547781.1\|3095887_3096592_-\|fumarylacetoacetate-hydrolase-family-protein	gnl\|CDD\|223257	COG0179, MhpD, 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Secondary metabolites biosynthesis, transport, and catabolism].	1.66688e-87
NZ_CP012042.1\|WP_060547785.1\|3106355_3107336_-\|ABC-transporter-permease	gnl\|CDD\|119321	cd06579, TM_PBP1_transp_AraH_like, Transmembrane subunit (TM) of Escherichia coli AraH and related proteins. E. coli AraH is the TM of a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of the monosaccharide arabinose. This group also contains E. coli RbsC, AlsC, and MglC, which are TMs of other monosaccharide transporters, the ribose transporter, the D-allose transporter and the galactose transporter, respectively. The D-allose transporter may also be involved in low affinity ribose transport. These transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. Proteins in this subgroup have a single TM which homodimerizes to generate the transmembrane pore.	1.49178e-52
NZ_CP012042.1\|WP_060547786.1\|3108410_3110252_-\|sugar-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224053	COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism].	4.20485e-174
NZ_CP012042.1\|WP_004184766.1\|3118053_3119448_-\|heavy-metal-sensor-histidine-kinase-IrlS	gnl\|CDD\|273593	TIGR01386, Probable_sensor_protein_PcoS, heavy metal sensor kinase. Members of this family contain a sensor histidine kinase domain (pfam00512) and a domain found in bacterial signal proteins (pfam00672). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc.	0
NZ_CP012042.1\|WP_004528277.1\|3100958_3101318_+\|lipoprotein	gnl\|CDD\|226765	COG4315, COG4315, Uncharacterized protein conserved in bacteria [Function unknown].	2.7211e-31
NZ_CP012042.1\|WP_004206353.1\|3111977_3112670_+\|isoprenylcysteine-carboxylmethyltransferase-family-protein	gnl\|CDD\|224931	COG2020, STE14, Putative protein-S-isoprenylcysteine methyltransferase [Posttranslational modification, protein turnover, chaperones].	8.15398e-14

>NZ_CP012042.1|WP_060547785.1|3106355_3107336_-|ABC-transporter-permease
MRDATDRLSRFAALGALAAVLAFFAVAAPGFATLANVERVLVNNFALLAIAALGMTLALSIGAIDLSLGTAIDVASLAFVCALAHRAGCASAALAGLGAALALGAANALLVTRLGIAPFLATLGTLFIGQTIQQLATDGGQPIYLLSTAPPPAFDALAHGVWLGVAAPLWIVAALAGALHVALERSTLGRQARALGAQPGVARHSGLRVGALAAGVFVASALVYGVAGLVLSSTVRSYAPQAGNAYLLNAIGATFIGATLSEARRPNVAGTLLGVLLVSFVANGLLLIGWNFYWQQVASGALVFAALALGSGVGRERRARDAGQSG
>NZ_CP012042.1|WP_060547784.1|3103452_3106137_+|TonB-dependent-receptor
MDSICNRRPRRAHAGVCADTANAPAGLPEAAQPAARLGAGRPRDAAAPRCARQATSHTSHTSHTSHASHASHTLHAPCMPQFAPQFAPRRVAARVAAAALFSACAAPGVSGAAEPAAATRGYDIPAGPLDAALTRFGREAGILLSFPGELTTGLRSPGLHGRADPAAALDRLLTGTGLVALRQPSGGYTLARLPGPAAAGADAALAADTTLPTVAVRASGPHADSYRPPREAAGLRSDAPLAEVPQAVAIVAQQVLRDQRPRNLDDALANVSGITQGNTLGSTQDTVMKRGFGDNRDGSVMRNGMPIVQGRSLNATTDSVEVLKGPASLLYGIMDPGGVINVVTKQPQLARRHAISALGSTYGGGRNGGELTFDSTGAIGESRVAYRLIVDQTNEQYWRNYGEHRETLVAPSLAWYGRDTQVVLSYEYRRFLMPFDRGTALDPRTNAPLAIPARRRLDEPFNDMRGESNLAQLAIDHQLAPDWKVHVGYSYNRETYDANQIRITAVDPLKGTLTRSNDATHGSRSTDSYGIAYVDGRVTLAGRRHDVQFGVDGEYRQVYRADMLRQPIKTPFSYLNPTYGLVPPSTSVSASDSDQSDTLHTASLFFQDSIHLSERWMLVGGARWVRYSQLAGRGRPFQVNTNLSGTKWLPRAGIVYKWNDALSLYGSYTQSLKPTSKIAPMAGGYVIDGSTAPEEGASWELGAKLDMPGGLAGTLAFFDIDKKHVLVSQYDDATNQTAWRTSGRARSRGIELDVSGRIGARWNVIASYAYIDAKTTEDPLYAGNRLWNVARHTASLAAVYDVGTVLGGDDLRIGAAGRYVGARPGDSANSFTLPAYATADAFATYDTRLGKQKLQFQLNVKNLFNRTYYPSSVNRFFVSVGDARQVSLLTTLQF
>NZ_CP012042.1|WP_011205506.1|3102321_3103326_+|FecR-family-protein
MSGAKPAGGPPAVPERVARRAVQWWVELGAAPASDATRARLARWRAEHPAHDAAWRHIEAVNGRLGHVASALSARAARAALLPPRSRGRRAALKALAVLLFAGGGAWTGQAYLPWRAWGADVRTALGERRTITLADGTTVVLNTDTAIDIRFDDATRGVRLLRGEIMVTSGRDAARAVPRALVIATAHGDVRPVGTRFSVRERGDATRVDVFDGAVRIAPRRAAGRAPLITAGHGADFTRDALAGPPRVLGASAGAWVDGILVASDLRLADLLAEIDRYRPGRVRCDAAVANLRVSGTYPLDDTDRILDTLRETLPVDVEYLSRYWVTVVAARD
>NZ_CP012042.1|WP_004524116.1|3101815_3102325_+|sigma-70-family-RNA-polymerase-sigma-factor
MPANTLRLQREIAALYTGHRGWLHGWLSKKLGCGERAADLVHDTFIRLLARDEPIDAAEPRAFLTTVAQRVLYNHWRRERLERAYLDALAQWPEAVAPSPETRAVLFETLVEVDRMLDGLPAVVRRAFLLAQLDGMTHAQIAAELRVSLATVKRYLVKAGAQCYFAIAA
>NZ_CP012042.1|WP_060547783.1|3101314_3101542_+|hypothetical-protein
MTGKGGAAANPRAAMAIVVAASGSISPASRRTALSTMKTTANATARRRDGGTMKAPKEPIASGGAVLAGSVESPV
>NZ_CP012042.1|WP_004528277.1|3100958_3101318_+|lipoprotein
MIRNVLIALVCAAPVAALAEPPKAAGGMIVDDDGMTLYTFDRDTMPGKSACTGGCTANWPAALADAYDKPGGDLGFIAAAGGKHQWTYKGRPLYRFSGDAKPGQHTGDGFGGMWHVARP
>NZ_CP012042.1|WP_004528275.1|3099150_3099975_+|anti-sigma-factor
MSDDPDLCVAPESDEPGLLALSAFVDGELPDAQSRAMARRLASDPRAAGIAAHYRAQRAALRALFADPVAPRHGPCVAWPVRTPWWRRAAFAGGALAAGVALGWLGGALAPRFAPSAALQWVAPAAAQRAFARDADLAYALYAPDARHPVEIAAGRDGAPLAWLSARVGRRIAAPSLREYGFALLGARLLPGAGGPAAQFMYENAAGERLALYVSASAQREAAVRPWRDGGRHTFYWVSERTAYALSGQLDEGRLRTIAADVCGELGGHPQRWR
>NZ_CP012042.1|WP_004199294.1|3098632_3099154_+|sigma-70-family-RNA-polymerase-sigma-factor
MSFESDVVGWLPQLRRYARALTGDPAWADDLVQDTVERAFSRMRAFRPDSNLRAWLLTILRHLYIDQLRARREFAVDDDEGPWRTLEAPAGQIDALVLRDVQRMLYRLPLEQREVLLLVCVEELSYQDASAVLGVPVGTVMSRLSRARERMRALLTDAPLRPPLSLTAARHHR
>NZ_CP012042.1|WP_060547782.1|3096767_3097763_-|AraC-family-transcriptional-regulator
MPERSDRLDFYIRDEAARRAITEPHRHAYFQIQFNLGGNTEQRIGGFTRAFPRGALAFVLPYREHLIAHPPGAHFVVINFSQTFLRADLDVDPLDLEDVCAQRAPELAPFRFQEHLDFILTGAAFDDARRLAQRMLEANRARTFGSVPLLRGYLLQLIGLVCTQYAGPLTKLAQSGAHRTGRRDAFARVLRHVRANLTNDALTLAGTARAACLSPNYLAHLIRKETGSTFTDLVTARRIALAQSLLAHTTRRIADIAHAVGFRDEGYFSRRFRACVGVSPKEYRDANGAPGPADALDSVDTAGPRAAPGGGETRGAAGAKSPARAAAKPRA
>NZ_CP012042.1|WP_060547781.1|3095887_3096592_-|fumarylacetoacetate-hydrolase-family-protein
MTDYVFAPPAVPSVEIAGCAARFAVRRVFCVGRNYADHAREMGADPNREPPFFFTKPADAIVPASGTVPYPTLTSELHHEIELVIAIGRGGRAIAADAALDHVWGYGVGVDLTRRDLQAEAKKAGRPWDWAKGFDASGPVTALHPAVSIGHPQRGRIWLAVNGALRQQGDLADMIWPIPDVIAYASRAVELRAGDLIFTGTPAGVAALQPGERVTGGVDGVASFEFVVGEKPAA
>NZ_CP012042.1|WP_060547786.1|3108410_3110252_-|sugar-ABC-transporter-ATP-binding-protein
MKAALTTAAASAPAAPDAAGAPLALDVRRVVKRFGGVAALRGASLAVTRGTVHGLIGQNGAGKSTLVKLLAGLHAPDEGEITVGGVPFASGGGGSRASAGAARRHSTGIGFIHQERLLPATFTVAEALFFPHPPTLGGRASRLARLLPLDVKRMRRDCRAVLHTQFGLDLAPDRLIGELSVAEQQIVQITRALLGRHEILVFDEPSAALVSSEVDRLLRTIERLRANGHTILYVSHYLDEIARVCDRVSVLRDGADVAHFEARAVSRDTLVAAMIGAPQPAAAAPSAATARATARADARADARADARVSARADAWGDDPHRAPAGADPARRGARAAPGAIALEARDLALPGRFGPLSLAVRRGEIVGLTGGLGSGGKDVIRALFGLARGVRGSIAVDGRPARVRRPHDAVAHGIALVPENRAAHGVALTLPVRENVVLADLSSVSRFGLVHGRREADVARALIRRLDIRPARADLPARFLSGGNQQKVALAKWLGRASTVYLLDEPTVGVDVGAKAQIYRLIDALARAGAAVLLFSSDLTELLDVTDRVYVMARGEIVAQCASAETTTRDVLAWATLARDARPGGGAGAHDAAARTGTPGAAGAASSAAKVAT
>NZ_CP012042.1|WP_028358984.1|3110248_3111259_-|sugar-ABC-transporter-substrate-binding-protein
MLFAVALAIGAAPACASPAAGAAPPGPRAGHAPLSLAGKRIGITAAGTDHYWDLQAYQGAVDEVKRLGGTPIALDAGRNDSRQIAQIQTLIAQQPDAIIEQLGTASVLEPWLRKIRQAGIPLFTIDTASPSSLNVVTSDNFAIGSQLALKLVNDIRGEGNVLVFNGFYGVPVCAIRYDQLKAVLKWYPKVKIIEPELRDVIPNTAQNAYAQISQLLQKYPKGAISAIWAAWDIPQVGATQAVDAAGRREIRTYAVDGSPEAVALVRNPTSSAAAVVAQQPALIGRTAVRNVARYLAGDRSLPAYTFVPSVLVTKDDAGVARPALGRAPAAAGLARR
>NZ_CP012042.1|WP_038803101.1|3111321_3111819_+|hypothetical-protein
MEANERFCATTPAKGTIDSCFGYGMAANARAAQAKMRGGNRTRPARALAGPAASRASMPTPISVGTRDRRRVVSIGIGQSQINFSAMLNKPDDAPLNRKRLIAGQSENAAARAASNETKSSRKRSARAKFRAGMLENPYEGPPRRMIRRGGGAARFDGDFANGCI
>NZ_CP012042.1|WP_004206353.1|3111977_3112670_+|isoprenylcysteine-carboxylmethyltransferase-family-protein
MATTRRHATATALAAAARPCAAPHADSFLGILIEVFARVVAALALGVFAYAAYLQWRLDPSRITLILLAVSTTLTVGLSLFAEPPKKRDWSPLALFFSVGGTFYYLVFQLTASRQLLPEAAGAAIQLIGLFWQLFAKVSLRKSFGILPANRGIVSRGAYRFVRHPMYLGYLIIDAGFLLTNFSARNLIAVALQIGLQLGRIRREERLLSEDAAYRAYRRSVRYRVIPGLF
>NZ_CP012042.1|WP_041195455.1|3113006_3113258_-|hypothetical-protein
MFSTLSHVLPRVVLLGEPLANAPFVDGEITRPFRDGFWLLPHSTLCLPLAASDTVIVEPDRPGSAGALAGRQLDAGRQSPSPL
>NZ_CP012042.1|WP_004549393.1|3114897_3116367_-|MFS-transporter
MSTLDLDAPISTPIRTASDVSRLINASGARANHARVIVLLALGGVFLDAYDLTTLSYGIEDVTREFGLTPALSGLVSASIMIGTILGSLLGGWFTDKVGRYRVFMADMLCFVVAAIVAGLAPNVEVLIAARFVMGLGVGIDLPVAMAFLAEFSKFGGRGNKASRLAAWCPMWYAASSVCFLIVFGLYFALPAEHARWLWRASLIFGAVPALAIIAVRGRYMNESPLWAANQGKLRDAARILRESYGIRAHAADDTPRAAPSQPPVSFRVLFRQPYLPRTLVASAMNLCIPFEYTAIAFFLPTILTQFLGAGVFETIAATLALNVLFALTGGLLGMRLAYRLPSRRVAIAGFALQAAALVTLALLGHPQTALGIGAAVLMLGLWLFAEGFGPGAQMMIYPALSYPASIRGTGLGFGRALTGIGSAFALFVLPILNARLGAGMFWIVAIAAFVPIVFLAAIRFEPTARDVDVDIDAGPRAQGDRARVRAAA
>NZ_CP012042.1|WP_004198472.1|3116784_3117033_-|hypothetical-protein
MKAPIIAIAFGIALAACAPLRQDSRPGEAGPPIAAPNRGGGNTPPSGARRAANEVVDYAGRPCVNQTLYVKTHPCIFPRLQR
>NZ_CP012042.1|WP_028358983.1|3117665_3117938_+|DUF4148-domain-containing-protein
MNTKTAIVWATAAALTALALSPAAFAQGKTRDEVRQELIRAQHEGVVPAGKNDYPPSAALVARNKELHAISVHGGKTDLALDQHDQTVAR
>NZ_CP012042.1|WP_004184766.1|3118053_3119448_-|heavy-metal-sensor-histidine-kinase-IrlS
MIRRLLPRTLRARLTALIILSTAATLALSGVALYSALHNRLVGMSSYEMSATLAAMRTHLANVANVDDIPRKSDLWIDQLHGHQNLDLAIYDTDGRLRFATRGFVAPRPALGAPQTRVPASAAPAGATFSYLADDAPLRGGNPRTARIVVQYDGKNDHALLRAYAYTVVVIEVLAVVLTAALAYGIAMLGLSPLRRLVARAEQMSSSRLAQPLPELDTSGELKEMEHAFNAMLKRLDESFVRLSQFSSNLAHDMRTPLTNLLAEAQVALSKPRTADEYRDVIESSIDEYQRLSRMIEDMLFLARSDNAQSHLAIRTLDAAAQAERVAGYYEPMAEDAEVSIVVRGKAEVRADALLYHRALSNLISNALNHAPRGSTITIECAQAADAATISVSDTGRGIEAPHRERIFERFYRVDPARHNSASGTGLGLAIVRSIMENHGGTCGVDSEPHVRTTFWLKFPAHAA
>NZ_CP012042.1|WP_004197868.1|3119444_3120134_-|heavy-metal-response-regulator-transcription-factor-IrlR
MRILIVEDEPKTGMYLRKGLTEAGFIADWVEDGVTGLHQAETEEYDLIILDVMLPGHDGWTVLERLRRAHSTPVLFLTARDDVGDRVKGLELGADDYVVKPFDFVELVARVRSILRRGQARESTVLRIADLELDLTRRKATRQGDVVLLTAKEFALLWLLMRREGEILPRATIASQVWDMNFNSDTNVVDAAIRRLRSKIDDAYEPKLIHTVRGMGYVLEVRSASAPSR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP012042_3	3.2\|2046094\|29\|NZ_CP012042\|CRISPRCasFinder	2046094-2046122	29	NZ_CP012042.1	2046130-2046158	1	0.966

1. spacer 3.2|2046094|29|NZ_CP012042|CRISPRCasFinder matches to position: 2046130-2046158, mismatch: 1, identity: 0.966

aggactcgaaggactcgaaggactcgaag	CRISPR spacer
aggactcgaaggactcgaaggacccgaag	Protospacer
***********************.*****

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP012042_3	3.1\|2046033\|27\|NZ_CP012042\|CRISPRCasFinder	2046033-2046059	27	MK799832	Synechococcus phage S-B05, complete genome	67571-67597	4	0.852
NZ_CP012042_3	3.2\|2046094\|29\|NZ_CP012042\|CRISPRCasFinder	2046094-2046122	29	NC_023694	Rhodococcus phage ReqiPoco6, complete genome	23753-23781	5	0.828
NZ_CP012042_3	3.2\|2046094\|29\|NZ_CP012042\|CRISPRCasFinder	2046094-2046122	29	MF541410	Streptomyces phage Ozzie, complete genome	29321-29349	5	0.828
NZ_CP012042_3	3.2\|2046094\|29\|NZ_CP012042\|CRISPRCasFinder	2046094-2046122	29	MF541407	Streptomyces phage Esperer, complete genome	29157-29185	5	0.828
NZ_CP012042_3	3.2\|2046094\|29\|NZ_CP012042\|CRISPRCasFinder	2046094-2046122	29	MF541403	Streptomyces phage BeardedLady, complete genome	29591-29619	5	0.828
NZ_CP012042_3	3.2\|2046094\|29\|NZ_CP012042\|CRISPRCasFinder	2046094-2046122	29	MN586009	Streptomyces phage Phettuccine, complete genome	29337-29365	5	0.828
NZ_CP012042_3	3.2\|2046094\|29\|NZ_CP012042\|CRISPRCasFinder	2046094-2046122	29	MN096375	Streptomyces phage Leviticus, complete genome	29341-29369	5	0.828
NZ_CP012042_3	3.2\|2046094\|29\|NZ_CP012042\|CRISPRCasFinder	2046094-2046122	29	MK433270	Streptomyces phage Bovely, complete genome	29344-29372	5	0.828
NZ_CP012042_3	3.2\|2046094\|29\|NZ_CP012042\|CRISPRCasFinder	2046094-2046122	29	NC_028892	Streptomyces phage Caliburn, complete genome	29321-29349	5	0.828
NZ_CP012042_3	3.2\|2046094\|29\|NZ_CP012042\|CRISPRCasFinder	2046094-2046122	29	MK433271	Streptomyces phage Indigo, complete genome	29337-29365	5	0.828
NZ_CP012042_3	3.2\|2046094\|29\|NZ_CP012042\|CRISPRCasFinder	2046094-2046122	29	NC_042051	Streptomyces phage Aaronocolus, complete genome	29338-29366	5	0.828
NZ_CP012042_3	3.2\|2046094\|29\|NZ_CP012042\|CRISPRCasFinder	2046094-2046122	29	MK433278	Streptomyces phage Nerdos, complete genome	29336-29364	5	0.828
NZ_CP012042_3	3.2\|2046094\|29\|NZ_CP012042\|CRISPRCasFinder	2046094-2046122	29	KT124229	Streptomyces phage Hydra, complete genome	29869-29897	5	0.828
NZ_CP012042_3	3.2\|2046094\|29\|NZ_CP012042\|CRISPRCasFinder	2046094-2046122	29	KX507345	Streptomyces phage Brataylor, complete genome	30656-30684	5	0.828
NZ_CP012042_3	3.2\|2046094\|29\|NZ_CP012042\|CRISPRCasFinder	2046094-2046122	29	MN694213	Marine virus AFVG_250M687, complete genome	362-390	5	0.828
NZ_CP012042_3	3.2\|2046094\|29\|NZ_CP012042\|CRISPRCasFinder	2046094-2046122	29	MN694213	Marine virus AFVG_250M687, complete genome	34955-34983	5	0.828
NZ_CP012042_3	3.2\|2046094\|29\|NZ_CP012042\|CRISPRCasFinder	2046094-2046122	29	NZ_CP022264	Xanthomonas citri pv. vignicola strain CFBP7111 plasmid plA, complete sequence	32313-32341	6	0.793
NZ_CP012042_3	3.2\|2046094\|29\|NZ_CP012042\|CRISPRCasFinder	2046094-2046122	29	NZ_CP011665	Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence	437861-437889	7	0.759

1. spacer 3.1|2046033|27|NZ_CP012042|CRISPRCasFinder matches to MK799832 (Synechococcus phage S-B05, complete genome) position: , mismatch: 4, identity: 0.852

tgaactcgatgagtcagatgagttcga	CRISPR spacer
ccaactcgatgagtcagaggagtttga	Protospacer
. **************** *****.**

2. spacer 3.2|2046094|29|NZ_CP012042|CRISPRCasFinder matches to NC_023694 (Rhodococcus phage ReqiPoco6, complete genome) position: , mismatch: 5, identity: 0.828

aggactcgaaggactcgaaggactcgaag	CRISPR spacer
aggactcgaaggattcgaaagactcgtcc	Protospacer
*************.*****.******

3. spacer 3.2|2046094|29|NZ_CP012042|CRISPRCasFinder matches to MF541410 (Streptomyces phage Ozzie, complete genome) position: , mismatch: 5, identity: 0.828

aggactcgaaggactcgaaggactcgaag	CRISPR spacer
cggactcgttggactcgaaggactcggac	Protospacer
 *******  ****************.*

4. spacer 3.2|2046094|29|NZ_CP012042|CRISPRCasFinder matches to MF541407 (Streptomyces phage Esperer, complete genome) position: , mismatch: 5, identity: 0.828

aggactcgaaggactcgaaggactcgaag	CRISPR spacer
cggactcgttggactcgaaggactcggac	Protospacer
 *******  ****************.*

5. spacer 3.2|2046094|29|NZ_CP012042|CRISPRCasFinder matches to MF541403 (Streptomyces phage BeardedLady, complete genome) position: , mismatch: 5, identity: 0.828

aggactcgaaggactcgaaggactcgaag	CRISPR spacer
cggactcgttggactcgaaggactcggac	Protospacer
 *******  ****************.*

6. spacer 3.2|2046094|29|NZ_CP012042|CRISPRCasFinder matches to MN586009 (Streptomyces phage Phettuccine, complete genome) position: , mismatch: 5, identity: 0.828

aggactcgaaggactcgaaggactcgaag	CRISPR spacer
cggactcgttggactcgaaggactcggac	Protospacer
 *******  ****************.*

7. spacer 3.2|2046094|29|NZ_CP012042|CRISPRCasFinder matches to MN096375 (Streptomyces phage Leviticus, complete genome) position: , mismatch: 5, identity: 0.828

aggactcgaaggactcgaaggactcgaag	CRISPR spacer
cggactcgttggactcgaaggactcggac	Protospacer
 *******  ****************.*

8. spacer 3.2|2046094|29|NZ_CP012042|CRISPRCasFinder matches to MK433270 (Streptomyces phage Bovely, complete genome) position: , mismatch: 5, identity: 0.828

aggactcgaaggactcgaaggactcgaag	CRISPR spacer
cggactcgttggactcgaaggactcggac	Protospacer
 *******  ****************.*

9. spacer 3.2|2046094|29|NZ_CP012042|CRISPRCasFinder matches to NC_028892 (Streptomyces phage Caliburn, complete genome) position: , mismatch: 5, identity: 0.828

aggactcgaaggactcgaaggactcgaag	CRISPR spacer
cggactcgttggactcgaaggactcggac	Protospacer
 *******  ****************.*

10. spacer 3.2|2046094|29|NZ_CP012042|CRISPRCasFinder matches to MK433271 (Streptomyces phage Indigo, complete genome) position: , mismatch: 5, identity: 0.828

aggactcgaaggactcgaaggactcgaag	CRISPR spacer
cggactcgttggactcgaaggactcggac	Protospacer
 *******  ****************.*

11. spacer 3.2|2046094|29|NZ_CP012042|CRISPRCasFinder matches to NC_042051 (Streptomyces phage Aaronocolus, complete genome) position: , mismatch: 5, identity: 0.828

aggactcgaaggactcgaaggactcgaag	CRISPR spacer
cggactcgttggactcgaaggactcggac	Protospacer
 *******  ****************.*

12. spacer 3.2|2046094|29|NZ_CP012042|CRISPRCasFinder matches to MK433278 (Streptomyces phage Nerdos, complete genome) position: , mismatch: 5, identity: 0.828

aggactcgaaggactcgaaggactcgaag	CRISPR spacer
cggactcgttggactcgaaggactcggac	Protospacer
 *******  ****************.*

13. spacer 3.2|2046094|29|NZ_CP012042|CRISPRCasFinder matches to KT124229 (Streptomyces phage Hydra, complete genome) position: , mismatch: 5, identity: 0.828

aggactcgaaggactcgaaggactcgaag	CRISPR spacer
cggactcgttggactcgaaggactcggac	Protospacer
 *******  ****************.*

14. spacer 3.2|2046094|29|NZ_CP012042|CRISPRCasFinder matches to KX507345 (Streptomyces phage Brataylor, complete genome) position: , mismatch: 5, identity: 0.828

aggactcgaaggactcgaaggactcgaag	CRISPR spacer
cggactcgttggactcgaaggactccgag	Protospacer
 *******  *************** .**

15. spacer 3.2|2046094|29|NZ_CP012042|CRISPRCasFinder matches to MN694213 (Marine virus AFVG_250M687, complete genome) position: , mismatch: 5, identity: 0.828

aggact---cgaaggactcgaaggactcgaag	CRISPR spacer
---actcggcgaagaactcgaagaactcgaag	Protospacer
   ***   *****.********.********

16. spacer 3.2|2046094|29|NZ_CP012042|CRISPRCasFinder matches to MN694213 (Marine virus AFVG_250M687, complete genome) position: , mismatch: 5, identity: 0.828

aggact---cgaaggactcgaaggactcgaag	CRISPR spacer
---actcggcgaagaactcgaagaactcgaag	Protospacer
   ***   *****.********.********

17. spacer 3.2|2046094|29|NZ_CP012042|CRISPRCasFinder matches to NZ_CP022264 (Xanthomonas citri pv. vignicola strain CFBP7111 plasmid plA, complete sequence) position: , mismatch: 6, identity: 0.793

aggactcgaaggactcgaaggactcgaag	CRISPR spacer
ggctctcgaaggactcgaaagacgcgatg	Protospacer
.*  ***************.*** *** *

18. spacer 3.2|2046094|29|NZ_CP012042|CRISPRCasFinder matches to NZ_CP011665 (Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence) position: , mismatch: 7, identity: 0.759

aggactcgaaggactcgaaggactcgaag	CRISPR spacer
gacccgcgaagcactcgaagtactcgaag	Protospacer
..  * ***** ******** ********

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

590122 : 618831

Agrobacterium_phage(33.33%)

plate,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004528791.1\|590122_590584_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_004525342.1\|590620_592363_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_038739761.1\|592350_593373_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_060547413.1\|593359_596443_+	AAA domain-containing protein	A0A223W0B1	Agrobacterium_phage	3.5e-78	29.5
WP_060547414.1\|596469_599493_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	2.4e-23	25.0
WP_038727858.1\|602176_603241_+	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_060547415.1\|603237_603993_+	DUF3540 domain-containing protein	NA	NA	NA	NA
WP_004200966.1\|604021_604414_+	DUF4150 domain-containing protein	NA	NA	NA	NA
WP_004200965.1\|604423_605221_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_060547416.1\|605253_606651_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_004184888.1\|606647_607313_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_060547798.1\|607324_611410_+	type VI secretion system protein ImpL	NA	NA	NA	NA
WP_162491911.1\|612135_613404_+	peptidase	NA	NA	NA	NA
WP_004551882.1\|613563_613857_+	hypothetical protein	NA	NA	NA	NA
WP_004528803.1\|613861_614494_+	GTP cyclohydrolase I	A0A0P0HSD2	Acinetobacter_phage	9.9e-20	30.6
WP_162491891.1\|615554_617084_-	type III secretion system effector BopC	NA	NA	NA	NA
WP_038719707.1\|617115_617559_-	hypothetical protein	NA	NA	NA	NA
WP_080333048.1\|617643_617931_-\|transposase	transposase	NA	NA	NA	NA
WP_004557778.1\|618192_618831_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_2

1326333 : 1387637

Streptococcus_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004539273.1\|1326333_1327062_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.3e-22	31.2
WP_004552566.1\|1327420_1328074_+	glutathione S-transferase	NA	NA	NA	NA
WP_004539273.1\|1328254_1328983_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.3e-22	31.2
WP_082249646.1\|1329036_1329339_-	hypothetical protein	NA	NA	NA	NA
WP_038717128.1\|1329408_1331169_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_004544755.1\|1331594_1331894_-	hypothetical protein	NA	NA	NA	NA
WP_060547527.1\|1331905_1341157_-	filamentous hemagglutinin N-terminal domain-containing protein	NA	NA	NA	NA
WP_076849157.1\|1341308_1341506_-	hypothetical protein	NA	NA	NA	NA
WP_004533385.1\|1341506_1341770_-	putative Immunity protein 75	NA	NA	NA	NA
WP_060547528.1\|1342362_1347021_-	type IV secretion protein Rhs	A0A2H4JFP5	uncultured_Caudovirales_phage	8.3e-23	34.9
WP_038770563.1\|1347007_1348276_-	hypothetical protein	NA	NA	NA	NA
WP_060547529.1\|1348291_1350496_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	1.3e-42	28.0
WP_051453673.1\|1351952_1352942_-	DUF1016 domain-containing protein	A0A0U2BZN7	Salmonella_phage	3.0e-23	43.4
WP_038736157.1\|1353957_1354425_+	decarboxylase	NA	NA	NA	NA
WP_060547530.1\|1354580_1355597_+	hypothetical protein	NA	NA	NA	NA
WP_060547531.1\|1356160_1356760_-	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_004524853.1\|1356784_1357195_-	RidA family protein	NA	NA	NA	NA
WP_004530174.1\|1358624_1358972_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	4.7e-40	72.0
WP_004539264.1\|1358968_1359376_-\|transposase	transposase	A0A0P0ZCV4	Stx2-converting_phage	2.4e-11	36.5
WP_038761111.1\|1359808_1361842_-	hypothetical protein	NA	NA	NA	NA
WP_060547532.1\|1362082_1364254_-	alpha-galactosidase	NA	NA	NA	NA
WP_060547533.1\|1364258_1365110_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_004524828.1\|1365110_1366034_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_004524825.1\|1367374_1368619_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	7.1e-22	32.8
WP_004557920.1\|1368661_1369300_-	hypothetical protein	NA	NA	NA	NA
WP_004536893.1\|1371074_1372229_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_060547821.1\|1373571_1374312_+	hypothetical protein	NA	NA	NA	NA
WP_024429920.1\|1374740_1374896_+	recombinase family protein	A0A286S1P7	Klebsiella_phage	1.8e-07	75.7
WP_076953723.1\|1377652_1378219_-	suppressor of fused domain protein	NA	NA	NA	NA
WP_134864253.1\|1378967_1380103_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	5.4e-16	28.8
WP_085954059.1\|1381357_1382538_-\|transposase	IS3-like element ISBps1 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.7e-60	42.9
WP_080296509.1\|1383165_1384317_+	hypothetical protein	NA	NA	NA	NA
WP_076860993.1\|1384346_1384616_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_060547535.1\|1385624_1387637_-\|transposase	transposase	S5WIU1	Leptospira_phage	1.2e-31	51.2

DBSCAN-SWA_3

2394916 : 2466701

Vibrio_phage(25.0%)

plate,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004188389.1\|2394916_2395684_-\|holin	phosphocholine cytidylyltransferase family protein	NA	NA	NA	NA
WP_004206084.1\|2395722_2396724_-	HpnL family protein	NA	NA	NA	NA
WP_038726822.1\|2396720_2397494_-	2OG-Fe(II) oxygenase	NA	NA	NA	NA
WP_038726824.1\|2397490_2398192_-	CDP-alcohol phosphatidyltransferase family protein	NA	NA	NA	NA
WP_011852789.1\|2398556_2400071_+	acetyl-CoA hydrolase/transferase family protein	NA	NA	NA	NA
WP_004530037.1\|2401791_2402730_+	hypothetical protein	NA	NA	NA	NA
WP_004202234.1\|2402763_2403312_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_004190846.1\|2403314_2404820_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_004530039.1\|2404963_2405491_+	hypothetical protein	NA	NA	NA	NA
WP_011852791.1\|2405570_2406002_+	GPW/gp25 family protein	NA	NA	NA	NA
WP_060547690.1\|2406015_2407878_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_004190851.1\|2407874_2408864_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_044358842.1\|2408866_2411737_+	type VI secretion system ATPase TssH	A0A2I7REQ1	Vibrio_phage	2.4e-60	27.2
WP_004538025.1\|2411727_2414019_+	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_004190563.1\|2414184_2416473_+	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_004530041.1\|2416476_2418693_+	DUF2169 domain-containing protein	NA	NA	NA	NA
WP_004525550.1\|2418692_2419763_+	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_004525551.1\|2419765_2420482_+	DUF3540 domain-containing protein	NA	NA	NA	NA
WP_004190606.1\|2420524_2420914_+	DUF4150 domain-containing protein	NA	NA	NA	NA
WP_004202226.1\|2420919_2421513_+	hypothetical protein	NA	NA	NA	NA
WP_004525552.1\|2421509_2422871_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_060547691.1\|2422953_2424612_+	OmpA family protein	NA	NA	NA	NA
WP_004525554.1\|2424608_2428112_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_004190863.1\|2428170_2428530_+	hypothetical protein	NA	NA	NA	NA
WP_004530792.1\|2428552_2428975_+	hypothetical protein	NA	NA	NA	NA
WP_004536812.1\|2429295_2429571_+	hypothetical protein	NA	NA	NA	NA
WP_004524288.1\|2430121_2431021_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_011852797.1\|2431062_2431365_-	hypothetical protein	NA	NA	NA	NA
WP_011205424.1\|2431254_2432574_+	glycosyltransferase	NA	NA	NA	NA
WP_011205597.1\|2432570_2434157_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_004186828.1\|2434449_2435445_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_038779716.1\|2435570_2435768_+	hypothetical protein	NA	NA	NA	NA
WP_004549244.1\|2435764_2437348_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_029444437.1\|2438074_2439328_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_060547693.1\|2439849_2441514_-	glycoside hydrolase family 32 protein	F8WPR5	Bacillus_phage	1.6e-56	31.4
WP_076829612.1\|2441646_2443212_-	glycoside hydrolase 68 family protein	NA	NA	NA	NA
WP_004523134.1\|2443400_2444417_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_004530054.1\|2444855_2446055_+	formaldehyde dehydrogenase, glutathione-independent	A0A2K9L7I1	Tupanvirus	8.4e-12	27.2
WP_038773649.1\|2446232_2447258_-	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_161630907.1\|2447271_2447556_+	hypothetical protein	NA	NA	NA	NA
WP_004523136.1\|2447691_2448966_+	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	5.3e-105	54.1
WP_004186989.1\|2449038_2450010_+	membrane dipeptidase	NA	NA	NA	NA
WP_004186987.1\|2450160_2450694_+	4-vinyl reductase	NA	NA	NA	NA
WP_004523137.1\|2450754_2452818_+	NADH:flavin oxidoreductase	NA	NA	NA	NA
WP_060547694.1\|2452820_2454746_+	(Fe-S)-binding protein	NA	NA	NA	NA
WP_004202150.1\|2454750_2455923_+	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_004530055.1\|2455919_2456705_+	drug:proton antiporter	NA	NA	NA	NA
WP_004535147.1\|2456756_2457998_+	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_004543120.1\|2458018_2459164_+	hybrid-cluster NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_004186918.1\|2459273_2460137_+	glycine betaine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011852809.1\|2460317_2461973_+	APC family permease	NA	NA	NA	NA
WP_004186920.1\|2462059_2462935_-	formyltetrahydrofolate deformylase	NA	NA	NA	NA
WP_060547695.1\|2463078_2463951_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004537371.1\|2464113_2465667_+\|holin	choline-sulfatase	NA	NA	NA	NA
WP_038765676.1\|2465663_2466701_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA

DBSCAN-SWA_4

3094803 : 3147346

Burkholderia_virus(72.0%)

terminase,portal,capsid,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004199327.1\|3094803_3095676_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_060547781.1\|3095887_3096592_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_060547782.1\|3096767_3097763_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_004199294.1\|3098632_3099154_+	sigma-70 family RNA polymerase sigma factor	A0A076YQ50	Rhizobium_phage	5.1e-06	27.1
WP_004528275.1\|3099150_3099975_+	anti-sigma factor	NA	NA	NA	NA
WP_004528277.1\|3100958_3101318_+	lipoprotein	NA	NA	NA	NA
WP_060547783.1\|3101314_3101542_+	hypothetical protein	NA	NA	NA	NA
WP_004524116.1\|3101815_3102325_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_011205506.1\|3102321_3103326_+	FecR family protein	NA	NA	NA	NA
WP_060547784.1\|3103452_3106137_+	TonB-dependent receptor	NA	NA	NA	NA
WP_060547785.1\|3106355_3107336_-	ABC transporter permease	NA	NA	NA	NA
WP_060547863.1\|3107328_3108414_-	ABC transporter permease	NA	NA	NA	NA
WP_060547786.1\|3108410_3110252_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	9.3e-10	25.2
WP_028358984.1\|3110248_3111259_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_038803101.1\|3111321_3111819_+	hypothetical protein	NA	NA	NA	NA
WP_004206353.1\|3111977_3112670_+	isoprenylcysteine carboxylmethyltransferase family protein	NA	NA	NA	NA
WP_041195455.1\|3113006_3113258_-	hypothetical protein	NA	NA	NA	NA
WP_004549393.1\|3114897_3116367_-	MFS transporter	NA	NA	NA	NA
WP_004198472.1\|3116784_3117033_-	hypothetical protein	NA	NA	NA	NA
WP_028358983.1\|3117665_3117938_+	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_004184766.1\|3118053_3119448_-	heavy metal sensor histidine kinase IrlS	W8CYF6	Bacillus_phage	1.2e-20	28.9
WP_004197868.1\|3119444_3120134_-	heavy metal response regulator transcription factor IrlR	W8CYM9	Bacillus_phage	1.7e-36	36.8
WP_060547787.1\|3120140_3123368_-	CusA/CzcA family heavy metal efflux RND transporter	NA	NA	NA	NA
WP_060547788.1\|3124892_3126278_-	TolC family protein	NA	NA	NA	NA
WP_038760816.1\|3126512_3126797_-	hypothetical protein	NA	NA	NA	NA
WP_004524134.1\|3127193_3127334_-	bacteriophage protein	NA	NA	NA	NA
WP_038719599.1\|3128001_3128487_-	membrane protein	NA	NA	NA	NA
WP_004197880.1\|3128816_3129302_+	YbaK/EbsC family protein	NA	NA	NA	NA
WP_009909341.1\|3129497_3129827_-	helix-turn-helix domain-containing protein	R4JEU7	Burkholderia_phage	1.6e-29	58.7
WP_060547789.1\|3130218_3131001_+	hypothetical protein	A4JWW8	Burkholderia_virus	1.5e-142	99.6
WP_009897093.1\|3131316_3131538_+	hypothetical protein	A4JWW6	Burkholderia_virus	1.6e-38	100.0
WP_009971783.1\|3131541_3131757_+	hypothetical protein	A4JWW5	Burkholderia_virus	2.1e-30	100.0
WP_009971784.1\|3132063_3132276_+	hypothetical protein	A4JWW3	Burkholderia_virus	1.1e-34	100.0
WP_038749735.1\|3132477_3133719_+	hypothetical protein	A4JWW2	Burkholderia_virus	6.5e-225	99.8
WP_006027270.1\|3133802_3133925_+	hypothetical protein	A4JWW1	Burkholderia_virus	7.7e-14	97.5
WP_038749737.1\|3133924_3135718_+	replication endonuclease	A4JWW0	Burkholderia_virus	0.0e+00	99.8
WP_009971787.1\|3135733_3136000_+	ogr/Delta-like zinc finger family protein	A4JWV9	Burkholderia_virus	3.1e-44	100.0
WP_004532731.1\|3135996_3136203_+	ogr/Delta-like zinc finger family protein	A4JWV8	Burkholderia_virus	8.7e-34	100.0
WP_004532770.1\|3136292_3136946_+	AAA family ATPase	A4JWV7	Burkholderia_virus	1.4e-114	100.0
WP_009897078.1\|3137179_3137302_+	CopG family transcriptional regulator	A4JWV6	Burkholderia_virus	5.9e-14	100.0
WP_004532793.1\|3137404_3137938_+	bacteriophage gp29 protein	A4JWV5	Burkholderia_virus	8.4e-97	100.0
WP_004532838.1\|3137934_3138672_+	VRR-NUC domain-containing protein	A4JWV4	Burkholderia_virus	1.0e-132	99.6
WP_076829914.1\|3138680_3139802_+	DUF3396 domain-containing protein	A4JWV3	Burkholderia_virus	8.2e-219	99.5
WP_038732507.1\|3140425_3140947_-	hypothetical protein	NA	NA	NA	NA
WP_038749746.1\|3141006_3142062_-\|portal	phage portal protein	A4JWQ2	Burkholderia_virus	4.9e-205	99.1
WP_060547865.1\|3142058_3143828_-\|terminase	terminase ATPase subunit family protein	A4JWU9	Burkholderia_virus	0.0e+00	99.1
WP_038765884.1\|3143971_3144781_+\|capsid	GPO family capsid scaffolding protein	A4JWQ0	Burkholderia_virus	4.8e-144	99.6
WP_004531048.1\|3144814_3145828_+\|capsid	phage major capsid protein, P2 family	K4NZP8	Burkholderia_phage	7.2e-190	100.0
WP_060547132.1\|3145824_3146514_+\|terminase	terminase endonuclease subunit	K4NX86	Burkholderia_phage	6.1e-116	98.7
WP_009897053.1\|3147139_3147346_+	hypothetical protein	A4JWU4	Burkholderia_virus	2.4e-31	100.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP012041

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 13407

Micromonas_sp._RCC1109_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004203514.1\|104_824_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_004522425.1\|1060_1606_-	diacylglycerol kinase	NA	NA	NA	NA
WP_004196438.1\|2668_3607_-	UDP-2,3-diacylglucosamine diphosphatase	A0A218MKA7	uncultured_virus	7.2e-67	48.5
WP_060546749.1\|3697_4207_-	RDD family protein	NA	NA	NA	NA
WP_004526454.1\|4213_4969_-	DUF3106 domain-containing protein	NA	NA	NA	NA
WP_004185907.1\|4999_5422_-	DUF3619 family protein	NA	NA	NA	NA
WP_004186304.1\|5418_5979_-	RNA polymerase sigma factor	NA	NA	NA	NA
WP_060546750.1\|6374_8138_+	acetolactate synthase 3 catalytic subunit	E5EQ70	Micromonas_sp._RCC1109_virus	6.5e-53	29.2
WP_004186134.1\|8249_8741_+	acetolactate synthase small subunit	NA	NA	NA	NA
WP_004185539.1\|8823_9840_+	ketol-acid reductoisomerase	NA	NA	NA	NA
WP_004531897.1\|9961_10612_+	phosphatidylserine decarboxylase	A0A1V0SDU9	Indivirus	5.4e-13	29.8
WP_004522420.1\|10628_11501_+	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
WP_004522419.1\|11859_13407_+	2-isopropylmalate synthase	E5EQ69	Micromonas_sp._RCC1109_virus	2.1e-07	27.0

DBSCAN-SWA_2

39221 : 39812

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004185716.1\|39221_39812_+	NUDIX hydrolase	A0A2K9VDH1	Lactobacillus_phage	3.0e-10	36.7

DBSCAN-SWA_3

55385 : 56606

Burkholderia_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004525642.1\|55385_56606_+\|transposase	ISL3-like element ISBma1 family transposase	A9YX10	Burkholderia_phage	2.7e-239	99.8

DBSCAN-SWA_4

71074 : 72349

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024429702.1\|71074_72349_+	phosphoglycerate dehydrogenase	A0A1V0SBV6	Catovirus	1.3e-82	42.7

DBSCAN-SWA_5

106987 : 107776

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060546760.1\|106987_107776_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.4e-25	36.8

DBSCAN-SWA_6

118939 : 125445

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004193148.1\|118939_122752_+	exodeoxyribonuclease V subunit beta	G3MA40	Bacillus_virus	3.6e-08	29.7
WP_060546761.1\|122748_125445_+	AAA family ATPase	A0A1P8DII4	Virus_Rctr197k	2.4e-14	38.1

DBSCAN-SWA_7

142728 : 143757

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004534498.1\|142728_143757_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.9e-20	30.7

DBSCAN-SWA_8

153141 : 154506

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162491861.1\|153141_154506_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	5.1e-21	36.1

DBSCAN-SWA_9

157815 : 162168

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004535882.1\|157815_159357_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	4.3e-16	26.7
WP_004531099.1\|159598_160093_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_004193800.1\|160251_162168_+	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	1.5e-135	42.6

DBSCAN-SWA_10

173826 : 174228

Wolbachia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004191564.1\|173826_174228_-	Hsp20/alpha crystallin family protein	A0A1B2LRT2	Wolbachia_phage	9.4e-08	33.6

DBSCAN-SWA_11

192888 : 200198

Burkholderia_virus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038754910.1\|192888_194376_-	glycine betaine/L-proline transporter ProP	Q6JIH2	Burkholderia_virus	6.7e-59	33.0
WP_060546779.1\|194911_195244_+	YnfA family protein	A0A218MNG8	uncultured_virus	7.7e-24	56.6
WP_004531112.1\|195590_196313_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	1.7e-39	40.0
WP_004193456.1\|196370_196817_-	ribonuclease HI	J9Q745	Salmonella_phage	1.2e-43	53.1
WP_004192921.1\|196813_197626_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_038729741.1\|197646_198453_+	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
WP_004538424.1\|198605_200198_+	transglycosylase SLT domain-containing protein	U5PVY0	Bacillus_phage	2.2e-07	37.2

DBSCAN-SWA_12

204484 : 205630

Halovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004198695.1\|204484_205630_+	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	2.2e-46	34.0

DBSCAN-SWA_13

212376 : 223795

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004191694.1\|212376_214263_+	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	M4QMW8	Micromonas_pusilla_virus	5.6e-111	40.8
WP_004542433.1\|214375_215266_+	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	4.8e-20	31.2
WP_004266863.1\|215291_216650_+	phosphoglucosamine mutase	NA	NA	NA	NA
WP_004199345.1\|217085_218114_+	phosphate ABC transporter substrate-binding protein PstS	A0A1D7SRJ6	Cyanophage	2.5e-44	35.6
WP_004193912.1\|218220_219207_+	phosphate ABC transporter permease PstC	NA	NA	NA	NA
WP_004521821.1\|219203_220097_+	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_004193614.1\|220112_220961_+	phosphate ABC transporter ATP-binding protein PstB	W8CYL7	Bacillus_phage	2.1e-17	34.8
WP_004193271.1\|220980_221685_+	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_004192125.1\|221713_222415_+	phosphate regulon transcriptional regulatory protein PhoB	W8CYM9	Bacillus_phage	5.1e-33	36.9
WP_004197666.1\|222484_223795_+	phosphate regulon sensor histidine kinase PhoR	W8CYF6	Bacillus_phage	3.1e-36	36.4

DBSCAN-SWA_14

238021 : 240704

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004193897.1\|238021_239647_-	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	2.3e-68	35.4
WP_004192280.1\|239626_239740_+	hypothetical protein	NA	NA	NA	NA
WP_004531123.1\|239751_239925_+	hypothetical protein	NA	NA	NA	NA
WP_004192768.1\|240002_240704_-	peptidoglycan DD-metalloendopeptidase family protein	A0A292GJG6	Xanthomonas_phage	9.9e-13	44.8

DBSCAN-SWA_15

246372 : 248352

Burkholderia_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009970413.1\|246372_246963_+	recombinase family protein	E5FFF9	Burkholderia_phage	7.5e-22	41.1
WP_122651352.1\|247232_248352_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5

DBSCAN-SWA_16

253142 : 257516

Burkholderia_phage(40.0%)

integrase

attL 248405:248420|attR 264414:264429

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
248405:248420	attL	NA	NA	NA	NA
WP_060546783.1\|253142_254162_-\|integrase	site-specific integrase	A0A0A1I5U0	Burkholderia_phage	5.3e-47	37.0
WP_076905327.1\|254321_254765_-\|integrase	tyrosine-type recombinase/integrase	A0A1S5NNJ1	Burkholderia_phage	4.3e-22	48.2
WP_060546784.1\|254942_255644_-	LysR family transcriptional regulator	A4PE26	Ralstonia_virus	1.0e-33	42.7
WP_038777473.1\|255646_256249_-	hypothetical protein	NA	NA	NA	NA
WP_060547266.1\|256590_257097_-	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	3.0e-19	40.1
WP_015878302.1\|257093_257516_-	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	3.7e-15	49.4
264414:264429	attR	NA	NA	NA	NA

DBSCAN-SWA_17

292404 : 297999

Yersinia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004552911.1\|292404_295677_+	hypothetical protein	A0A2C9CZB7	Yersinia_phage	1.4e-05	33.0
WP_038731660.1\|295757_296468_+	OmpA family protein	NA	NA	NA	NA
WP_004192726.1\|296469_297999_+	hypothetical protein	D6PFH9	uncultured_phage	1.2e-15	25.4

DBSCAN-SWA_18

305326 : 347792

uncultured_Caudovirales_phage(33.33%)

plate,transposase,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004542513.1\|305326_307177_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_060546791.1\|307204_308620_-	hypothetical protein	NA	NA	NA	NA
WP_004193592.1\|308643_308910_-	PAAR domain-containing protein	NA	NA	NA	NA
WP_004521773.1\|309169_309397_-	hypothetical protein	NA	NA	NA	NA
WP_038735477.1\|309430_312238_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	5.7e-27	25.0
WP_004535790.1\|312240_313074_+	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_060546792.1\|313210_313768_+	DUF3304 domain-containing protein	NA	NA	NA	NA
WP_004531151.1\|313764_314358_+	DUF3304 domain-containing protein	NA	NA	NA	NA
WP_060546793.1\|314354_316763_+	DUF2235 domain-containing protein	NA	NA	NA	NA
WP_060546794.1\|316871_320207_+	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_004521767.1\|320184_320676_+	lipoprotein	NA	NA	NA	NA
WP_075018909.1\|320992_321532_+	hypothetical protein	NA	NA	NA	NA
WP_038754846.1\|321764_322007_+	hypothetical protein	NA	NA	NA	NA
WP_004542462.1\|322024_322330_+	hypothetical protein	NA	NA	NA	NA
WP_060546795.1\|322342_325177_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	1.4e-20	25.9
WP_060546796.1\|325180_326197_+	hypothetical protein	NA	NA	NA	NA
WP_060546797.1\|326199_329223_+	hypothetical protein	NA	NA	NA	NA
WP_004538387.1\|329504_329951_+	hypothetical protein	NA	NA	NA	NA
WP_153260188.1\|331094_331520_+	hypothetical protein	NA	NA	NA	NA
WP_060546798.1\|332178_333099_+	hypothetical protein	NA	NA	NA	NA
WP_004556892.1\|333644_333938_+	hypothetical protein	NA	NA	NA	NA
WP_080294203.1\|334881_335574_+	hypothetical protein	NA	NA	NA	NA
WP_129111352.1\|335656_335842_+\|transposase	transposase	NA	NA	NA	NA
WP_004556795.1\|335838_335961_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_052108053.1\|336891_337206_+\|transposase	transposase	S5WIU1	Leptospira_phage	4.3e-24	57.5
WP_154316409.1\|337246_337411_+	hypothetical protein	NA	NA	NA	NA
WP_060547270.1\|337528_338449_+	hypothetical protein	NA	NA	NA	NA
WP_060546799.1\|338708_340022_+	divalent metal cation transporter	NA	NA	NA	NA
WP_009927991.1\|340914_341187_+	hypothetical protein	NA	NA	NA	NA
WP_004193855.1\|341449_341731_-	H-NS histone family protein	NA	NA	NA	NA
WP_060546801.1\|342198_343173_-	amidohydrolase family protein	NA	NA	NA	NA
WP_004538381.1\|343217_344504_-	MFS transporter	NA	NA	NA	NA
WP_004196705.1\|344920_345814_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_162491859.1\|345998_346175_+	hypothetical protein	NA	NA	NA	NA
WP_076812081.1\|346193_346373_+	hypothetical protein	NA	NA	NA	NA
WP_004534686.1\|346458_346647_+	hypothetical protein	NA	NA	NA	NA
WP_004538378.1\|346633_347179_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_004191870.1\|347231_347792_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA

DBSCAN-SWA_19

353098 : 355180

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060546802.1\|353098_355180_+	response regulator	A0A1V0SGR3	Hokovirus	1.7e-12	26.8

DBSCAN-SWA_20

371047 : 378749

Proteus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004552886.1\|371047_371530_+	NUDIX hydrolase	A0A2I6PFL2	Proteus_phage	1.7e-19	41.3
WP_011854060.1\|371880_373590_-\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	6.7e-188	57.5
WP_004534928.1\|373869_374079_+	hypothetical protein	NA	NA	NA	NA
WP_004531186.1\|374364_375585_-	CoA transferase	NA	NA	NA	NA
WP_004204967.1\|376124_378749_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	5.5e-80	39.2

DBSCAN-SWA_21

389436 : 392513

Cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060546809.1\|389436_391812_+	branched-chain amino acid ABC transporter ATP-binding protein/permease	A0A2R8FFL6	Cedratvirus	1.5e-07	26.9
WP_004521714.1\|391808_392513_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.7e-08	29.1

DBSCAN-SWA_22

398359 : 399160

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004193469.1\|398359_399160_-	sugar ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	8.1e-11	26.2

DBSCAN-SWA_23

411276 : 417615

Bacillus_phage(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192544.1\|411276_412158_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.9e-69	47.9
WP_038795339.1\|412244_415112_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	2.1e-146	39.3
WP_028358885.1\|415251_417615_+	UvrD-helicase domain-containing protein	S5M596	Bacillus_phage	1.4e-71	30.7

DBSCAN-SWA_24

428960 : 429932

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060546814.1\|428960_429932_-	serine/threonine protein phosphatase	A0A291ATQ8	Pandoravirus	5.6e-22	32.0

DBSCAN-SWA_25

437480 : 440113

Pandoravirus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004534774.1\|437480_438590_+	chorismate synthase	A0A291AU41	Pandoravirus	1.1e-82	43.7
WP_134864182.1\|438744_440113_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	8.0e-75	54.0

DBSCAN-SWA_26

459349 : 466770

Tupanvirus(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004191232.1\|459349_461257_+\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	1.7e-123	37.5
WP_071810680.1\|461306_461831_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	4.1e-11	28.7
WP_004191477.1\|462023_462221_+	50S ribosomal protein L35	NA	NA	NA	NA
WP_004192938.1\|462251_462611_+	50S ribosomal protein L20	NA	NA	NA	NA
WP_060546819.1\|462759_463773_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	4.6e-27	39.3
WP_060546820.1\|463860_466293_+\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_004197408.1\|466365_466770_+	integration host factor subunit alpha	A0A1P8CWT5	Bacillus_phage	2.8e-12	41.1

DBSCAN-SWA_27

469969 : 471154

Gordonia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060546821.1\|469969_471154_-	acyltransferase	A0A166XZF2	Gordonia_phage	3.1e-14	28.9

DBSCAN-SWA_28

479626 : 482315

Lactobacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004193481.1\|479626_480529_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	4.5e-10	23.6
WP_038725786.1\|480947_482315_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	4.2e-23	35.1

DBSCAN-SWA_29

486372 : 489300

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004526850.1\|486372_489300_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	6.8e-23	25.3

DBSCAN-SWA_30

498215 : 499678

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_134864184.1\|498215_499678_-\|transposase	IS1182-like element ISBma2 family transposase	A0A1X9I5T2	Streptococcus_phage	3.0e-80	38.6

DBSCAN-SWA_31

504400 : 505831

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004534933.1\|504400_505831_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	1.4e-42	28.0

DBSCAN-SWA_32

530191 : 531964

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004199468.1\|530191_531964_-	long-chain-fatty-acid--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	6.6e-37	29.9

DBSCAN-SWA_33

544848 : 549435

Lactococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004550537.1\|544848_547287_+	ribonuclease R	Q0GXV6	Lactococcus_phage	1.5e-68	32.6
WP_004191786.1\|547418_548162_+	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
WP_011851549.1\|548173_548473_+	hypothetical protein	NA	NA	NA	NA
WP_011851550.1\|548535_549435_+	N-acetylmuramoyl-L-alanine amidase	A0A076YN96	Rhizobium_phage	3.6e-07	30.0

DBSCAN-SWA_34

559231 : 559570

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004191709.1\|559231_559570_+	multidrug efflux SMR transporter	E5EPE2	Acinetobacter_phage	8.7e-07	33.6

DBSCAN-SWA_35

563989 : 564973

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004550532.1\|563989_564973_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	7.6e-27	36.0

DBSCAN-SWA_36

576509 : 580364

Anomala_cuprea_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004534557.1\|576509_577424_-	nodulation factor ABC transporter ATP-binding protein NodI	W6JKT0	Anomala_cuprea_entomopoxvirus	8.4e-28	27.8
WP_004199454.1\|577653_578145_+	universal stress protein	NA	NA	NA	NA
WP_004521621.1\|578559_579294_-	DUF2939 domain-containing protein	NA	NA	NA	NA
WP_004192710.1\|579327_579654_-	hypothetical protein	NA	NA	NA	NA
WP_004191638.1\|579716_580364_-	transcriptional repressor LexA	A0A218MND2	uncultured_virus	1.2e-09	37.3

DBSCAN-SWA_37

583772 : 591004

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192434.1\|583772_584828_+	sulfate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.3e-28	34.6
WP_060546831.1\|584897_585824_+	CysB family HTH-type transcriptional regulator	NA	NA	NA	NA
WP_004531229.1\|586182_587145_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004521615.1\|587287_588859_+	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.6e-08	24.5
WP_004521614.1\|588929_589943_+	ABC transporter permease	NA	NA	NA	NA
WP_004521613.1\|589972_591004_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	6.5e-37	32.9

DBSCAN-SWA_38

596958 : 604243

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004534653.1\|596958_598224_+	YeaH/YhbH family protein	A0A219UQP6	Bacillus_phage	1.9e-09	37.2
WP_004192871.1\|598223_599906_+	SpoVR family protein	NA	NA	NA	NA
WP_004521606.1\|600375_601680_+	MFS transporter	Q6JIH2	Burkholderia_virus	2.4e-44	30.0
WP_004521605.1\|601932_602979_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_024430432.1\|603030_603318_+	hypothetical protein	NA	NA	NA	NA
WP_004191944.1\|603412_604243_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.8e-30	40.4

DBSCAN-SWA_39

619864 : 621280

Rhodococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060546837.1\|619864_621280_-	peptidoglycan DD-metalloendopeptidase family protein	G9FHH0	Rhodococcus_phage	2.2e-11	40.4

DBSCAN-SWA_40

635250 : 637011

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060546839.1\|635250_637011_-	ABC transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	1.9e-07	23.4

DBSCAN-SWA_41

642357 : 643965

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060546840.1\|642357_643965_+	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.3e-19	30.8

DBSCAN-SWA_42

651820 : 652711

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004526941.1\|651820_652711_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.5e-09	31.2

DBSCAN-SWA_43

658113 : 675615

Tupanvirus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004552852.1\|658113_659859_-	cyclic peptide export ABC transporter	G9BWD6	Planktothrix_phage	4.5e-14	24.5
WP_060546844.1\|660444_670347_+	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	2.8e-60	29.0
WP_060546845.1\|670395_675615_+	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	3.9e-45	22.4

DBSCAN-SWA_44

695306 : 696653

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060546850.1\|695306_696653_-	chitinase	M1HTM3	Paramecium_bursaria_Chlorella_virus	1.1e-39	37.5

DBSCAN-SWA_45

723319 : 727542

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038728504.1\|723319_724258_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.5e-19	30.6
WP_004521532.1\|724254_725475_-	ABC transporter permease	NA	NA	NA	NA
WP_038727325.1\|725471_726410_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004198168.1\|726771_727542_+	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	2.8e-45	40.6

DBSCAN-SWA_46

743129 : 744122

Faustovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009920361.1\|743129_744122_+	histidinol-phosphate aminotransferase family protein	A0A0H3TLT9	Faustovirus	9.8e-06	25.9

DBSCAN-SWA_47

776193 : 777915

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004534894.1\|776193_777915_+	carbamoyltransferase	E3SL71	Synechococcus_phage	7.0e-52	32.9

DBSCAN-SWA_48

794530 : 795853

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527034.1\|794530_795853_+	MFS transporter	Q6JIH2	Burkholderia_virus	1.1e-84	42.5

DBSCAN-SWA_49

805456 : 806062

Freshwater_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038723826.1\|805456_806062_-	adenylyl-sulfate kinase	A0A1B0XTK9	Freshwater_phage	4.1e-07	36.0

DBSCAN-SWA_50

813885 : 816177

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038746604.1\|813885_816177_-	ATP-binding cassette domain-containing protein	A0A1V0SE00	Indivirus	1.6e-19	28.9

DBSCAN-SWA_51

835824 : 836886

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004550415.1\|835824_836886_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-26	37.8

DBSCAN-SWA_52

843793 : 844678

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527060.1\|843793_844678_-	alpha/beta fold hydrolase	A0A0B5A484	Mycobacterium_phage	1.9e-08	27.6

DBSCAN-SWA_53

852536 : 855785

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060546866.1\|852536_855785_-	response regulator	A0A2K9L5I4	Tupanvirus	9.6e-26	32.3

DBSCAN-SWA_54

886140 : 887127

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060546873.1\|886140_887127_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.6e-16	32.7

DBSCAN-SWA_55

892295 : 893210

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004539779.1\|892295_893210_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	8.9e-30	36.6

DBSCAN-SWA_56

917418 : 918396

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004521382.1\|917418_918396_-	D-glycerate dehydrogenase	M1I1Q8	Acanthocystis_turfacea_Chlorella_virus	1.2e-16	25.8

DBSCAN-SWA_57

928494 : 931665

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060546878.1\|928494_931665_+	efflux RND transporter permease subunit	S5VL66	Leptospira_phage	1.7e-06	17.6

DBSCAN-SWA_58

943657 : 945744

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004521363.1\|943657_944587_-	ABC transporter permease subunit	Q6GZ02	Mycoplasma_phage	3.7e-07	22.8
WP_004521362.1\|944583_945744_-	polyamine ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	1.3e-22	36.6

DBSCAN-SWA_59

954001 : 955594

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538238.1\|954001_955594_-	ABC-F family ATPase	A0A2K9L0W2	Tupanvirus	3.1e-54	26.8

DBSCAN-SWA_60

958679 : 959375

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192911.1\|958679_959375_+	ATP-binding cassette domain-containing protein	F2Y302	Organic_Lake_phycodnavirus	8.9e-06	29.3

DBSCAN-SWA_61

977964 : 980223

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527153.1\|977964_980223_-	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	3.4e-78	30.1

DBSCAN-SWA_62

984060 : 988191

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004521342.1\|984060_985953_-	potassium transporter Kup	A7J6G4	Paramecium_bursaria_Chlorella_virus	5.7e-79	32.7
WP_004197469.1\|985917_986112_+	hypothetical protein	NA	NA	NA	NA
WP_004527158.1\|986244_986838_-	phosphoribosyltransferase	NA	NA	NA	NA
WP_004534924.1\|986844_988191_-	adenylosuccinate synthase	A0A160ER07	Powai_lake_megavirus	1.5e-70	36.8

DBSCAN-SWA_63

1002359 : 1016737

Powai_lake_megavirus(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004193561.1\|1002359_1002785_-	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	1.6e-21	42.1
WP_004521332.1\|1003033_1003732_+	Bax inhibitor-1/YccA family protein	NA	NA	NA	NA
WP_004192701.1\|1003805_1005203_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	8.3e-27	25.4
WP_004192869.1\|1005280_1006141_+	hypothetical protein	NA	NA	NA	NA
WP_004191371.1\|1006329_1007106_-	3'-5' exonuclease	NA	NA	NA	NA
WP_004193640.1\|1007113_1008193_-	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	3.9e-32	35.4
WP_004192107.1\|1008204_1009095_-	peptidoglycan DD-metalloendopeptidase family protein	A0A0S2SXL7	Bacillus_phage	3.3e-05	34.3
WP_004521326.1\|1010070_1010832_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.9e-62	52.7
WP_060546884.1\|1010936_1012142_-	CoA transferase	NA	NA	NA	NA
WP_038707995.1\|1012211_1012808_-	recombination protein RecR	NA	NA	NA	NA
WP_004192342.1\|1012845_1013172_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_060546885.1\|1013268_1015746_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	8.6e-43	37.0
WP_004191795.1\|1016410_1016737_+	thioredoxin TrxA	A0A1J0GW78	Streptomyces_phage	4.0e-17	43.0

DBSCAN-SWA_64

1028043 : 1030641

Cronobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009920009.1\|1028043_1030641_-	ATP-dependent chaperone ClpB	K4FB40	Cronobacter_phage	2.4e-120	36.9

DBSCAN-SWA_65

1043655 : 1044663

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004191549.1\|1043655_1044663_+	glycosyltransferase	B9UDL7	Salmonella_phage	4.3e-33	29.9

DBSCAN-SWA_66

1048611 : 1055103

Vibrio_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004206399.1\|1048611_1050246_+	PhoH family protein	A0A2I7SAD7	Vibrio_phage	6.2e-74	38.5
WP_060546892.1\|1050485_1051700_+	C40 family peptidase	A0A1S5SEZ8	Streptococcus_phage	2.9e-12	34.1
WP_004193771.1\|1051934_1052945_-	inorganic phosphate transporter	NA	NA	NA	NA
WP_004193838.1\|1052955_1053582_-	DUF47 domain-containing protein	NA	NA	NA	NA
WP_004192724.1\|1053720_1055103_-	replicative DNA helicase	C7BGG1	Burkholderia_phage	1.2e-139	58.5

DBSCAN-SWA_67

1058923 : 1064592

Burkholderia_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004525642.1\|1058923_1060144_+\|transposase	ISL3-like element ISBma1 family transposase	A9YX10	Burkholderia_phage	2.7e-239	99.8
WP_004539796.1\|1060217_1061138_+	twin-arginine translocation signal domain-containing protein	NA	NA	NA	NA
WP_004192893.1\|1061148_1061574_+	cytochrome-c oxidase	NA	NA	NA	NA
WP_004521296.1\|1061742_1062654_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004527189.1\|1062816_1064592_+	glyoxylate carboligase	E4WLQ6	Ostreococcus_tauri_virus	6.1e-43	27.9

DBSCAN-SWA_68

1072896 : 1074075

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009973288.1\|1072896_1074075_-	AAA family ATPase	A0A077SLJ9	Escherichia_phage	1.1e-69	40.6

DBSCAN-SWA_69

1079240 : 1084735

Bacteriophage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004540021.1\|1079240_1079861_-	dTMP kinase	A0A1L2BX49	Bacteriophage	2.7e-30	41.1
WP_004191597.1\|1079861_1080881_-	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_004193428.1\|1080959_1082006_+	folate-binding protein YgfZ	NA	NA	NA	NA
WP_004191929.1\|1082076_1082928_+	NRDE family protein	A0A0M3ZEJ9	Turkeypox_virus	7.1e-21	28.5
WP_004192469.1\|1082963_1083404_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_004521279.1\|1083775_1084735_-	alpha/beta hydrolase	J3IZC7	Acanthamoeba_polyphaga_lentillevirus	7.2e-30	30.3

DBSCAN-SWA_70

1089577 : 1090216

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060546897.1\|1089577_1090216_-	bifunctional nicotinamidase/pyrazinamidase	A0A2K9L2K0	Tupanvirus	5.3e-21	35.6

DBSCAN-SWA_71

1094352 : 1102850

Burkholderia_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060547279.1\|1094352_1095918_+	YdiU family protein	A0A075BSJ0	Microcystis_phage	3.1e-54	31.6
WP_004193880.1\|1095968_1096400_+	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_004192037.1\|1096492_1097023_+	septation protein A	NA	NA	NA	NA
WP_004534587.1\|1097025_1097340_+	BolA family transcriptional regulator	NA	NA	NA	NA
WP_009965630.1\|1097364_1098144_+	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_004527207.1\|1098241_1098775_-	N-acetyltransferase	A9YX37	Burkholderia_phage	3.6e-15	100.0
WP_038754526.1\|1098779_1102850_-	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	2.9e-237	100.0

DBSCAN-SWA_72

1108059 : 1108776

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038746829.1\|1108059_1108776_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-35	40.6

DBSCAN-SWA_73

1116264 : 1120963

Moraxella_phage(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004193454.1\|1116264_1118682_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	5.9e-222	52.8
WP_004521258.1\|1118877_1120149_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	2.4e-134	59.0
WP_004193408.1\|1120309_1120963_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	3.1e-53	56.5

DBSCAN-SWA_74

1129884 : 1137831

Ralstonia_virus(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527232.1\|1129884_1130994_+	class II histone deacetylase	A0A2K9L2T7	Tupanvirus	3.1e-37	31.6
WP_009980362.1\|1131188_1131812_+	phospholipase D family protein	NA	NA	NA	NA
WP_004534930.1\|1131938_1132121_-	hypothetical protein	NA	NA	NA	NA
WP_004550288.1\|1133060_1133522_+	avidin	NA	NA	NA	NA
WP_004527234.1\|1133597_1133831_+	hypothetical protein	A4PE26	Ralstonia_virus	4.3e-13	60.6
WP_004531416.1\|1133866_1134094_-	hypothetical protein	Q8W6S4	Burkholderia_virus	3.8e-22	75.8
WP_009937072.1\|1134347_1134743_+	hypothetical protein	NA	NA	NA	NA
WP_024430095.1\|1135023_1135449_+	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	3.8e-15	49.4
WP_060546905.1\|1135445_1135952_+	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	5.1e-19	39.4
WP_053293552.1\|1136293_1136896_+	hypothetical protein	NA	NA	NA	NA
WP_038728419.1\|1136902_1137625_+	LysR family transcriptional regulator	A4PE26	Ralstonia_virus	1.9e-30	39.9
WP_071897863.1\|1137645_1137831_-	hypothetical protein	Q8W6S4	Burkholderia_virus	4.4e-21	85.2

DBSCAN-SWA_75

1143081 : 1143807

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004199523.1\|1143081_1143807_+	two-component system response regulator OmpR	W8CYM9	Bacillus_phage	8.1e-34	36.7

DBSCAN-SWA_76

1179143 : 1179740

Pandoravirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004536431.1\|1179143_1179740_-\|tRNA	tRNA adenosine(34) deaminase TadA	S4VYT2	Pandoravirus	2.6e-06	30.7

DBSCAN-SWA_77

1184366 : 1188233

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004540130.1\|1184366_1185986_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	2.9e-15	29.1
WP_004192833.1\|1186772_1188233_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	1.5e-92	38.7

DBSCAN-SWA_78

1193798 : 1198362

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004197080.1\|1193798_1194245_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	2.2e-26	42.8
WP_004192895.1\|1194373_1195321_-	SPFH/Band 7/PHB domain protein	NA	NA	NA	NA
WP_004192504.1\|1195400_1195835_-	hypothetical protein	NA	NA	NA	NA
WP_004193522.1\|1195962_1198362_-	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	9.8e-169	36.1

DBSCAN-SWA_79

1204485 : 1205130

Emiliania_huxleyi_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538183.1\|1204485_1205130_-	ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	2.5e-26	42.0

DBSCAN-SWA_80

1215238 : 1216021

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527291.1\|1215238_1216021_-	di-trans,poly-cis-decaprenylcistransferase	R9W0U9	Flavobacterium_phage	7.2e-20	39.6

DBSCAN-SWA_81

1225357 : 1227963

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004193946.1\|1225357_1225891_-	peptide deformylase	A0A0E3FIY1	Synechococcus_phage	2.3e-09	32.9
WP_060546916.1\|1225887_1227963_-	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	4.5e-146	44.6

DBSCAN-SWA_82

1241095 : 1243661

Canarypox_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192400.1\|1241095_1241575_-	glutathione peroxidase	Q6VZR0	Canarypox_virus	8.2e-27	39.9
WP_004527300.1\|1241720_1243661_+	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	5.1e-59	30.5

DBSCAN-SWA_83

1253965 : 1255507

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004521171.1\|1253965_1255507_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.2e-42	29.5

DBSCAN-SWA_84

1268238 : 1271937

Klosneuvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041190068.1\|1268238_1269282_+	patatin-like phospholipase family protein	A0A1V0SKV5	Klosneuvirus	6.4e-08	27.2
WP_004193992.1\|1269447_1270152_-	C40 family peptidase	A0A217EQL1	Bacillus_phage	1.3e-20	39.4
WP_004192088.1\|1270287_1271937_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-21	33.7

DBSCAN-SWA_85

1288725 : 1289790

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017881607.1\|1288725_1289790_-	cysteine synthase family protein	A0A1W6JHY1	Lactococcus_phage	8.0e-22	31.2

DBSCAN-SWA_86

1293038 : 1298215

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004524767.1\|1293038_1294133_-	phosphoserine transaminase	M1Q1P2	Streptococcus_phage	1.1e-74	43.0
WP_038732243.1\|1294173_1295301_-	acyltransferase	A0A1R3Y5Q6	Salmonella_virus	5.9e-07	24.9
WP_038794247.1\|1295352_1296486_-	hypothetical protein	NA	NA	NA	NA
WP_004192821.1\|1296482_1297394_-	transketolase	NA	NA	NA	NA
WP_060546921.1\|1297390_1298215_-	transketolase	A0A0P0YMZ3	Yellowstone_lake_phycodnavirus	1.9e-15	35.8

DBSCAN-SWA_87

1302708 : 1311648

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060546922.1\|1302708_1311648_-	non-ribosomal peptide synthetase	A0A2K9L3I8	Tupanvirus	1.9e-60	24.9

DBSCAN-SWA_88

1314706 : 1316545

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060546923.1\|1314706_1316545_-	non-ribosomal peptide synthetase	A0A2K9L3I8	Tupanvirus	1.9e-34	23.7

DBSCAN-SWA_89

1320771 : 1323918

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038752705.1\|1320771_1323918_+	MMPL family transporter	S5VTK5	Leptospira_phage	1.3e-51	21.2

DBSCAN-SWA_90

1331191 : 1402129

uncultured_Caudovirales_phage(27.03%)

integrase,plate,protease,head,tail,portal,terminase,tRNA,capsid

attL 1375026:1375043|attR 1391175:1391192

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060546927.1\|1331191_1332670_-\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_004193249.1\|1332713_1333685_-	acetyl-CoA carboxylase carboxyltransferase subunit alpha	NA	NA	NA	NA
WP_012730566.1\|1333788_1334727_-	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
WP_004192752.1\|1334774_1336172_-\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	1.8e-42	33.8
WP_011851871.1\|1336403_1337126_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_060546928.1\|1337182_1337758_+	peptidylprolyl isomerase	A0A1V0SCU1	Indivirus	2.4e-12	39.3
WP_004193779.1\|1337838_1338330_+	peptidyl-prolyl cis-trans isomerase	A0A1V0SCU1	Indivirus	4.2e-10	33.3
WP_004550230.1\|1338354_1339155_+	UDP-2,3-diacylglucosamine diphosphatase	NA	NA	NA	NA
WP_004193377.1\|1339501_1340287_-	serine O-acetyltransferase	NA	NA	NA	NA
WP_004552788.1\|1340477_1341389_-	RNA methyltransferase	NA	NA	NA	NA
WP_004532151.1\|1341394_1341646_-	hypothetical protein	NA	NA	NA	NA
WP_004191664.1\|1341689_1342493_+	inositol monophosphatase	NA	NA	NA	NA
WP_009980718.1\|1342772_1343045_-	hypothetical protein	NA	NA	NA	NA
WP_004191077.1\|1343228_1343408_-	hypothetical protein	NA	NA	NA	NA
WP_076900745.1\|1344244_1344484_+	DNA mismatch repair protein	NA	NA	NA	NA
WP_038773158.1\|1344789_1345674_+	hypothetical protein	NA	NA	NA	NA
WP_128972300.1\|1345759_1346536_+	hypothetical protein	NA	NA	NA	NA
WP_128972301.1\|1346789_1347053_-	hypothetical protein	NA	NA	NA	NA
WP_038714125.1\|1347068_1347644_-	PIN domain-containing protein	K4HZX4	Acidithiobacillus_phage	3.1e-73	71.0
WP_004540053.1\|1347648_1348110_-	excisionase family DNA-binding protein	K4ICM4	Acidithiobacillus_phage	6.7e-50	67.3
WP_134864196.1\|1349594_1350722_-	hypothetical protein	Q7Y4B3	Escherichia_virus	3.6e-12	23.1
WP_128972303.1\|1351294_1351675_+	hypothetical protein	NA	NA	NA	NA
WP_060546929.1\|1352072_1352495_+	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	1.9e-14	48.3
WP_060546930.1\|1352491_1352998_+	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	8.7e-19	39.4
WP_038769052.1\|1352990_1353464_+	hypothetical protein	NA	NA	NA	NA
WP_060546931.1\|1353420_1353939_+	hypothetical protein	NA	NA	NA	NA
WP_060546932.1\|1353935_1354679_+	hypothetical protein	A4PE26	Ralstonia_virus	1.2e-37	43.3
WP_060546933.1\|1354714_1355503_-	DNA adenine methylase	Q8W6S4	Burkholderia_virus	5.7e-150	95.8
WP_060546934.1\|1355646_1356192_-	lysozyme	Q8W6S5	Burkholderia_virus	2.3e-81	93.9
WP_060546935.1\|1356191_1356734_-	lysozyme	A4JX20	Burkholderia_virus	5.8e-85	91.2
WP_004533694.1\|1356726_1356921_-	hypothetical protein	NA	NA	NA	NA
WP_060546936.1\|1356996_1358049_-	late control protein	A0A2H4JBF6	uncultured_Caudovirales_phage	1.8e-79	45.1
WP_044369494.1\|1358058_1358265_-\|tail	phage tail protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	1.2e-14	59.7
WP_004552771.1\|1358239_1359121_-\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	8.6e-30	37.0
WP_038794220.1\|1359129_1361541_-\|tail	phage tail tape measure protein	A0A2H4JG00	uncultured_Caudovirales_phage	1.6e-62	35.5
WP_004533642.1\|1361628_1361931_-\|tail	phage tail assembly protein	V5YST8	Pseudomonas_phage	1.5e-05	37.2
WP_004533620.1\|1362000_1362504_-\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	1.2e-41	50.0
WP_014917516.1\|1362514_1363684_-\|tail	phage tail sheath family protein	A0A2H4J869	uncultured_Caudovirales_phage	4.0e-160	72.7
WP_004552412.1\|1363749_1364202_-\|tail	tail assembly chaperone	A4JWL9	Burkholderia_virus	1.4e-44	76.8
WP_038774745.1\|1364217_1365681_-	hypothetical protein	A4JWL8	Burkholderia_virus	7.2e-215	78.4
WP_004547894.1\|1365668_1366244_-\|tail	phage tail protein I	Q6QI98	Burkholderia_phage	6.0e-32	47.7
WP_009909065.1\|1366236_1367130_-\|plate	baseplate J protein	A0A1J0I2M3	Salmonella_phage	8.4e-49	40.5
WP_009927735.1\|1367126_1367471_-	hypothetical protein	A0A2H4JA09	uncultured_Caudovirales_phage	4.0e-23	50.0
WP_038783056.1\|1367467_1367674_-	hypothetical protein	NA	NA	NA	NA
WP_134864197.1\|1367771_1368221_+	hypothetical protein	S4TUD6	Salmonella_phage	3.7e-05	26.4
WP_060546937.1\|1368201_1368882_-\|plate	phage baseplate assembly protein V	A0A1B2LRU5	Wolbachia_phage	4.0e-19	35.7
WP_009944030.1\|1368884_1369418_-	hypothetical protein	Q9JML9	Wolbachia_phage	8.0e-23	39.5
WP_060546938.1\|1369407_1369938_-\|tail	phage tail protein	A0A2H4JBV1	uncultured_Caudovirales_phage	5.4e-11	28.5
WP_060546939.1\|1369939_1370230_-	hypothetical protein	NA	NA	NA	NA
WP_004547853.1\|1370233_1371259_-\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	2.2e-109	59.1
WP_004539732.1\|1371293_1371638_-\|head	head decoration protein	NA	NA	NA	NA
WP_060546940.1\|1371664_1372765_-\|protease	Clp protease ClpP	A0A2H4JDI2	uncultured_Caudovirales_phage	2.5e-47	35.5
WP_009970818.1\|1372761_1374255_-\|portal	phage portal protein	A0A2H4JFL5	uncultured_Caudovirales_phage	5.8e-135	51.2
WP_004533700.1\|1374251_1374458_-	hypothetical protein	NA	NA	NA	NA
WP_082248465.1\|1374468_1376454_-\|terminase	phage terminase large subunit family protein	A0A2D1GMT1	Marinobacter_phage	2.7e-180	53.4
1375026:1375043	attL	NA	NA	NA	NA
WP_004547883.1\|1376416_1376986_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_009935698.1\|1377352_1377727_-	hypothetical protein	NA	NA	NA	NA
WP_004533678.1\|1378074_1378662_-	hypothetical protein	NA	NA	NA	NA
WP_004547868.1\|1381492_1381963_-	hypothetical protein	NA	NA	NA	NA
WP_060547282.1\|1382269_1382635_-	hypothetical protein	NA	NA	NA	NA
WP_009944042.1\|1382636_1383167_-	hypothetical protein	C7BGG0	Burkholderia_phage	4.4e-29	46.8
WP_024430958.1\|1383253_1383463_-	hypothetical protein	NA	NA	NA	NA
WP_004555254.1\|1383579_1384080_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_004555253.1\|1384033_1384522_+	hypothetical protein	NA	NA	NA	NA
WP_128972336.1\|1384656_1384845_+	NlpBDapX lipoprotein	NA	NA	NA	NA
WP_004534202.1\|1384896_1385232_+	hypothetical protein	NA	NA	NA	NA
WP_025369283.1\|1385228_1385834_+	hypothetical protein	NA	NA	NA	NA
WP_060546941.1\|1385830_1386280_+	hypothetical protein	NA	NA	NA	NA
WP_060546942.1\|1386279_1387596_+	ParB N-terminal domain-containing protein	NA	NA	NA	NA
WP_060546943.1\|1387709_1388039_+	hypothetical protein	NA	NA	NA	NA
WP_038727731.1\|1388047_1388521_+	hypothetical protein	B5TA88	Burkholderia_phage	2.3e-05	71.4
WP_009890227.1\|1388529_1388772_+	AlpA family phage regulatory protein	C7BGF0	Burkholderia_phage	9.3e-19	59.2
WP_004547867.1\|1388722_1390024_-\|integrase	integrase family protein	C7BGE7	Burkholderia_phage	2.3e-148	58.9
WP_060546944.1\|1392855_1394154_+	hypothetical protein	NA	NA	NA	NA
1391175:1391192	attR	NA	NA	NA	NA
WP_004524740.1\|1394133_1394679_-	peptidylprolyl isomerase	NA	NA	NA	NA
WP_038761622.1\|1394747_1395935_+	cupin	NA	NA	NA	NA
WP_004193059.1\|1396659_1397436_-	MBL fold metallo-hydrolase	U5PVD0	Bacillus_phage	3.3e-09	26.6
WP_004524737.1\|1397440_1398583_-	outer membrane protein assembly factor BamC	NA	NA	NA	NA
WP_004191516.1\|1398693_1399596_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_060546945.1\|1399640_1400180_-	hypothetical protein	NA	NA	NA	NA
WP_004191887.1\|1400252_1401455_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_004192745.1\|1401463_1402129_-\|protease	site-2 protease family protein	NA	NA	NA	NA

DBSCAN-SWA_91

1408762 : 1412662

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192585.1\|1408762_1410046_-	phosphopyruvate hydratase	W6LP63	Streptococcus_phage	6.4e-151	62.6
WP_004193658.1\|1410149_1411004_-	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	2.3e-48	40.9
WP_004192790.1\|1411000_1412662_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.9e-150	52.0

DBSCAN-SWA_92

1417156 : 1431128

Lake_Baikal_phage(28.57%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004195923.1\|1417156_1417906_-	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	2.2e-34	38.3
WP_004532144.1\|1417898_1419152_-	lipoprotein-releasing ABC transporter permease subunit	NA	NA	NA	NA
WP_004193226.1\|1419724_1420801_+	hypothetical protein	NA	NA	NA	NA
WP_004191649.1\|1420816_1422511_+	single-stranded-DNA-specific exonuclease RecJ	A0A0K2FM92	Brevibacillus_phage	1.1e-28	27.3
WP_004199566.1\|1422872_1423976_+	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	2.2e-06	37.1
WP_004192783.1\|1424071_1425598_+\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	2.8e-84	35.6
WP_004193508.1\|1425948_1426674_+	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
WP_038792454.1\|1427086_1427296_-	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_004193872.1\|1427314_1427656_-	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_004527365.1\|1427748_1429617_-	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	1.6e-102	41.6
WP_004202016.1\|1429674_1430202_-	Fe-S protein assembly co-chaperone HscB	NA	NA	NA	NA
WP_004191333.1\|1430314_1430638_-	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	8.9e-25	51.4
WP_004192918.1\|1430720_1431128_-	Fe-S cluster assembly scaffold IscU	A0A2H4N7M4	Lake_Baikal_phage	1.2e-50	78.0

DBSCAN-SWA_93

1439973 : 1443498

Streptococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080309967.1\|1439973_1441437_+\|transposase	IS1182-like element ISBma2 family transposase	A0A1X9I5T2	Streptococcus_phage	1.2e-79	38.3
WP_004536178.1\|1441728_1443498_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	6.8e-34	23.8

DBSCAN-SWA_94

1452012 : 1455654

Enterococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004524717.1\|1452012_1452870_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	1.4e-37	39.9
WP_004524715.1\|1453554_1455654_+	M3 family metallopeptidase	A0A1V0SD92	Indivirus	1.7e-39	21.8

DBSCAN-SWA_95

1464583 : 1466137

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004524710.1\|1464583_1466137_+	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	2.9e-20	46.5

DBSCAN-SWA_96

1480181 : 1485403

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192001.1\|1480181_1481174_-	beta-propeller fold lactonase family protein	A0A2H4JCI3	uncultured_Caudovirales_phage	3.5e-11	59.6
WP_060546952.1\|1481275_1485403_-	ATP-dependent RNA helicase HrpA	A0A1V0SBU4	Catovirus	3.3e-47	28.3

DBSCAN-SWA_97

1506708 : 1508232

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527399.1\|1506708_1508232_-	histidine ammonia-lyase	A0A1V0S940	Catovirus	1.6e-76	39.0

DBSCAN-SWA_98

1514318 : 1515779

Bandra_megavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004533992.1\|1514318_1515779_-	deoxyribodipyrimidine photo-lyase	A0A2K9V7Z5	Bandra_megavirus	2.3e-43	28.3

DBSCAN-SWA_99

1524021 : 1525773

Clostridium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192163.1\|1524021_1525773_+	ribonucleoside triphosphate reductase	D9ZNH0	Clostridium_phage	2.2e-133	43.4

DBSCAN-SWA_100

1535083 : 1537006

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012730519.1\|1535083_1537006_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.5e-10	48.8

DBSCAN-SWA_101

1542711 : 1543953

environmental_halophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004199378.1\|1542711_1543953_+	aminotransferase class V-fold PLP-dependent enzyme	Q2XUY6	environmental_halophage	3.5e-77	39.1

DBSCAN-SWA_102

1561846 : 1565453

Burkholderia_virus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_101631221.1\|1561846_1563005_+\|transposase	IS3-like element ISBps2 family transposase	A4JX31	Burkholderia_virus	5.0e-78	99.3
WP_082249503.1\|1563022_1563271_+	ion transporter	NA	NA	NA	NA
WP_004557171.1\|1563593_1564631_-	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_004524643.1\|1564658_1565453_-	ABC transporter ATP-binding protein	M1H3A1	Paramecium_bursaria_Chlorella_virus	1.6e-06	24.9

DBSCAN-SWA_103

1580976 : 1582136

Burkholderia_virus(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_101631221.1\|1580976_1582136_-\|transposase	IS3-like element ISBps2 family transposase	A4JX31	Burkholderia_virus	5.0e-78	99.3

DBSCAN-SWA_104

1588578 : 1590444

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192713.1\|1588578_1590444_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.7e-38	27.1

DBSCAN-SWA_105

1611215 : 1622951

Micromonas_pusilla_virus(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044490403.1\|1611215_1612619_-	ribonuclease III	G8DDA3	Micromonas_pusilla_virus	4.9e-19	30.3
WP_060546965.1\|1612769_1613663_-	signal peptidase I	NA	NA	NA	NA
WP_004193305.1\|1613678_1615472_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	2.1e-22	23.5
WP_009970892.1\|1615463_1615706_+	hypothetical protein	NA	NA	NA	NA
WP_004524616.1\|1615713_1615968_-	glutaredoxin family protein	NA	NA	NA	NA
WP_004527468.1\|1615964_1617473_-\|protease	DegQ family serine endoprotease	A0A1B1IT49	uncultured_Mediterranean_phage	2.8e-20	27.7
WP_004524615.1\|1617489_1618542_-	sigma E factor regulatory protein	NA	NA	NA	NA
WP_038743166.1\|1618547_1619150_-	sigma-E factor negative regulatory protein	NA	NA	NA	NA
WP_004193971.1\|1619233_1619833_-	RNA polymerase sigma factor RpoE	A0A0F6TH34	Sinorhizobium_phage	3.8e-05	27.3
WP_004544154.1\|1619938_1620412_-	hypothetical protein	NA	NA	NA	NA
WP_004193086.1\|1620423_1621662_-	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_004197638.1\|1621818_1622058_-	acyl carrier protein	B2ZXV3	Ralstonia_phage	1.6e-10	47.1
WP_004197597.1\|1622201_1622951_-	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	5.8e-19	30.9

DBSCAN-SWA_106

1641701 : 1646261

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011203830.1\|1641701_1642691_-	D-glycerate dehydrogenase	A0A1B1IVB5	uncultured_Mediterranean_phage	4.1e-12	25.8
WP_004193636.1\|1642756_1644199_-	sodium:proton antiporter	NA	NA	NA	NA
WP_004192015.1\|1644254_1644917_-	lactate utilization protein C	NA	NA	NA	NA
WP_004192078.1\|1645061_1646261_-	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	1.6e-55	34.3

DBSCAN-SWA_107

1659515 : 1660487

Yersinia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189921.1\|1659515_1660487_-	thymidylate synthase	A0A1V0DY05	Yersinia_phage	2.9e-47	36.1

DBSCAN-SWA_108

1666363 : 1666867

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060546971.1\|1666363_1666867_+	dihydrofolate reductase	A0A0A0PL85	Bacillus_phage	1.3e-25	39.8

DBSCAN-SWA_109

1670004 : 1670610

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004535917.1\|1670004_1670610_-	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	4.2e-28	40.4

DBSCAN-SWA_110

1689941 : 1702280

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004190044.1\|1689941_1690976_-	methionine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.8e-26	34.1
WP_063831528.1\|1691283_1692126_+	alpha/beta hydrolase	A7XCB7	Tanapox_virus	7.2e-18	27.2
WP_004522362.1\|1692465_1693389_-	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	2.4e-43	36.2
WP_060546975.1\|1693567_1694821_+	lytic murein transglycosylase B	NA	NA	NA	NA
WP_004532363.1\|1695047_1695950_-	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	1.9e-53	39.9
WP_004189725.1\|1696300_1696618_-	competence protein ComE	NA	NA	NA	NA
WP_004190173.1\|1696689_1697682_-	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	9.1e-28	30.9
WP_060546977.1\|1697740_1698727_-	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	3.3e-14	27.1
WP_011851991.1\|1698695_1700096_-	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	4.2e-79	38.3
WP_011851992.1\|1700216_1701386_-	lipopolysaccharide assembly protein LapB	NA	NA	NA	NA
WP_004195986.1\|1701438_1701732_-	LapA family protein	NA	NA	NA	NA
WP_004189865.1\|1701956_1702280_-	integration host factor subunit beta	A7KV42	Bacillus_phage	4.7e-10	38.9

DBSCAN-SWA_111

1708471 : 1713025

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189993.1\|1708471_1709554_-	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	8.5e-88	47.2
WP_004189806.1\|1709727_1710324_-	DUF2059 domain-containing protein	NA	NA	NA	NA
WP_060546979.1\|1710424_1713025_-	DNA gyrase subunit A	A0A172JHV7	Bacillus_phage	1.2e-100	29.8

DBSCAN-SWA_112

1716378 : 1727046

Burkholderia_virus(85.71%)

integrase,terminase

attL 1706069:1706085|attR 1735987:1736003

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1706069:1706085	attL	NA	NA	NA	NA
WP_038782622.1\|1716378_1717617_+\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	3.9e-121	55.1
WP_038782583.1\|1717625_1718168_+	hypothetical protein	NA	NA	NA	NA
WP_076911959.1\|1718175_1718697_-	hypothetical protein	NA	NA	NA	NA
WP_076911982.1\|1718804_1719071_-	helix-turn-helix domain-containing protein	Q6J1Q0	Burkholderia_virus	6.8e-15	63.2
WP_038768302.1\|1719136_1719391_-	hypothetical protein	NA	NA	NA	NA
WP_038782580.1\|1719777_1720260_+	hypothetical protein	NA	NA	NA	NA
WP_052142585.1\|1720317_1720887_-	hypothetical protein	Q6J1R3	Burkholderia_virus	3.7e-42	76.7
WP_038782618.1\|1720886_1721318_-	hypothetical protein	Q6J1R4	Burkholderia_virus	2.3e-44	60.8
WP_038782579.1\|1721389_1721635_-	hypothetical protein	Q6J1S6	Burkholderia_virus	2.4e-22	67.1
WP_038782578.1\|1721638_1721929_-	hypothetical protein	NA	NA	NA	NA
WP_038782577.1\|1721941_1722619_-	hypothetical protein	NA	NA	NA	NA
WP_038782576.1\|1722618_1723287_-	hypothetical protein	NA	NA	NA	NA
WP_134864201.1\|1723291_1723522_-	hypothetical protein	NA	NA	NA	NA
WP_060546980.1\|1723801_1724524_-\|terminase	terminase small subunit	C5IHM0	Burkholderia_virus	3.4e-85	72.1
WP_082249511.1\|1724742_1727046_-	hypothetical protein	Q6J1N1	Burkholderia_virus	5.8e-118	66.0
1735987:1736003	attR	NA	NA	NA	NA

DBSCAN-SWA_113

1738248 : 1741777

Organic_Lake_phycodnavirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038764768.1\|1738248_1740093_+	tetratricopeptide repeat protein	F2Y1J7	Organic_Lake_phycodnavirus	4.9e-11	31.5
WP_004522345.1\|1740481_1741777_-	MFS transporter	Q6JIH2	Burkholderia_virus	3.2e-65	37.5

DBSCAN-SWA_114

1746731 : 1747754

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522341.1\|1746731_1747754_+	xanthine dehydrogenase accessory protein XdhC	A0A0P0IKN7	Acinetobacter_phage	3.2e-44	37.5

DBSCAN-SWA_115

1760457 : 1761474

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189384.1\|1760457_1761474_+	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	5.4e-52	36.4

DBSCAN-SWA_116

1770667 : 1772162

Croceibacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522325.1\|1770667_1771813_-	DNA polymerase III subunit epsilon	I6R9X8	Croceibacter_phage	1.1e-13	31.0
WP_004522324.1\|1771958_1772162_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.6e-19	74.2

DBSCAN-SWA_117

1775810 : 1779194

Bordetella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194871.1\|1775810_1778180_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A291L9W9	Bordetella_phage	2.0e-12	34.8
WP_004185855.1\|1778246_1778450_-	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_004185877.1\|1778510_1779194_-	guanylate kinase	A0A218KC48	Bacillus_phage	7.4e-13	33.5

DBSCAN-SWA_118

1783593 : 1783803

Ralstonia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004532274.1\|1783593_1783803_+	hypothetical protein	A0A077KET4	Ralstonia_phage	1.0e-10	63.3

DBSCAN-SWA_119

1796236 : 1797352

Ralstonia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_052107011.1\|1796236_1797352_+	phage replication protein	E5F076	Ralstonia_phage	6.4e-30	40.8

DBSCAN-SWA_120

1805681 : 1819047

Ralstonia_phage(28.57%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038731025.1\|1805681_1806272_+	hypothetical protein	A0A0K2QQ53	Ralstonia_phage	2.1e-08	53.8
WP_080293950.1\|1806321_1806636_+	transcriptional regulator	NA	NA	NA	NA
WP_080293890.1\|1806604_1806913_+	type II toxin-antitoxin system MqsA family antitoxin	NA	NA	NA	NA
WP_038757556.1\|1807189_1807432_+	hypothetical protein	NA	NA	NA	NA
WP_038757554.1\|1807640_1808222_-	recombinase family protein	A0A1W5LU24	Ralstonia_phage	1.9e-54	59.1
WP_004186129.1\|1808519_1809821_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.8e-93	44.0
WP_004550097.1\|1809978_1810245_+	DUF2164 domain-containing protein	NA	NA	NA	NA
WP_004185515.1\|1810284_1811595_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	1.8e-79	39.8
WP_004185701.1\|1811781_1812498_-	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_004186104.1\|1812555_1814862_-	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	6.5e-85	50.1
WP_004186294.1\|1815189_1816152_+	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	5.5e-62	44.2
WP_004186084.1\|1816319_1817057_+	DNA mismatch repair protein MutS	NA	NA	NA	NA
WP_060546988.1\|1817082_1817703_+	trimeric intracellular cation channel family protein	NA	NA	NA	NA
WP_004535527.1\|1817928_1819047_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	2.9e-22	34.5

DBSCAN-SWA_121

1822795 : 1824265

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004186165.1\|1822795_1824265_+	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	1.8e-72	34.6

DBSCAN-SWA_122

1829028 : 1839605

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522301.1\|1829028_1829754_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.0e-29	37.7
WP_004522300.1\|1829824_1830844_+	D-cysteine desulfhydrase	NA	NA	NA	NA
WP_011205197.1\|1830840_1831308_+	DUF3088 domain-containing protein	NA	NA	NA	NA
WP_060546989.1\|1831417_1832653_-	Bcr/CflA family multidrug efflux MFS transporter	S4TR35	Salmonella_phage	4.4e-24	25.8
WP_017881163.1\|1832831_1833356_+	hypothetical protein	NA	NA	NA	NA
WP_004185675.1\|1833455_1833914_+	hypothetical protein	NA	NA	NA	NA
WP_004522295.1\|1835633_1836776_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	1.3e-41	33.0
WP_004185756.1\|1836790_1837405_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	4.0e-26	36.2
WP_004527565.1\|1837867_1839004_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	2.8e-49	36.2
WP_004186056.1\|1839083_1839605_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2I2L4Y7	Orpheovirus	5.6e-13	36.8

DBSCAN-SWA_123

1850360 : 1855090

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522284.1\|1850360_1850747_-	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	4.9e-22	48.5
WP_004522282.1\|1851355_1852576_+	hypothetical protein	NA	NA	NA	NA
WP_041218889.1\|1852843_1853572_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	2.5e-51	44.0
WP_060546993.1\|1853839_1855090_-	hypothetical protein	S5M4R0	Bacillus_phage	5.3e-09	25.8

DBSCAN-SWA_124

1867246 : 1868807

Cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004186044.1\|1867246_1868110_+	urea ABC transporter ATP-binding protein UrtD	A0A1M7XV31	Cedratvirus	3.1e-08	23.1
WP_004522269.1\|1868114_1868807_+	urea ABC transporter ATP-binding subunit UrtE	A0A2H4PQG7	Staphylococcus_phage	1.0e-14	25.8

DBSCAN-SWA_125

1878360 : 1879779

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522260.1\|1878360_1879779_-	phosphomannomutase/phosphoglucomutase	A0A127AWJ1	Bacillus_phage	6.6e-56	32.5

DBSCAN-SWA_126

1883306 : 1884329

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527590.1\|1883306_1884329_+	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	1.2e-83	47.2

DBSCAN-SWA_127

1890650 : 1903196

Enterobacteria_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004534033.1\|1890650_1892492_-	glycosyltransferase	A0A1V0SAH6	Catovirus	6.2e-06	31.9
WP_004185767.1\|1892543_1894268_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_004186722.1\|1894271_1895156_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_004186496.1\|1895215_1896307_-	NAD(P)-dependent oxidoreductase	A0A1V0SKV4	Klosneuvirus	7.9e-17	25.2
WP_060547001.1\|1896306_1897545_-	acyltransferase	A9YX16	Burkholderia_phage	4.0e-17	30.2
WP_038745496.1\|1897541_1898951_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_004186421.1\|1898940_1899774_-	ABC transporter permease	NA	NA	NA	NA
WP_004186608.1\|1899800_1900697_-	dTDP-4-dehydrorhamnose reductase	I7HXC9	Enterobacteria_phage	7.4e-21	34.7
WP_004185665.1\|1900693_1901245_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	4.4e-48	52.5
WP_004202440.1\|1901229_1902123_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	2.4e-96	57.7
WP_004522250.1\|1902134_1903196_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	4.6e-86	47.5

DBSCAN-SWA_128

1906804 : 1907836

Only_Syngen_Nebraska_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004534003.1\|1906804_1907836_-	aspartate carbamoyltransferase catalytic subunit	A0A1J0F9B8	Only_Syngen_Nebraska_virus	2.1e-27	33.0

DBSCAN-SWA_129

1912637 : 1914619

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004538665.1\|1912637_1914278_-	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	9.3e-171	62.6
WP_004186661.1\|1914325_1914619_-	co-chaperone GroES	A0A221S4A8	uncultured_virus	9.5e-18	42.6

DBSCAN-SWA_130

1918868 : 1919876

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004200388.1\|1918868_1919876_+	NAD(P)-dependent alcohol dehydrogenase	A0A0K0KVL7	Prochlorococcus_phage	2.9e-05	24.1

DBSCAN-SWA_131

1932555 : 1933998

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004185757.1\|1932555_1933998_+	DHA2 family efflux MFS transporter permease subunit	A0A0M3UL24	Mycobacterium_phage	6.3e-54	36.4

DBSCAN-SWA_132

1946542 : 1955806

Acinetobacter_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522226.1\|1946542_1947334_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.2e-08	26.8
WP_060547008.1\|1947381_1949652_-	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	9.7e-09	32.4
WP_004522224.1\|1950142_1950547_-	SnoaL-like domain-containing protein	NA	NA	NA	NA
WP_004527624.1\|1950731_1951514_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_038747347.1\|1951896_1954260_-	xanthine dehydrogenase molybdopterin binding subunit	A0A0P0I429	Acinetobacter_phage	3.1e-236	56.5
WP_060547009.1\|1954288_1955806_-	xanthine dehydrogenase small subunit	A0A0P0IVM8	Acinetobacter_phage	2.3e-131	52.2

DBSCAN-SWA_133

1962903 : 1963908

Only_Syngen_Nebraska_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522216.1\|1962903_1963908_+	2-hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	3.3e-62	44.7

DBSCAN-SWA_134

1985723 : 1986971

Aeromonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060547012.1\|1985723_1986971_-	serine hydroxymethyltransferase	A0A219YCZ0	Aeromonas_phage	1.2e-93	50.1

DBSCAN-SWA_135

1995503 : 1999074

Cafeteria_roenbergensis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522195.1\|1995503_1996388_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.1e-69	46.2
WP_004533581.1\|1996642_1997578_-	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	1.9e-35	33.7
WP_004522192.1\|1997680_1998232_-	HAD-IIIA family hydrolase	E3T535	Cafeteria_roenbergensis_virus	3.7e-15	32.5
WP_038726326.1\|1998228_1999074_-	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	8.2e-46	40.0

DBSCAN-SWA_136

2030276 : 2034467

Synechococcus_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522168.1\|2030276_2030969_-	NTP transferase domain-containing protein	A0A0G2Y8M0	Acanthamoeba_polyphaga_mimivirus	7.5e-05	28.8
WP_009938567.1\|2030970_2031549_-	D-sedoheptulose 7-phosphate isomerase	A0A067XQR2	Caulobacter_phage	2.5e-17	37.2
WP_004194045.1\|2031545_2032586_-	dehydrogenase	A0A222YW25	Synechococcus_phage	1.7e-61	40.5
WP_004194087.1\|2032601_2033615_-	GDP-mannose 4,6-dehydratase	A0A222YY99	Synechococcus_phage	7.2e-97	52.6
WP_038726335.1\|2033624_2034467_-	sugar nucleotide-binding protein	A0A222YYW2	Synechococcus_phage	9.7e-39	35.0

DBSCAN-SWA_137

2041061 : 2041718

Amsacta_moorei_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194035.1\|2041061_2041718_-	ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	8.7e-11	31.1

DBSCAN-SWA_138

2049043 : 2050471

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004533609.1\|2049043_2050471_+	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	1.1e-53	30.2

DBSCAN-SWA_139

2053689 : 2069500

Wolbachia_phage(12.5%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_043275027.1\|2053689_2055735_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	2.8e-76	32.5
WP_004194103.1\|2055731_2056706_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_060547024.1\|2056723_2057125_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_004194386.1\|2057460_2058516_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SEW4	Cyanophage	2.9e-72	44.7
WP_004196484.1\|2058814_2059540_+	DnaA regulatory inactivator Hda	NA	NA	NA	NA
WP_004194213.1\|2059561_2060248_+	HAD-IB family hydrolase	NA	NA	NA	NA
WP_004522151.1\|2060244_2061792_+	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	4.3e-24	31.2
WP_009971015.1\|2061828_2062356_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_004532195.1\|2062352_2063036_+	deoxynucleoside kinase	A0A249XZR7	Enterococcus_phage	2.0e-05	26.0
WP_004194137.1\|2063100_2063916_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	8.8e-37	33.3
WP_060547025.1\|2064101_2066117_-	bifunctional anthranilate synthase component I family protein/class IV aminotransferase	S4VT78	Pandoravirus	3.1e-51	33.8
WP_004522147.1\|2066150_2067281_-	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	1.7e-22	27.6
WP_004194034.1\|2067547_2069500_-	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	2.7e-148	49.2

DBSCAN-SWA_140

2084124 : 2091755

Paramecium_bursaria_Chlorella_virus(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522140.1\|2084124_2084952_+	carbon-nitrogen hydrolase family protein	M1I6H3	Paramecium_bursaria_Chlorella_virus	9.6e-15	28.0
WP_004194084.1\|2085031_2086528_+\|protease	metalloprotease TldD	NA	NA	NA	NA
WP_004194245.1\|2086527_2086749_+	hypothetical protein	NA	NA	NA	NA
WP_060547028.1\|2086937_2088011_+	3-deoxy-7-phosphoheptulonate synthase AroG	A0A2I6UFP9	Klebsiella_phage	7.2e-79	47.3
WP_004522138.1\|2088289_2089498_-	NO-inducible flavohemoprotein	NA	NA	NA	NA
WP_004201622.1\|2089609_2090182_-	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
WP_060547029.1\|2090345_2091755_+	FAD-binding protein	S4VRT3	Pandoravirus	1.3e-08	30.9

DBSCAN-SWA_141

2099851 : 2103730

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527694.1\|2099851_2100775_-	phosphonate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.0e-21	35.6
WP_004541324.1\|2101008_2102142_-	alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase	NA	NA	NA	NA
WP_038766632.1\|2102153_2102951_-	phosphonate C-P lyase system protein PhnL	A0A2R8FG22	Brazilian_cedratvirus	3.6e-11	28.8
WP_004202168.1\|2102959_2103730_-	phosphonate C-P lyase system protein PhnK	G3M9Y6	Bacillus_virus	1.9e-12	26.2

DBSCAN-SWA_142

2112011 : 2112500

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004200519.1\|2112011_2112500_-	non-specific DNA-binding protein DpsA	A0A2H4N7L5	Lake_Baikal_phage	9.9e-20	36.2

DBSCAN-SWA_143

2115643 : 2116603

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060547036.1\|2115643_2116603_-	hydrogen peroxide-inducible genes activator	A0A2P0ZL89	Lactobacillus_phage	2.2e-07	24.8

DBSCAN-SWA_144

2121124 : 2126172

uncultured_Mediterranean_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194199.1\|2121124_2122318_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	7.2e-88	46.6
WP_004194088.1\|2122745_2123072_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	1.7e-12	42.2
WP_060547038.1\|2123178_2125206_+	protein translocase subunit SecD	NA	NA	NA	NA
WP_004522118.1\|2125221_2126172_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.5e-40	35.1

DBSCAN-SWA_145

2153275 : 2157657

Prochlorococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194285.1\|2153275_2154841_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	4.1e-67	46.7
WP_004196340.1\|2155207_2155750_+	crossover junction endodeoxyribonuclease RuvC	NA	NA	NA	NA
WP_004194029.1\|2155823_2156405_+	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_004194268.1\|2156586_2157657_+	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	3.5e-09	32.5

DBSCAN-SWA_146

2166583 : 2166952

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194247.1\|2166583_2166952_-	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	4.7e-30	58.3

DBSCAN-SWA_147

2175761 : 2177463

uncultured_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038738532.1\|2175761_2176079_+	co-chaperone GroES	A0A221S322	uncultured_virus	3.0e-17	43.6
WP_004522089.1\|2176373_2176628_+	hypothetical protein	NA	NA	NA	NA
WP_004194225.1\|2176737_2177463_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-30	38.9

DBSCAN-SWA_148

2184703 : 2186092

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527739.1\|2184703_2186092_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	3.5e-102	44.8

DBSCAN-SWA_149

2193067 : 2198797

Streptococcus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082249526.1\|2193067_2194444_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	2.4e-79	44.4
WP_038766738.1\|2194475_2195564_-	DNA polymerase III subunit delta	NA	NA	NA	NA
WP_004194132.1\|2195609_2196161_-	lipoprotein	NA	NA	NA	NA
WP_038738837.1\|2196202_2198797_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	5.6e-178	40.3

DBSCAN-SWA_150

2207244 : 2208180

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060547046.1\|2207244_2208180_-	transcriptional regulator CynR	A0A2P0ZL89	Lactobacillus_phage	9.8e-16	24.9

DBSCAN-SWA_151

2215587 : 2216004

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527755.1\|2215587_2216004_+	glyoxalase/bleomycin resistance protein/dioxygenase	A0A2K9L1J4	Tupanvirus	1.6e-10	29.3

DBSCAN-SWA_152

2222678 : 2223179

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194139.1\|2222678_2223179_+	CinA family protein	B5TK85	Pseudomonas_phage	1.7e-30	49.0

DBSCAN-SWA_153

2227473 : 2230978

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024429544.1\|2227473_2228985_-	L-arabinose ABC transporter ATP-binding protein AraG	A0A2H4PQG7	Staphylococcus_phage	1.3e-14	28.5
WP_004522055.1\|2229073_2230069_-	arabinose ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004535276.1\|2230198_2230978_-	SDR family oxidoreductase	W8CYX9	Bacillus_phage	2.3e-10	43.0

DBSCAN-SWA_154

2252120 : 2256687

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194129.1\|2252120_2253332_-	ribonucleotide-diphosphate reductase subunit beta	A0A2H4P762	Pseudomonas_phage	9.7e-32	27.7
WP_071810953.1\|2253395_2253551_-	hypothetical protein	NA	NA	NA	NA
WP_038730838.1\|2253699_2256687_-	ribonucleoside-diphosphate reductase subunit alpha	A0A2H4P767	Pseudomonas_phage	1.2e-168	43.7

DBSCAN-SWA_155

2260530 : 2261082

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194377.1\|2260530_2261082_+	hypoxanthine-guanine phosphoribosyltransferase	A0A1V0SEQ1	Hokovirus	7.8e-05	32.5

DBSCAN-SWA_156

2265361 : 2266480

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194262.1\|2265361_2266480_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	2.8e-62	43.5

DBSCAN-SWA_157

2283815 : 2287070

Streptococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082249529.1\|2283815_2285282_-\|transposase	IS1182-like element ISBma2 family transposase	A0A1X9I5T2	Streptococcus_phage	1.3e-78	38.5
WP_004522022.1\|2285404_2286322_-	UDP-3-O-acyl-N-acetylglucosamine deacetylase	NA	NA	NA	NA
WP_004522021.1\|2286563_2287070_-	peroxiredoxin	M1I839	Pelagibacter_phage	1.3e-25	51.7

DBSCAN-SWA_158

2307360 : 2311249

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004527788.1\|2307360_2309034_-	long-chain fatty acid--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	1.5e-35	26.8
WP_004527789.1\|2309173_2311249_-	molybdopterin oxidoreductase family protein	A0A077SK27	Escherichia_phage	2.5e-56	26.9

DBSCAN-SWA_159

2328179 : 2333659

Acinetobacter_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004186866.1\|2328179_2329673_+	anthranilate synthase component I	A0A0B5J984	Pandoravirus	3.5e-39	30.5
WP_038747521.1\|2329686_2330277_+	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	1.8e-68	59.5
WP_004186823.1\|2330294_2331326_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.6e-80	47.0
WP_004522001.1\|2331388_2332174_+	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	8.4e-53	47.9
WP_060547055.1\|2332184_2332826_+	CYTH domain-containing protein	NA	NA	NA	NA
WP_004521999.1\|2332870_2333659_+	uracil-DNA glycosylase	A0A060Q589	Fruit_bat_alphaherpesvirus	1.4e-52	51.1

DBSCAN-SWA_160

2347850 : 2409669

Burkholderia_phage(33.33%)

plate,tRNA,transposase,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004186903.1\|2347850_2349518_+	energy-dependent translational throttle protein EttA	A0A2K9L0W2	Tupanvirus	5.8e-43	27.9
WP_004186915.1\|2349848_2350472_-	HAD-IA family hydrolase	NA	NA	NA	NA
WP_004186966.1\|2350468_2351020_-	cysteine hydrolase	NA	NA	NA	NA
WP_004527809.1\|2351168_2352983_-	aminopeptidase P family protein	A0A0P0I8D7	Acinetobacter_phage	7.2e-172	49.7
WP_004198580.1\|2353001_2353256_-	hypothetical protein	NA	NA	NA	NA
WP_004521985.1\|2353556_2353799_-	hypothetical protein	NA	NA	NA	NA
WP_004521984.1\|2353851_2355150_+\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_004527811.1\|2355216_2356299_+	peptide chain release factor 1	A0A0S4KWG0	Pseudomonas_phage	6.7e-08	46.6
WP_004534980.1\|2356342_2357200_+	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_004186955.1\|2357279_2357588_+	Grx4 family monothiol glutaredoxin	NA	NA	NA	NA
WP_004521981.1\|2357602_2358199_+	UbiX family flavin prenyltransferase	NA	NA	NA	NA
WP_004521980.1\|2358482_2359271_+	dioxygenase	NA	NA	NA	NA
WP_004527813.1\|2359714_2361316_-	APC family permease	NA	NA	NA	NA
WP_004196837.1\|2361749_2361953_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	6.3e-21	73.1
WP_004521977.1\|2362139_2363402_-	Hsp70 family protein	NA	NA	NA	NA
WP_004198059.1\|2364080_2364686_-	nitroreductase family protein	NA	NA	NA	NA
WP_076911358.1\|2364647_2365169_+	restriction endonuclease subunit R	NA	NA	NA	NA
WP_004198061.1\|2365128_2366412_-	MFS transporter	NA	NA	NA	NA
WP_038723008.1\|2366570_2367215_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_004527819.1\|2367552_2368176_+	DUF1415 domain-containing protein	NA	NA	NA	NA
WP_017881271.1\|2369289_2370426_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_004198068.1\|2370575_2370689_+	hypothetical protein	NA	NA	NA	NA
WP_004521968.1\|2370763_2371882_-	acyltransferase	NA	NA	NA	NA
WP_004202806.1\|2371880_2372360_+	hypothetical protein	NA	NA	NA	NA
WP_038773272.1\|2372319_2372823_-	water stress/hypersensitive response domain-containing protein	NA	NA	NA	NA
WP_017881272.1\|2373426_2375583_+	peptidase M1	A0A0P0IY26	Acinetobacter_phage	1.9e-46	27.1
WP_004535992.1\|2376164_2376563_+	hypothetical protein	NA	NA	NA	NA
WP_004185238.1\|2376638_2376875_+	hypothetical protein	NA	NA	NA	NA
WP_004204906.1\|2376977_2377208_+	hypothetical protein	NA	NA	NA	NA
WP_004521964.1\|2377441_2377798_-	hypothetical protein	NA	NA	NA	NA
WP_004199991.1\|2377823_2379092_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_004521963.1\|2379106_2381368_+	peptidase domain-containing ABC transporter	A0A2R8FG22	Brazilian_cedratvirus	2.3e-10	31.9
WP_060547063.1\|2381364_2382813_+	TolC family protein	NA	NA	NA	NA
WP_060547064.1\|2383022_2383991_-	hypothetical protein	NA	NA	NA	NA
WP_004199998.1\|2384116_2384968_+	M15 family metallopeptidase	NA	NA	NA	NA
WP_038773270.1\|2385246_2389140_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_004200003.1\|2389136_2390126_+	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_041195956.1\|2390130_2391063_+	OmpA family protein	NA	NA	NA	NA
WP_004527835.1\|2391254_2392376_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_060547065.1\|2392465_2395135_-	type VI secretion system ATPase TssH	A0A223W0B1	Agrobacterium_phage	1.5e-88	32.0
WP_004200010.1\|2395168_2396269_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_004527836.1\|2396232_2398071_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_004204912.1\|2398150_2398633_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_004527837.1\|2398690_2399194_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_004521953.1\|2399266_2400757_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_004521952.1\|2400773_2401292_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_060547066.1\|2401328_2402009_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_004521950.1\|2402385_2403000_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_004521949.1\|2403108_2404455_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_004521948.1\|2404451_2405237_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_038740490.1\|2405339_2405705_+	phage virion morphogenesis protein	K4NZQ8	Burkholderia_phage	1.1e-52	89.3
WP_111952238.1\|2405808_2406399_-	hypothetical protein	NA	NA	NA	NA
WP_082249531.1\|2406794_2407397_-	site-specific DNA-methyltransferase	K4NZW3	Burkholderia_phage	1.1e-81	88.5
WP_038776480.1\|2407294_2407708_-\|tail	phage tail protein I	K4NXA0	Burkholderia_phage	1.5e-69	99.2
WP_004545634.1\|2407700_2408027_-	hypothetical protein	K4NZR5	Burkholderia_phage	4.3e-51	97.2
WP_158510030.1\|2408251_2408650_+	hypothetical protein	NA	NA	NA	NA
WP_122651352.1\|2408549_2409669_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5

DBSCAN-SWA_161

2415327 : 2425593

Liberibacter_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038747574.1\|2415327_2417700_-	AAA domain-containing protein	K4I1H4	Acidithiobacillus_phage	5.3e-42	37.5
WP_080278804.1\|2417705_2418458_-	M48 family metallopeptidase	NA	NA	NA	NA
WP_060547067.1\|2418462_2421780_-	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	6.1e-68	27.5
WP_080278803.1\|2421779_2423108_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_038747580.1\|2423100_2425593_-	SAM-dependent DNA methyltransferase	A0A220A2U4	Liberibacter_phage	6.3e-78	36.3

DBSCAN-SWA_162

2430022 : 2431804

Ralstonia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038747586.1\|2430022_2431804_-	hypothetical protein	A0A1L7N0M1	Ralstonia_phage	3.4e-49	30.8

DBSCAN-SWA_163

2436215 : 2438259

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038747599.1\|2436215_2437211_-	endonuclease	A6XMH8	Bacillus_virus	2.5e-54	40.5
WP_038747601.1\|2437287_2438259_-	DUF932 domain-containing protein	A0A0H4INH5	Stenotrophomonas_phage	3.1e-57	42.0

DBSCAN-SWA_164

2453520 : 2456692

Vibrio_phage(33.33%)

integrase,protease

attL 2452952:2452968|attR 2457427:2457443

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2452952:2452968	attL	NA	NA	NA	NA
WP_050042693.1\|2453520_2453733_-	AlpA family phage regulatory protein	A0A1V0E8E5	Vibrio_phage	2.3e-05	42.6
WP_134864213.1\|2453976_2454687_-	hypothetical protein	NA	NA	NA	NA
WP_060547071.1\|2454683_2455883_-\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	1.1e-107	50.5
WP_004554066.1\|2456170_2456692_-\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	1.9e-21	51.0
2457427:2457443	attR	NA	NA	NA	NA

DBSCAN-SWA_165

2461238 : 2463572

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004521939.1\|2461238_2462447_+	Do family serine endopeptidase	A0A1B1IRD3	uncultured_Mediterranean_phage	8.5e-12	31.9
WP_004199900.1\|2462789_2463572_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	8.7e-26	29.7

DBSCAN-SWA_166

2469844 : 2470915

Faustovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038725049.1\|2469844_2470915_-	histidinol-phosphate transaminase	A0A1X7BZP2	Faustovirus	8.0e-14	26.3

DBSCAN-SWA_167

2475539 : 2476466

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004521934.1\|2475539_2476466_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.0e-21	29.7

DBSCAN-SWA_168

2480124 : 2480943

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004199931.1\|2480124_2480943_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.4e-20	29.4

DBSCAN-SWA_169

2497667 : 2499556

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004196745.1\|2497667_2498429_-	glycerophosphodiester phosphodiesterase	M1HTS7	Paramecium_bursaria_Chlorella_virus	2.8e-13	27.0
WP_060547074.1\|2498473_2499556_-	sn-glycerol-3-phosphate import ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	9.6e-23	34.4

DBSCAN-SWA_170

2540677 : 2555785

Klosneuvirus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004198356.1\|2540677_2541868_-	elongation factor Tu	A0A1V0SLW6	Klosneuvirus	1.5e-13	27.9
WP_004198357.1\|2541909_2544012_-	elongation factor G	E4ZFJ7	Streptococcus_phage	9.8e-56	26.9
WP_004198359.1\|2544133_2544604_-	30S ribosomal protein S7	NA	NA	NA	NA
WP_004521903.1\|2544774_2545155_-	30S ribosomal protein S12	NA	NA	NA	NA
WP_004198363.1\|2545370_2547218_-	DNA helicase RecQ	F2NZ48	Diadromus_pulchellus_ascovirus	3.1e-74	41.7
WP_004521902.1\|2547418_2551657_-	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	2.3e-72	27.9
WP_004198365.1\|2551678_2555785_-	DNA-directed RNA polymerase subunit beta	E3T4Z4	Cafeteria_roenbergensis_virus	4.6e-25	21.4

DBSCAN-SWA_171

2559774 : 2560965

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004198356.1\|2559774_2560965_-	elongation factor Tu	A0A1V0SLW6	Klosneuvirus	1.5e-13	27.9

DBSCAN-SWA_172

2585718 : 2586405

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004197905.1\|2585718_2586405_+	orotate phosphoribosyltransferase	S4VS55	Pandoravirus	1.2e-15	28.1

DBSCAN-SWA_173

2607345 : 2616771

Stenotrophomonas_phage(40.0%)

integrase

attL 2596982:2596997|attR 2617798:2617813

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2596982:2596997	attL	NA	NA	NA	NA
WP_038734107.1\|2607345_2608803_-	type I restriction-modification system subunit M	A0A220A2U5	Liberibacter_phage	1.1e-18	25.5
WP_038734106.1\|2608876_2612344_-	type I restriction-modification system endonuclease	A0A221J782	Mycobacterium_phage	9.0e-06	24.7
WP_038783472.1\|2612883_2613459_-	recombinase family protein	A0A0F7LA37	Escherichia_phage	9.3e-25	43.3
WP_080297929.1\|2614085_2614388_-	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_134864215.1\|2614461_2614953_-	hypothetical protein	NA	NA	NA	NA
WP_038734104.1\|2615089_2616310_-\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	1.9e-120	55.0
WP_038734103.1\|2616312_2616771_-	DUF4102 domain-containing protein	B7SYF8	Stenotrophomonas_phage	8.7e-18	49.5
2617798:2617813	attR	NA	NA	NA	NA

DBSCAN-SWA_174

2620431 : 2622965

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004554632.1\|2620431_2621067_-	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	1.6e-22	63.1
WP_004541818.1\|2621667_2622312_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_004195773.1\|2622308_2622965_+	hypothetical protein	A0A2L0UZL4	Agrobacterium_phage	1.1e-32	38.2

DBSCAN-SWA_175

2635049 : 2636471

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004198634.1\|2635049_2636471_-	adenosylhomocysteinase	S4VPF6	Pandoravirus	7.6e-44	30.1

DBSCAN-SWA_176

2647575 : 2647971

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004185006.1\|2647575_2647971_-	chemotaxis protein CheY	Q56AR1	Bacillus_thuringiensis_phage	2.7e-07	32.8

DBSCAN-SWA_177

2672213 : 2673362

Stenotrophomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004198210.1\|2672213_2673362_+	DegT/DnrJ/EryC1/StrS family aminotransferase	A0A2D2W2B8	Stenotrophomonas_phage	1.7e-09	26.1

DBSCAN-SWA_178

2691066 : 2694874

Apis_mellifera_filamentous_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060547088.1\|2691066_2691711_-	lytic polysaccharide monooxygenase	A0A0K1Y848	Apis_mellifera_filamentous_virus	3.4e-07	30.5
WP_004266306.1\|2692214_2692532_-	hypothetical protein	NA	NA	NA	NA
WP_004195757.1\|2692748_2692973_+	hypothetical protein	NA	NA	NA	NA
WP_038759024.1\|2693866_2694874_+	ATP-binding protein	E5ESM9	Bathycoccus_sp._RCC1105_virus	9.6e-17	27.9

DBSCAN-SWA_179

2699637 : 2702104

Burkholderia_virus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085955848.1\|2699637_2700797_-\|transposase	IS3-like element ISBps2 family transposase	A4JX31	Burkholderia_virus	5.0e-78	99.3
WP_122651352.1\|2700984_2702104_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5

DBSCAN-SWA_180

2707405 : 2719835

Ralstonia_phage(60.0%)

integrase

attL 2705322:2705373|attR 2716175:2716226

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2705322:2705373	attL	NA	NA	NA	NA
WP_045588412.1\|2707405_2708149_-\|integrase	site-specific integrase	A0A0S2SYQ7	Pseudomonas_phage	1.1e-54	46.5
WP_038780225.1\|2708360_2709140_-	hypothetical protein	A0A1W5LU59	Ralstonia_phage	1.3e-34	41.4
WP_038738754.1\|2709666_2709900_+	hypothetical protein	NA	NA	NA	NA
WP_060547089.1\|2709913_2711290_-	type II secretory pathway protein	NA	NA	NA	NA
WP_038738752.1\|2711286_2712192_-	AAA family ATPase	Q6UAZ2	Ralstonia_phage	4.9e-28	37.7
WP_009938962.1\|2712188_2712470_-	DUF2523 domain-containing protein	NA	NA	NA	NA
WP_060547090.1\|2712466_2714200_-	hypothetical protein	NA	NA	NA	NA
WP_004542809.1\|2714263_2714470_-	hypothetical protein	NA	NA	NA	NA
WP_004542799.1\|2714653_2714860_-	hypothetical protein	NA	NA	NA	NA
WP_038735841.1\|2714943_2715246_-	hypothetical protein	W6CMZ9	Ralstonia_phage	1.5e-13	42.3
WP_038752416.1\|2716528_2717428_+	cytochrome c	NA	NA	NA	NA
2716175:2716226	attR	NA	NA	NA	NA
WP_004524472.1\|2717747_2719835_-	UvrD-helicase domain-containing protein	A7KV33	Bacillus_phage	1.9e-99	35.8

DBSCAN-SWA_181

2726829 : 2729757

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041187793.1\|2726829_2729757_+	aminomethyl-transferring glycine dehydrogenase	M4QFZ1	Prochlorococcus_phage	1.1e-257	51.0

DBSCAN-SWA_182

2748878 : 2751347

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060547095.1\|2748878_2751347_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	5.4e-130	42.8

DBSCAN-SWA_183

2758926 : 2760474

Hepacivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060547097.1\|2758926_2760474_+	AMP-binding protein	Q75ZG1	Hepacivirus	2.0e-29	26.6

DBSCAN-SWA_184

2772167 : 2773898

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024429735.1\|2772167_2773898_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	3.2e-28	29.6

DBSCAN-SWA_185

2783200 : 2790319

Bifidobacterium_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004195818.1\|2783200_2784088_-	ParB/RepB/Spo0J family partition protein	I3NLC2	Bifidobacterium_phage	2.4e-16	34.6
WP_004195817.1\|2784123_2784894_-	ParA family protein	A0A0K2FLP4	Brevibacillus_phage	1.4e-23	33.0
WP_060547100.1\|2784946_2785645_-	16S rRNA (guanine(527)-N(7))-methyltransferase RsmG	NA	NA	NA	NA
WP_060547101.1\|2785641_2787615_-\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
WP_060547298.1\|2787776_2788532_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.2e-09	26.2
WP_038724438.1\|2788534_2790319_-	branched-chain amino acid ABC transporter ATP-binding protein/permease	A0A1M7XV31	Cedratvirus	2.7e-14	29.5

DBSCAN-SWA_186

2798068 : 2801785

Aureococcus_anophage(33.33%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004195807.1\|2798068_2798824_-	ABC transporter ATP-binding protein	A0A076FI99	Aureococcus_anophage	8.2e-05	24.3
WP_004195806.1\|2798820_2799600_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.7e-13	25.0
WP_038771064.1\|2800099_2801785_-\|holin	choline dehydrogenase	A0A1V0S9J5	Catovirus	6.9e-52	29.3

DBSCAN-SWA_187

2820157 : 2822683

Burkholderia_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004195781.1\|2820157_2820436_+	HU family DNA-binding protein	A4JWM7	Burkholderia_virus	8.7e-21	61.8
WP_060547106.1\|2820538_2821879_-	GTP-binding protein	NA	NA	NA	NA
WP_004524535.1\|2822197_2822683_-	lytic transglycosylase domain-containing protein	A0A0A8J856	Ralstonia_phage	9.3e-10	43.2

DBSCAN-SWA_188

2851114 : 2851912

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004199877.1\|2851114_2851912_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.5e-30	35.3

DBSCAN-SWA_189

2856855 : 2861941

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038780259.1\|2856855_2858871_+	site-specific DNA-methyltransferase	A0A2K5B2C1	Erysipelothrix_phage	4.3e-85	33.5
WP_038726587.1\|2858911_2861941_+	DEAD/DEAH box helicase family protein	A0A2K5B256	Erysipelothrix_phage	3.4e-182	38.8

DBSCAN-SWA_190

2865060 : 2866887

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038747812.1\|2865060_2865792_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	2.7e-05	25.3
WP_043289848.1\|2866164_2866887_-	ATP-binding cassette domain-containing protein	A0A2R8FG22	Brazilian_cedratvirus	4.2e-06	27.9

DBSCAN-SWA_191

2873106 : 2875659

Trichoplusia_ni_ascovirus(50.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060547113.1\|2873106_2873904_-	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	2.1e-11	27.6
WP_004524564.1\|2873988_2875659_-\|holin	glucose-methanol-choline (GMC) oxidoreductase	A0A1V0SI18	Klosneuvirus	6.0e-56	31.1

DBSCAN-SWA_192

2908060 : 2909180

Leptospira_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038802333.1\|2908060_2909180_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5

DBSCAN-SWA_193

2915810 : 2923979

Caulobacter_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009917967.1\|2915810_2916020_+	KTSC domain-containing protein	A0A0K1LMB5	Caulobacter_phage	3.0e-10	47.8
WP_038771266.1\|2916090_2916810_-	toll/interleukin-1 receptor domain-containing protein	NA	NA	NA	NA
WP_004196276.1\|2917041_2919510_-	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	9.3e-114	34.4
WP_004196275.1\|2919698_2920802_-	DNA polymerase III subunit beta	B4UTW9	Rhizobium_phage	1.7e-46	34.0
WP_076805040.1\|2920964_2922719_-	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
WP_004198824.1\|2923011_2923146_+	50S ribosomal protein L34	NA	NA	NA	NA
WP_038716494.1\|2923162_2923630_+	ribonuclease P protein component	NA	NA	NA	NA
WP_004198815.1\|2923709_2923979_+	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	2.1e-16	53.6

DBSCAN-SWA_194

2934643 : 2939888

Acanthamoeba_polyphaga_mimivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004523120.1\|2934643_2935738_+	bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	5.0e-19	37.4
WP_060547118.1\|2935734_2936676_+	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
WP_004523118.1\|2936834_2938448_+	glutamate--cysteine ligase	NA	NA	NA	NA
WP_041194981.1\|2938466_2939888_-	RNA polymerase sigma factor RpoD/SigA	A0A2I7SAT0	Vibrio_phage	2.8e-30	33.5

DBSCAN-SWA_195

2944241 : 2946240

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004523110.1\|2944241_2945354_+	histone deacetylase	A0A2K9KZC4	Tupanvirus	3.2e-37	30.8
WP_004189258.1\|2945364_2946240_+	N-carbamoylputrescine amidase	A7IVZ1	Paramecium_bursaria_Chlorella_virus	9.6e-74	47.3

DBSCAN-SWA_196

2952833 : 3042781

Burkholderia_phage(56.14%)

protease,plate,holin,head,tail,portal,terminase,tRNA,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060547120.1\|2952833_2953889_+\|portal	phage portal protein	A4JWQ2	Burkholderia_virus	7.5e-206	99.4
WP_004202809.1\|2953932_2954289_-	putative addiction module antidote protein	A4JWV1	Burkholderia_virus	3.9e-42	100.0
WP_004535781.1\|2954913_2955738_-	hypothetical protein	NA	NA	NA	NA
WP_038743538.1\|2956340_2956745_+	PaaI family thioesterase	NA	NA	NA	NA
WP_004189208.1\|2956782_2957652_+	patatin-like phospholipase family protein	NA	NA	NA	NA
WP_004523104.1\|2957772_2958789_-	D-2-hydroxyacid dehydrogenase family protein	NA	NA	NA	NA
WP_004189230.1\|2959228_2960284_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004523103.1\|2960505_2963115_-	DNA topoisomerase III	A0A2P1ELA0	Moumouvirus	7.7e-18	25.7
WP_004190199.1\|2963325_2963697_-	thioredoxin family protein	NA	NA	NA	NA
WP_038764515.1\|2963756_2964947_-	DNA-protecting protein DprA	S6BFL3	Thermus_phage	2.0e-21	39.2
WP_004525852.1\|2965175_2965679_+	peptide deformylase	A0A067XQZ3	Caulobacter_phage	2.1e-12	34.3
WP_004549892.1\|2965710_2966694_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	1.3e-07	38.0
WP_060547122.1\|2966814_2967450_+	LysE family translocator	NA	NA	NA	NA
WP_004189409.1\|2967559_2968417_+\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA
WP_004537745.1\|2968962_2970372_+	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
WP_004188929.1\|2970368_2970959_+	DUF4390 domain-containing protein	NA	NA	NA	NA
WP_004523096.1\|2970960_2973369_+	PAS domain-containing sensor histidine kinase	NA	NA	NA	NA
WP_004189647.1\|2973369_2974053_+	response regulator	NA	NA	NA	NA
WP_076836148.1\|2975080_2975422_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_060547124.1\|2976122_2978915_-	hypothetical protein	K4NXL6	Burkholderia_phage	0.0e+00	99.2
WP_038724513.1\|2978926_2979181_-	hypothetical protein	A4JWQ9	Burkholderia_virus	4.5e-40	98.8
WP_060547125.1\|2979177_2979537_-	hypothetical protein	K4NXB4	Burkholderia_phage	9.4e-60	98.3
WP_004524469.1\|2979539_2979746_-	hypothetical protein	K4NZT3	Burkholderia_phage	2.7e-35	100.0
WP_004531069.1\|2979914_2980154_-	hypothetical protein	K4PAZ5	Burkholderia_phage	1.4e-35	100.0
WP_004524467.1\|2980157_2980352_-	hypothetical protein	K4NXL1	Burkholderia_phage	1.6e-26	100.0
WP_038738765.1\|2980395_2980593_-	hypothetical protein	K4NZY3	Burkholderia_phage	4.0e-28	98.5
WP_004549898.1\|2980598_2980817_-	hypothetical protein	K4NXB1	Burkholderia_phage	1.1e-34	100.0
WP_060547126.1\|2980832_2981378_-	Bro-N domain-containing protein	K4NZS9	Burkholderia_phage	1.7e-97	99.4
WP_004549899.1\|2981463_2981712_-	ogr/Delta-like zinc finger family protein	K4PAZ0	Burkholderia_phage	3.0e-41	100.0
WP_004549900.1\|2981699_2981996_-	phage DNA-binding protein	E5E3P2	Burkholderia_phage	5.4e-37	84.3
WP_004524462.1\|2981999_2982236_-	hypothetical protein	K4NZX7	Burkholderia_phage	6.9e-35	98.7
WP_009935904.1\|2982319_2982814_+	helix-turn-helix transcriptional regulator	E5E3P4	Burkholderia_phage	8.7e-56	77.0
WP_038798608.1\|2982829_2983579_+	phage-encoded membrane protein	E5E3P5	Burkholderia_phage	3.6e-53	43.1
WP_004524459.1\|2983621_2984122_+	hypothetical protein	NA	NA	NA	NA
WP_060547127.1\|2984129_2985227_-	phage late control D family protein	A4JWS1	Burkholderia_virus	8.4e-200	98.4
WP_009935906.1\|2985226_2985652_-\|tail	phage tail protein	A4JWS2	Burkholderia_virus	3.3e-72	99.3
WP_060547128.1\|2985669_2988630_-	hypothetical protein	A4JWX4	Burkholderia_virus	0.0e+00	99.8
WP_004552648.1\|2988632_2988746_-\|tail	GpE family phage tail protein	A0A089FGX3	Burkholderia_phage	5.4e-14	100.0
WP_038773368.1\|2988754_2989099_-\|tail	phage tail assembly protein	K4NXA3	Burkholderia_phage	8.8e-55	99.1
WP_004524455.1\|2989156_2989666_-\|tail	phage major tail tube protein	K4NZR9	Burkholderia_phage	4.9e-94	100.0
WP_060547129.1\|2989681_2990854_-\|tail	phage tail sheath protein	A4JWS7	Burkholderia_virus	6.4e-222	99.0
WP_038788701.1\|2990909_2991581_-\|tail	caudovirales tail fiber assembly protein	A4JWS8	Burkholderia_virus	4.6e-116	99.1
WP_060547299.1\|2991597_2993961_-	hypothetical protein	K4NZW8	Burkholderia_phage	0.0e+00	99.4
WP_060547130.1\|2993971_2994526_-\|tail	phage tail protein I	K4NXA0	Burkholderia_phage	7.2e-99	98.4
WP_011204758.1\|2994518_2995424_-\|plate	baseplate assembly protein	A4JWT1	Burkholderia_virus	6.1e-164	99.7
WP_038732417.1\|2995420_2995783_-\|plate	baseplate assembly protein	K4PAX6	Burkholderia_phage	4.3e-60	98.3
WP_038796050.1\|2995779_2996460_-\|plate	phage baseplate assembly protein V	K4NXJ5	Burkholderia_phage	7.4e-122	98.7
WP_041193913.1\|2996633_2997392_+	site-specific DNA-methyltransferase	K4NZW3	Burkholderia_phage	2.9e-135	94.3
WP_011204760.1\|2997791_2998259_-	phage virion morphogenesis protein	K4NZQ8	Burkholderia_phage	3.9e-74	94.2
WP_038783511.1\|2998255_2998672_-\|tail	phage tail protein	A4JWT7	Burkholderia_virus	2.8e-71	98.6
WP_009941344.1\|2998776_2999217_-	hypothetical protein	K4NXJ2	Burkholderia_phage	2.5e-70	99.3
WP_009941345.1\|2999213_3000026_-	DUF3380 domain-containing protein	A4JWZ0	Burkholderia_virus	1.2e-150	100.0
WP_060547131.1\|3000022_3000295_-\|holin	phage holin family protein	K4NX91	Burkholderia_phage	7.4e-41	98.9
WP_004524439.1\|3000296_3000641_-	membrane protein	K4NZQ3	Burkholderia_phage	2.9e-50	100.0
WP_004524438.1\|3000655_3000862_-\|tail	tail protein	K4PAW7	Burkholderia_phage	2.4e-31	100.0
WP_004524437.1\|3000858_3001110_-	hypothetical protein	K4NXI9	Burkholderia_phage	7.6e-40	100.0
WP_009979065.1\|3001109_3001589_-\|head	head completion/stabilization protein	K4NZV5	Burkholderia_phage	1.3e-80	99.4
WP_060547132.1\|3001688_3002378_-\|terminase	terminase endonuclease subunit	K4NX86	Burkholderia_phage	6.1e-116	98.7
WP_004531048.1\|3002374_3003388_-\|capsid	phage major capsid protein, P2 family	K4NZP8	Burkholderia_phage	7.2e-190	100.0
WP_038765884.1\|3003421_3004231_-\|capsid	GPO family capsid scaffolding protein	A4JWQ0	Burkholderia_virus	4.8e-144	99.6
WP_038765882.1\|3004374_3006144_+\|terminase	terminase ATPase subunit family protein	A4JWU9	Burkholderia_virus	0.0e+00	99.2
WP_038796190.1\|3006140_3007196_+\|portal	phage portal protein	A4JWV0	Burkholderia_virus	7.5e-206	99.1
WP_004524431.1\|3007302_3007575_+	BrnT family toxin	K4NX81	Burkholderia_phage	1.0e-45	100.0
WP_004524430.1\|3007534_3007807_+	BrnA antitoxin family protein	K4NZP3	Burkholderia_phage	6.3e-48	100.0
WP_158510039.1\|3008337_3008853_-	DUF4411 family protein	NA	NA	NA	NA
WP_076823251.1\|3008836_3009988_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_158510040.1\|3010331_3011072_+	type II toxin-antitoxin system death-on-curing family toxin	E4ZFM2	Streptococcus_phage	9.2e-09	38.1
WP_004190026.1\|3011869_3012604_+	7-cyano-7-deazaguanine synthase QueC	A0A1B0Z0B4	Vibrio_phage	1.6e-50	42.5
WP_004189241.1\|3012697_3013330_+	7-carboxy-7-deazaguanine synthase	R4TAH8	Halovirus	2.1e-06	30.9
WP_004189793.1\|3013349_3013802_+	6-carboxytetrahydropterin synthase QueD	A0A088FAL2	Vibrio_phage	7.6e-14	30.8
WP_004523095.1\|3014223_3015009_+	2-dehydro-3-deoxyglucarate aldolase	NA	NA	NA	NA
WP_004543106.1\|3015005_3015782_+	sel1 repeat family protein	NA	NA	NA	NA
WP_004189171.1\|3016137_3017286_-	rod shape-determining protein RodA	NA	NA	NA	NA
WP_060547134.1\|3017297_3019745_-	penicillin-binding protein 2	NA	NA	NA	NA
WP_004523092.1\|3019928_3020441_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_060547135.1\|3020437_3021517_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_004189550.1\|3021636_3022680_-	rod shape-determining protein	NA	NA	NA	NA
WP_041194991.1\|3023045_3023345_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_004525859.1\|3023457_3024948_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_004523090.1\|3024950_3026423_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_038771918.1\|3026549_3027389_+	polyphosphate kinase	NA	NA	NA	NA
WP_004190029.1\|3027421_3028192_+	exodeoxyribonuclease III	R4TWA8	Phaeocystis_globosa_virus	3.4e-30	33.8
WP_004534096.1\|3028598_3029663_-	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L339	Tupanvirus	1.3e-80	45.8
WP_004531039.1\|3029872_3030817_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_004534253.1\|3031190_3032243_-	M48 family metallopeptidase	NA	NA	NA	NA
WP_004523086.1\|3032232_3033546_-	AmpG family muropeptide MFS transporter	NA	NA	NA	NA
WP_004543091.1\|3033557_3034172_-	methionine biosynthesis protein MetW	NA	NA	NA	NA
WP_004198305.1\|3034168_3035314_-	homoserine O-acetyltransferase	NA	NA	NA	NA
WP_060547136.1\|3035663_3036356_-	nucleoid occlusion factor SlmA	NA	NA	NA	NA
WP_060547137.1\|3036322_3037126_-	pyrimidine 5'-nucleotidase	NA	NA	NA	NA
WP_004200214.1\|3037122_3038022_-	acetylglutamate kinase	NA	NA	NA	NA
WP_004198312.1\|3038346_3038598_+	cysteine-rich CWC family protein	NA	NA	NA	NA
WP_004198314.1\|3038615_3039896_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_004198315.1\|3039915_3040458_+	response regulator transcription factor	NA	NA	NA	NA
WP_004198316.1\|3040891_3042235_-\|protease	ATP-dependent protease ATPase subunit HslU	A0A191ZC11	Erwinia_phage	3.7e-40	28.8
WP_004203414.1\|3042244_3042781_-\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA

DBSCAN-SWA_197

3046621 : 3051600

Mycobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004523080.1\|3046621_3047554_-	tyrosine recombinase XerC	G1JX48	Mycobacterium_phage	2.4e-14	28.0
WP_004199066.1\|3047591_3048305_-	DUF484 family protein	NA	NA	NA	NA
WP_038723722.1\|3048352_3049222_-	diaminopimelate epimerase	NA	NA	NA	NA
WP_004534286.1\|3049262_3050147_-	lauroyl acyltransferase	NA	NA	NA	NA
WP_004199069.1\|3050412_3051600_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	2.2e-121	60.7

DBSCAN-SWA_198

3063717 : 3065361

Orpheovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004198976.1\|3063717_3065361_+	GMC family oxidoreductase	A0A2I2L3D3	Orpheovirus	2.9e-31	27.0

DBSCAN-SWA_199

3087887 : 3089180

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004266303.1\|3087887_3089180_+	MFS transporter	Q6JIH2	Burkholderia_virus	8.6e-95	45.5

DBSCAN-SWA_200

3093372 : 3095378

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004525887.1\|3093372_3094365_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.0e-18	31.8
WP_004523051.1\|3094361_3095378_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.9e-17	28.4

DBSCAN-SWA_201

3103427 : 3108413

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004197235.1\|3103427_3105383_+	lytic transglycosylase domain-containing protein	A0A0S2SXL7	Bacillus_phage	5.6e-13	33.1
WP_009979730.1\|3105504_3106464_+	complex I NDUFA9 subunit family protein	NA	NA	NA	NA
WP_004523045.1\|3106527_3107175_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_004197240.1\|3107171_3108413_+	multifunctional CCA addition/repair protein	A0A0F6YPT7	Sinorhizobium_phage	2.3e-81	42.8

DBSCAN-SWA_202

3124980 : 3126288

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004197818.1\|3124980_3126288_+	permease	Q9KX94	Enterobacteria_phage	5.3e-161	70.7

DBSCAN-SWA_203

3144612 : 3151235

Dickeya_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189990.1\|3144612_3145953_+	argininosuccinate synthase	A0A140XAJ5	Dickeya_phage	1.8e-55	82.5
WP_004197840.1\|3146237_3146741_+	hypothetical protein	NA	NA	NA	NA
WP_004525920.1\|3146848_3147556_+	hypothetical protein	NA	NA	NA	NA
WP_038752049.1\|3147925_3148126_+	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_060547149.1\|3148706_3151235_-	heavy metal translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.6e-65	32.3

DBSCAN-SWA_204

3161594 : 3166425

Paramecium_bursaria_Chlorella_virus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189813.1\|3161594_3163427_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	1.3e-141	47.0
WP_004542878.1\|3163490_3164852_-	UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	A0A2K9L277	Tupanvirus	1.2e-30	33.8
WP_004189298.1\|3165429_3166425_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	1.7e-106	70.5

DBSCAN-SWA_205

3173657 : 3175217

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189860.1\|3173657_3175217_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	7.6e-13	35.4

DBSCAN-SWA_206

3184844 : 3186065

Burkholderia_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004525642.1\|3184844_3186065_+\|transposase	ISL3-like element ISBma1 family transposase	A9YX10	Burkholderia_phage	2.7e-239	99.8

DBSCAN-SWA_207

3225812 : 3226997

Emiliania_huxleyi_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189736.1\|3225812_3226997_-	8-amino-7-oxononanoate synthase	G9E4Q1	Emiliania_huxleyi_virus	3.9e-17	24.1

DBSCAN-SWA_208

3230893 : 3231571

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004534292.1\|3230893_3231571_-	SDR family oxidoreductase	Q56AQ6	Bacillus_thuringiensis_phage	6.7e-06	31.5

DBSCAN-SWA_209

3237082 : 3238729

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004530980.1\|3237082_3238729_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2I4R674	Erysipelothrix_phage	1.5e-19	26.1

DBSCAN-SWA_210

3250759 : 3251839

Dickeya_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004204527.1\|3250759_3251839_-	5-methyltetrahydrofolate--homocysteine methyltransferase	A0A140XBC7	Dickeya_phage	8.4e-11	49.2

DBSCAN-SWA_211

3260701 : 3261187

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189202.1\|3260701_3261187_+	D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase	A0A1B1IUK5	uncultured_Mediterranean_phage	2.3e-16	35.9

DBSCAN-SWA_212

3268305 : 3269148

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004190185.1\|3268305_3269148_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	2.4e-21	33.8

DBSCAN-SWA_213

3273867 : 3275181

Stx2-converting_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004530969.1\|3273867_3275181_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	2.5e-65	39.5

DBSCAN-SWA_214

3310786 : 3312559

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004553810.1\|3310786_3312559_+	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	4.3e-12	27.9

DBSCAN-SWA_215

3316806 : 3319373

Rhizobium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004200200.1\|3316806_3317067_+	glutaredoxin 3	V9QKN6	Rhizobium_phage	3.4e-11	46.8
WP_004198004.1\|3317183_3317663_+	protein-export chaperone SecB	NA	NA	NA	NA
WP_060547166.1\|3317688_3318687_+	NAD(P)-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_038729043.1\|3318839_3319373_+	O-acetyl-ADP-ribose deacetylase	F1SVT2	Red_sea_bream_iridovirus	3.5e-34	49.7

DBSCAN-SWA_216

3324518 : 3326126

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004197996.1\|3324518_3326126_+	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	2.6e-08	35.8

DBSCAN-SWA_217

3338360 : 3344704

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004195287.1\|3338360_3339155_+	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	6.6e-05	27.8
WP_004522898.1\|3339361_3340072_+	translesion DNA synthesis-associated protein ImuA	NA	NA	NA	NA
WP_004556702.1\|3340004_3341480_+	DNA polymerase Y family protein	NA	NA	NA	NA
WP_038749030.1\|3341485_3344704_+	error-prone DNA polymerase	R4TMT6	Streptomyces_phage	1.3e-102	28.8

DBSCAN-SWA_218

3348468 : 3352601

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004548112.1\|3348468_3349821_-	diaminobutyrate--2-oxoglutarate transaminase family protein	A0A1V0SKB7	Klosneuvirus	1.6e-19	25.3
WP_004522894.1\|3349865_3350399_-	hypothetical protein	NA	NA	NA	NA
WP_004522893.1\|3350473_3351565_-	ABC transporter permease	NA	NA	NA	NA
WP_004526032.1\|3351557_3352601_-	ATP-binding cassette domain-containing protein	A0A2R8FFL6	Cedratvirus	1.4e-07	29.2

DBSCAN-SWA_219

3358454 : 3360023

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038799689.1\|3358454_3360023_-	acyl-CoA ligase (AMP-forming), exosortase A system-associated	A0A2K9KZV5	Tupanvirus	5.3e-14	22.7

DBSCAN-SWA_220

3366197 : 3367964

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004536235.1\|3366197_3367964_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	1.5e-09	34.2

DBSCAN-SWA_221

3373050 : 3380613

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004540961.1\|3373050_3375648_+	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	3.2e-08	27.1
WP_004522878.1\|3375760_3377521_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_060547171.1\|3378126_3380613_-	family 20 glycosylhydrolase	A0A076G5S5	Staphylococcus_phage	5.8e-07	31.9

DBSCAN-SWA_222

3385645 : 3387515

Salicola_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522872.1\|3385645_3386581_-	RNA polymerase sigma factor RpoH	A0A248SJA5	Salicola_phage	1.6e-37	36.4
WP_004553800.1\|3386945_3387515_+	acyloxyacyl hydrolase	A0A2H4J0I5	uncultured_Caudovirales_phage	1.9e-09	27.4

DBSCAN-SWA_223

3402005 : 3406628

uncultured_Mediterranean_phage(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004195249.1\|3402005_3402506_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	2.9e-30	44.7
WP_004195247.1\|3402568_3402835_+	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	1.4e-20	56.3
WP_004553797.1\|3403015_3404086_-	histidinol-phosphate transaminase	NA	NA	NA	NA
WP_004202941.1\|3404174_3404780_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_004200150.1\|3404893_3405508_-	50S ribosomal protein L25/general stress protein Ctc	NA	NA	NA	NA
WP_004195243.1\|3405671_3406628_-	ribose-phosphate pyrophosphokinase	A0A2K9L2G2	Tupanvirus	5.3e-41	35.5

DBSCAN-SWA_224

3413237 : 3414131

Thermobifida_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004195227.1\|3413237_3414131_-	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	4.4e-05	30.8

DBSCAN-SWA_225

3418246 : 3434976

Burkholderia_virus(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060547176.1\|3418246_3419023_-	LPS export ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.5e-17	28.1
WP_004195213.1\|3419019_3419685_-	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_024429780.1\|3419703_3420318_-	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_004200146.1\|3420323_3420863_-	HAD family hydrolase	E3T535	Cafeteria_roenbergensis_virus	8.4e-12	28.0
WP_004195206.1\|3420862_3421846_-	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	9.9e-43	37.5
WP_004522854.1\|3421973_3423983_+	sodium/hydrogen exchanger family protein	NA	NA	NA	NA
WP_004534111.1\|3424067_3424631_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	1.5e-27	41.1
WP_004526063.1\|3424713_3425328_+	LysE family translocator	NA	NA	NA	NA
WP_004548083.1\|3425340_3426198_+	DUF4743 domain-containing protein	NA	NA	NA	NA
WP_004522850.1\|3426249_3427131_+	formyltetrahydrofolate deformylase	M4QRX9	Synechococcus_phage	4.3e-13	35.7
WP_004540904.1\|3427429_3428515_-	membrane protein	NA	NA	NA	NA
WP_004537849.1\|3428715_3431583_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	2.3e-305	55.0
WP_004195190.1\|3431796_3432984_+	MFS transporter	NA	NA	NA	NA
WP_011851057.1\|3433097_3433637_+	single-stranded DNA-binding protein	C5IHK5	Burkholderia_virus	6.6e-49	87.9
WP_085955848.1\|3433817_3434976_+\|transposase	IS3-like element ISBps2 family transposase	A4JX31	Burkholderia_virus	5.0e-78	99.3

DBSCAN-SWA_226

3448644 : 3449764

Leptospira_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038802333.1\|3448644_3449764_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5

DBSCAN-SWA_227

3466322 : 3470402

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060547182.1\|3466322_3470402_+	TOMM system kinase/cyclase fusion protein	A0A2R8FF19	Brazilian_cedratvirus	5.6e-15	27.6

DBSCAN-SWA_228

3479953 : 3481546

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004537860.1\|3479953_3481546_-	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	3.6e-42	27.5

DBSCAN-SWA_229

3513435 : 3514260

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_043275317.1\|3513435_3514260_-	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	A0A2I7SAX1	Vibrio_phage	1.2e-36	35.2

DBSCAN-SWA_230

3523833 : 3529395

Tetraselmis_virus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522804.1\|3523833_3525411_+	ubiquinone biosynthesis regulatory protein kinase UbiB	A0A2P0VMP1	Tetraselmis_virus	3.6e-26	26.7
WP_004541161.1\|3525596_3526376_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_004526127.1\|3526476_3526818_+	hypothetical protein	NA	NA	NA	NA
WP_004189093.1\|3526885_3527536_+	DUF502 domain-containing protein	A0A2I7S9X1	Vibrio_phage	1.4e-13	28.8
WP_011851090.1\|3527592_3529395_+\|tRNA	aspartate--tRNA ligase	A0A2K9L0E9	Tupanvirus	7.4e-20	31.3

DBSCAN-SWA_231

3541136 : 3543008

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189741.1\|3541136_3543008_+	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	4.1e-45	28.3

DBSCAN-SWA_232

3564319 : 3565384

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522785.1\|3564319_3565384_-	PhoH family protein	H6X2N1	Pseudomonas_phage	4.2e-47	48.9

DBSCAN-SWA_233

3570657 : 3571380

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060547190.1\|3570657_3571380_+	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	5.2e-41	44.7

DBSCAN-SWA_234

3574470 : 3576003

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004526144.1\|3574470_3576003_-	asparagine synthetase B	A0A1V0SGM7	Hokovirus	2.0e-37	29.1

DBSCAN-SWA_235

3580108 : 3580825

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189870.1\|3580108_3580825_-	aquaporin family protein	M1HJ77	Paramecium_bursaria_Chlorella_virus	4.0e-25	33.6

DBSCAN-SWA_236

3585202 : 3585982

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189076.1\|3585202_3585982_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	8.7e-26	30.2

DBSCAN-SWA_237

3589724 : 3591182

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011851112.1\|3589724_3591182_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	2.0e-52	33.2

DBSCAN-SWA_238

3599625 : 3606167

Ectocarpus_siliculosus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189170.1\|3599625_3601509_-	sensor histidine kinase	Q8QNA2	Ectocarpus_siliculosus_virus	9.8e-07	34.5
WP_060547195.1\|3601558_3603004_-	response regulator	NA	NA	NA	NA
WP_158510042.1\|3603100_3603424_-	gamma-glutamyltransferase	NA	NA	NA	NA
WP_004198678.1\|3603666_3604248_+	DUF4142 domain-containing protein	NA	NA	NA	NA
WP_038768032.1\|3604415_3606167_-	PAS domain-containing methyl-accepting chemotaxis protein	A0A1B0V854	Salmonella_phage	1.1e-44	50.9

DBSCAN-SWA_239

3612477 : 3613794

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009918819.1\|3612477_3613794_-	nitrate/sulfonate/bicarbonate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.0e-31	35.8

DBSCAN-SWA_240

3643450 : 3645259

Ectocarpus_siliculosus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522738.1\|3643450_3645259_-	response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	3.3e-28	24.3

DBSCAN-SWA_241

3648784 : 3653243

Bacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_134864182.1\|3648784_3650154_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	8.0e-75	54.0
WP_009972524.1\|3650376_3651168_-	WYL domain-containing protein	NA	NA	NA	NA
WP_038802333.1\|3652123_3653243_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-49	39.5

DBSCAN-SWA_242

3664358 : 3667959

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060547207.1\|3664358_3665918_-	GHKL domain-containing protein	A0A1V0SGX0	Hokovirus	1.8e-06	25.2
WP_038732354.1\|3665941_3666685_-	response regulator transcription factor	NA	NA	NA	NA
WP_004189458.1\|3666888_3667959_+	recombinase RecA	A0A0S2MVG1	Bacillus_phage	2.5e-116	65.8

DBSCAN-SWA_243

3672267 : 3672981

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004526210.1\|3672267_3672981_+	TerC family protein	A0A2R2YAT9	Pseudomonas_phage	6.9e-38	48.7

DBSCAN-SWA_244

3690895 : 3694656

Mollivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189256.1\|3690895_3691786_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0M4JBD3	Mollivirus	3.3e-53	37.8
WP_038738479.1\|3691821_3692340_+	5-(carboxyamino)imidazole ribonucleotide mutase	NA	NA	NA	NA
WP_038771765.1\|3692419_3693616_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_004526220.1\|3693627_3694656_+	threonylcarbamoyl-AMP synthase	A0A291ATS8	Pandoravirus	2.5e-41	40.2

DBSCAN-SWA_245

3700073 : 3703339

Bacillus_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004190128.1\|3700073_3701390_+	HAMP domain-containing protein	W8CYF6	Bacillus_phage	1.9e-20	29.6
WP_004526224.1\|3701851_3703339_+\|protease	DegQ family serine endoprotease	A0A1B1IT49	uncultured_Mediterranean_phage	2.0e-26	32.1

DBSCAN-SWA_246

3707819 : 3714530

Leptospira_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522669.1\|3707819_3711020_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	3.8e-51	23.4
WP_060547211.1\|3711023_3712562_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_004530867.1\|3713156_3714530_-	purine permease	Q9KX94	Enterobacteria_phage	3.3e-28	30.7

DBSCAN-SWA_247

3717862 : 3721632

Prochlorococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189192.1\|3717862_3718969_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	A0A0K0KVL7	Prochlorococcus_phage	1.6e-33	29.3
WP_009918952.1\|3718982_3719843_+	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_004200770.1\|3719987_3720779_-	metal ABC transporter permease	NA	NA	NA	NA
WP_004522663.1\|3720771_3721632_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.5e-13	26.2

DBSCAN-SWA_248

3730087 : 3731959

Acanthocystis_turfacea_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004550806.1\|3730087_3730786_+	HAD-IA family hydrolase	M1IMD4	Acanthocystis_turfacea_Chlorella_virus	1.4e-06	42.9
WP_004199035.1\|3730846_3731959_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G3M9Y6	Bacillus_virus	6.8e-24	34.1

DBSCAN-SWA_249

3756113 : 3767622

Orpheovirus(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189668.1\|3756113_3757334_-	class I SAM-dependent methyltransferase	A0A2I2L5L3	Orpheovirus	2.9e-44	32.3
WP_004522643.1\|3757465_3758110_-	pyridoxamine 5'-phosphate oxidase	NA	NA	NA	NA
WP_038796596.1\|3758243_3759110_+\|tRNA	tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA	S4VW33	Pandoravirus	3.5e-15	33.1
WP_004522640.1\|3759382_3760231_-	thioredoxin	A0A1X9I9P5	Staphylococcus_phage	1.1e-13	37.8
WP_011851184.1\|3760284_3761166_-	pirin family protein	NA	NA	NA	NA
WP_004526255.1\|3761350_3762235_+	O-acetylserine/cysteine exporter	NA	NA	NA	NA
WP_004189918.1\|3762743_3764300_-	N-acetylmuramoyl-L-alanine amidase	Q5YA51	Bacillus_phage	2.0e-13	27.9
WP_004189096.1\|3764281_3764836_-\|tRNA	bifunctional tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE/phosphotransferase	NA	NA	NA	NA
WP_009972999.1\|3764853_3766083_+\|tRNA	tRNA epoxyqueuosine(34) reductase QueG	NA	NA	NA	NA
WP_004522636.1\|3766153_3766621_+	methylated-DNA--[protein]-cysteine S-methyltransferase	NA	NA	NA	NA
WP_004203577.1\|3766620_3767622_+	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	2.8e-24	28.9

DBSCAN-SWA_250

3772900 : 3773830

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004190177.1\|3772900_3773830_-	ornithine carbamoyltransferase	M1HWF9	Paramecium_bursaria_Chlorella_virus	4.1e-22	26.7

DBSCAN-SWA_251

3782598 : 3784756

Gordonia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060547216.1\|3782598_3783981_+	exodeoxyribonuclease VII large subunit	A0A1B3AYB4	Gordonia_phage	1.4e-29	27.2
WP_004185841.1\|3784177_3784756_+	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	1.1e-44	44.7

DBSCAN-SWA_252

3799367 : 3800213

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004526276.1\|3799367_3800213_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	2.0e-23	30.0

DBSCAN-SWA_253

3803668 : 3814644

Streptococcus_phage(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004197486.1\|3803668_3805783_-	elongation factor G	E4ZFJ7	Streptococcus_phage	5.8e-56	26.7
WP_004185496.1\|3806083_3806593_-	DUF192 domain-containing protein	A0A1B1IUW8	uncultured_Mediterranean_phage	5.5e-13	41.2
WP_071810810.1\|3806784_3807003_-	hypothetical protein	NA	NA	NA	NA
WP_004189780.1\|3807265_3807844_-	pseudouridine synthase	NA	NA	NA	NA
WP_004189552.1\|3808111_3809371_+	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	5.2e-12	63.0
WP_004189626.1\|3809343_3809526_-	hypothetical protein	NA	NA	NA	NA
WP_060547221.1\|3809538_3811167_+	multicopper oxidase family protein	NA	NA	NA	NA
WP_004196460.1\|3811296_3811500_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	6.8e-23	81.8
WP_004194131.1\|3812032_3812347_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A218MMY6	uncultured_virus	4.4e-13	44.6
WP_004196461.1\|3812343_3814644_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	5.1e-167	42.1

DBSCAN-SWA_254

3817976 : 3824988

Xanthomonas_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004186718.1\|3817976_3818423_-	dUTP diphosphatase	Q2NP83	Xanthomonas_phage	7.9e-48	64.4
WP_004186216.1\|3818486_3819698_-	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	3.0e-41	31.9
WP_004186086.1\|3819759_3820260_-	lipoprotein signal peptidase	NA	NA	NA	NA
WP_060547223.1\|3820259_3823097_-\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	2.6e-80	26.0
WP_004535897.1\|3823208_3824201_-	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
WP_004522603.1\|3824325_3824988_+	phosphoribosylglycinamide formyltransferase	E3SNR5	Prochlorococcus_phage	1.6e-25	40.0

DBSCAN-SWA_255

3840243 : 3843747

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004185649.1\|3840243_3840960_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.4e-14	26.4
WP_038760131.1\|3841262_3841931_+	DUF2278 family protein	NA	NA	NA	NA
WP_004543851.1\|3842087_3842546_-	GNAT family acetyltransferase	NA	NA	NA	NA
WP_004522595.1\|3842562_3843747_-	acetylornithine transaminase	A0A1V0SKB7	Klosneuvirus	2.5e-24	27.3

DBSCAN-SWA_256

3860593 : 3861910

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004534154.1\|3860593_3861910_+	sulfate adenylyltransferase	A0A1V0SA87	Catovirus	3.0e-18	25.5

DBSCAN-SWA_257

3865744 : 3867256

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060547225.1\|3865744_3867256_+	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	5.6e-53	41.0

DBSCAN-SWA_258

3876289 : 3880299

Acinetobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038753488.1\|3876289_3878347_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	7.0e-06	31.8
WP_004192857.1\|3878425_3879427_+	iron ABC transporter permease	NA	NA	NA	NA
WP_060547228.1\|3879423_3880299_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-10	25.1

DBSCAN-SWA_259

3890038 : 3890662

Vibrio_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009919218.1\|3890038_3890662_+	ParA family protein	A2I303	Vibrio_virus	8.0e-14	34.1

DBSCAN-SWA_260

3902427 : 3904605

Indivirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009973062.1\|3902427_3904605_-\|tRNA	methionine--tRNA ligase	A0A1V0SDF2	Indivirus	6.8e-52	28.5

DBSCAN-SWA_261

3907980 : 3908550

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192666.1\|3907980_3908550_+	dCTP deaminase	S5VM63	Pseudomonas_phage	1.3e-71	70.6

DBSCAN-SWA_262

3933520 : 3942532

uncultured_Caudovirales_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522531.1\|3933520_3934048_+	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	9.0e-51	53.8
WP_060547234.1\|3934106_3934931_-	GIY-YIG nuclease family protein	W8W2G4	Invertebrate_iridovirus	1.9e-07	43.1
WP_082249565.1\|3934909_3935296_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_004554523.1\|3935498_3935705_+	beta-glucosidase	NA	NA	NA	NA
WP_004538480.1\|3935926_3937105_-	N-acetyltransferase	NA	NA	NA	NA
WP_038731834.1\|3937225_3938926_+	NAD+ synthase	A0A2L0UZF5	Agrobacterium_phage	2.2e-90	36.8
WP_004193987.1\|3938986_3939325_+	P-II family nitrogen regulator	NA	NA	NA	NA
WP_004191758.1\|3939769_3940858_-	porin	NA	NA	NA	NA
WP_004553879.1\|3941752_3942532_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.3e-17	31.3

DBSCAN-SWA_263

3947165 : 3947891

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522521.1\|3947165_3947891_+	response regulator	W8CYM9	Bacillus_phage	9.2e-30	35.0

DBSCAN-SWA_264

3951835 : 3953176

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192968.1\|3951835_3953176_+	nitrate/sulfonate/bicarbonate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.2e-32	37.7

DBSCAN-SWA_265

3956647 : 3957250

Ochrobactrum_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522515.1\|3956647_3957250_+	AAA family ATPase	A0A219VHB7	Ochrobactrum_phage	3.3e-25	62.8

DBSCAN-SWA_266

3968218 : 3980344

Moraxella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082249566.1\|3968218_3977623_+	filamentous hemagglutinin N-terminal domain-containing protein	A0A0R6PJK4	Moraxella_phage	1.3e-35	34.4
WP_154233233.1\|3977631_3977988_+	hypothetical protein	NA	NA	NA	NA
WP_004526362.1\|3977999_3978224_+	CDI system lipoprotein BcpO	NA	NA	NA	NA
WP_060547241.1\|3978248_3980006_+	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_071897713.1\|3979939_3980344_-	DUF4102 domain-containing protein	Q7M297	Enterobacteria_phage	4.5e-10	48.2

DBSCAN-SWA_267

3987989 : 3994501

Bacillus_virus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004550744.1\|3987989_3989936_+	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	1.9e-45	27.8
WP_004185934.1\|3990141_3992124_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	1.4e-91	34.1
WP_060547243.1\|3992182_3994501_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	2.2e-80	34.5

DBSCAN-SWA_268

3998613 : 4006781

Burkholderia_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004526397.1\|3998613_3999927_+	MHS family MFS transporter	Q6JIH2	Burkholderia_virus	2.3e-39	31.5
WP_060547246.1\|3999928_4001191_+	Zn-dependent hydrolase	NA	NA	NA	NA
WP_060547247.1\|4001515_4002541_+	histone deacetylase family protein	A0A0N9QAS6	Chrysochromulina_ericina_virus	1.1e-17	27.7
WP_158510043.1\|4002474_4002969_-	hypothetical protein	NA	NA	NA	NA
WP_004531925.1\|4003080_4004289_-	chromate transporter	NA	NA	NA	NA
WP_004185903.1\|4004420_4006781_-	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	9.4e-15	34.6

DBSCAN-SWA_269

4013101 : 4015000

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004185742.1\|4013101_4015000_+	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	3.0e-120	38.5

DBSCAN-SWA_270

4020160 : 4021114

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060547249.1\|4020160_4021114_-	transaldolase	A0A0E3F5V4	Synechococcus_phage	5.7e-11	29.6

DBSCAN-SWA_271

4036518 : 4042047

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060547250.1\|4036518_4042047_-	DNA translocase FtsK	S5VNE3	Mycobacterium_phage	1.0e-83	49.3

DBSCAN-SWA_272

4046084 : 4055864

Diachasmimorpha_longicaudata_entomopoxvirus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038724990.1\|4046084_4047524_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	6.3e-54	35.6
WP_038769808.1\|4048059_4048953_-\|tRNA	tRNA glutamyl-Q(34) synthetase GluQRS	NA	NA	NA	NA
WP_004543849.1\|4048996_4049896_-	sulfurtransferase	NA	NA	NA	NA
WP_004522462.1\|4050509_4054034_+	DNA polymerase III subunit alpha	A0A291AVG1	Streptomyces_phage	1.6e-183	35.9
WP_004186431.1\|4054073_4055864_+	lipid A export permease/ATP-binding protein MsbA	W8CYL7	Bacillus_phage	1.2e-49	28.1

DBSCAN-SWA_273

4062506 : 4063271

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522457.1\|4062506_4063271_-	glycosyltransferase family 2 protein	S5WBE2	Pseudomonas_phage	6.4e-05	34.2

DBSCAN-SWA_274

4075410 : 4076799

environmental_Halophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004531904.1\|4075410_4076799_-	purine permease	H9YQ34	environmental_Halophage	1.6e-25	50.8

DBSCAN-SWA_275

4091196 : 4097144

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004522436.1\|4091196_4093284_+	potassium-transporting ATPase subunit KdpB	M1HBF8	Paramecium_bursaria_Chlorella_virus	2.3e-20	25.7
WP_004186443.1\|4093296_4093878_+	potassium-transporting ATPase subunit KdpC	NA	NA	NA	NA
WP_060547254.1\|4094162_4097144_+	DUF4118 domain-containing protein	A0A1V0SGX0	Hokovirus	1.6e-06	23.7

DBSCAN-SWA_276

4103857 : 4107808

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009973147.1\|4103857_4104499_+	DUF924 domain-containing protein	A0A1V0SIY0	Klosneuvirus	6.3e-14	31.8
WP_060547258.1\|4106491_4107808_+	MFS transporter	Q6JIH2	Burkholderia_virus	2.6e-62	37.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP012042

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP012041

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection