CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_LT904873	Salmonella enterica subsp. enterica serovar Typhi strain ERL11909 plasmid 2	1 crisprs	NA	1	0
NZ_LT904874	Salmonella enterica subsp. enterica serovar Typhi strain ERL11909 plasmid 3	0 crisprs	NA	0	0
NZ_LT904872	Salmonella enterica subsp. enterica serovar Typhi strain ERL11909 chromosome 1	1 crisprs	DEDDh,cas3,c2c9_V-U4,WYL,DinG,RT,csa3,cas2,cas1,cas6e,cas5,cas7,cse2gr11,cas8e,PD-DExK	3	14

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_LT904873_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LT904873_1

5653-5772

Orphan

Consensus_repeat	Method
TGCGTACCCATCCACCTTTCAGTGCGTACCCATCCACCTTTCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_LT904873_1

>merge|NZ_LT904873|1|5653-5772|CRISPRCasFinder
TGCGTACCCATCCACCTTTCAGTGCGTACCCATCCACCTTTCAGTGCGCAGCCATCCACCTTTCATGAAAATTACAGTGCGTACCCATCCACCTTTCAGTGCGTACCCATCCACCTTTCA

>NZ_LT904873|1|1|5653-5772|CRISPRCasFinder
TGCGTACCCATCCACCTTTCAGTGCGTACCCATCCACCTTTCA	GTGCGCAGCCATCCACCTTTCATGAAAATTACAG
TGCGTACCCATCCACCTTTCAGTGCGTACCCATCCACCTTTCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LT904873.1\|WP_000343717.1\|12967_14176_-\|IS256-family-transposase	unknown	unknown	gnl\|CDD\|225865
NZ_LT904873.1\|WP_000167280.1\|10030_10303_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LT904873.1\|WP_001178641.1\|8094_8643_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LT904873.1\|WP_000864791.1\|1009_1630_+\|ParA-family-protein	unknown	unknown	gnl\|CDD\|349760
NZ_LT904873.1\|WP_000220561.1\|6875_7157_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|224937
NZ_LT904873.1\|WP_001426313.1\|10628_11174_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LT904873.1\|WP_000360321.1\|1927_2239_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LT904873.1\|WP_000121743.1\|6634_6886_+\|plasmid-stabilization-protein	unknown	unknown	gnl\|CDD\|179484
NZ_LT904873.1\|WP_000999428.1\|2276_2897_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LT904873.1\|WP_001802123.1\|4563_5400_-\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NZ_LT904873.1\|WP_000051065.1\|1681_1912_+\|partitioning-protein	unknown	unknown	gnl\|CDD\|117819
NZ_LT904873.1\|WP_001567305.1\|3068_3557_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LT904873.1\|WP_000203204.1\|94_724_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239736
NZ_LT904873.1\|WP_000876435.1\|3587_3941_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LT904873.1\|WP_001074383.1\|4077_4524_-\|hypothetical-protein	unknown	unknown	unknown
NZ_LT904873.1\|WP_001446884.1\|8708_8921_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LT904873.1\|WP_001025387.1\|7505_8021_+\|J-domain-containing-protein	unknown	unknown	gnl\|CDD\|99751
NZ_LT904873.1\|WP_000866654.1\|9246_9576_+\|hypothetical-protein	unknown	unknown	unknown
NZ_LT904873.1\|WP_000008708.1\|8910_9153_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274805

Protein	Function_ID	Function_description	E-value
NZ_LT904873.1\|WP_000343717.1\|12967_14176_-\|IS256-family-transposase	gnl\|CDD\|225865	COG3328, COG3328, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	4.53371e-149
NZ_LT904873.1\|WP_000203204.1\|94_724_-\|recombinase-family-protein	gnl\|CDD\|239736	cd03767, SR_Res_par, Serine recombinase (SR) family, Partitioning (par)-Resolvase subfamily, catalytic domain; Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. This subgroup is composed of proteins similar to the E. coli resolvase found in the par region of the RP4 plasmid, which encodes a highly efficient partitioning system. This protein is part of a complex stabilization system involved in the resolution of plasmid dimers during cell division. Similar to Tn3 and other resolvases, members of this family may contain a C-terminal DNA binding domain.	9.60651e-71
NZ_LT904873.1\|WP_000220561.1\|6875_7157_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|224937	COG2026, RelE, Cytotoxic translational repressor of toxin-antitoxin stability system [Translation, ribosomal structure and biogenesis / Cell division and chromosome partitioning].	2.37215e-20
NZ_LT904873.1\|WP_000008708.1\|8910_9153_+\|hypothetical-protein	gnl\|CDD\|274805	TIGR03830, transcriptional_regulator_XRE_family, putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.	2.19388e-05
NZ_LT904873.1\|WP_000864791.1\|1009_1630_+\|ParA-family-protein	gnl\|CDD\|349760	cd02042, ParAB_family, partition proteins ParAB family. ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in Rhizobium etli symbiotic plasmid. This operon is involved in the plasmid replication and partition.	1.99353e-34
NZ_LT904873.1\|WP_000121743.1\|6634_6886_+\|plasmid-stabilization-protein	gnl\|CDD\|179484	PRK02854, PRK02854, primosomal protein DnaT.	2.40816e-08
NZ_LT904873.1\|WP_000051065.1\|1681_1912_+\|partitioning-protein	gnl\|CDD\|117819	pfam09274, ParG, ParG. Members of this family of plasmid partition proteins adopt a ribbon-helix-helix fold, with a core of four alpha-helices. They are an essential component of the DNA partition complex of the multidrug resistance plasmid TP228.	1.38371e-39
NZ_LT904873.1\|WP_001802123.1\|4563_5400_-\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	1.31744e-21
NZ_LT904873.1\|WP_001025387.1\|7505_8021_+\|J-domain-containing-protein	gnl\|CDD\|99751	cd06257, DnaJ, DnaJ domain or J-domain. DnaJ/Hsp40 (heat shock protein 40) proteins are highly conserved and play crucial roles in protein translation, folding, unfolding, translocation, and degradation. They act primarily by stimulating the ATPase activity of Hsp70s, an important chaperonine family. Hsp40 proteins are characterized by the presence of a J domain, which mediates the interaction with Hsp70. They may contain other domains as well, and the architectures provide a means of classification.	2.01289e-12

>NZ_LT904873.1|WP_001802123.1|4563_5400_-|replication-initiation-protein
MNLLSVTKKTKIRHRNEINSTFSSLPLSARRILFMAMAQIDSREELSEGATFRITAREYAFIADIDVTGAYRQLKEGAEELQASVIRIPRNQLLTAQGNQISGHTKKRGKLPSDAVRLMNLTAFCDYVESEGYIDIAFSHVIEPYITMLKDSYTTQVLISSVRLADQNSNMLYQFIRKQYSSGKKTFFDIEVDVLKDELELFRIDNGEKVYLYQNFKDFNKVFLQKNIEKINQYTEINHLEVKIVERVARRASKLRFSYKIDKESEGLDIRIPYGFRG
>NZ_LT904873.1|WP_001074383.1|4077_4524_-|hypothetical-protein
MAKIYQFPQGEERAKFRKEIARERKKRFAVKTGSTFVKWLDWGWFYLRLLAASVLHFIFVFVLAILGAFKWSVFWLGGILCVITWYHLDHQLWTPQNLTIPVITATWILGLLAEPLMELLNKTMPWHKLLVPEPADESTENSSEISQK
>NZ_LT904873.1|WP_000876435.1|3587_3941_-|hypothetical-protein
MKYLVKEFINEKYTKAVNILKDNLKEHYHVFYCVRLSEILFPASEYGTEQFFSDFEKINSISLPVLVFDLKEGVPVIVISLDDVSYCDVLDEMDIDFMKCDSLSELLTSDKLENLLV
>NZ_LT904873.1|WP_001567305.1|3068_3557_+|hypothetical-protein
MTLLERIKRVTEKNSEGVKTPDVDLDALIDTIYIGCRSMFCENPDLKNNYTLQNCLRKANYHNEARVIDNILQEKKFTDSIMKDESFFSLVKLVSNKSIAHQESLSGKKREKIDYRYKFLNDNSNICEFQYYIFRCHRIYENIVKEYGDTLLNELKIKNNDI
>NZ_LT904873.1|WP_000999428.1|2276_2897_+|hypothetical-protein
MNDNSTSVTSKEDVQDISLKNWLKNKKTIVLLIFTALTNVGNVLSTIDIITDKTSSFYTWLGESKKFEGHWTNNTEGFIDGTPDFLLKNAGDVLIKFDLNIKGGEVRGELHTDARLKMCETIEEKLKTLCTLIASHPLMIEGEKSPFSNEFDAYITEYRNGDKKIVAILNMKITDDDKMTITNTMRTPESALFPTKIYAIKIITEE
>NZ_LT904873.1|WP_000360321.1|1927_2239_+|hypothetical-protein
MDKNVVDALKTLLEALPEEVVTEVTSKLNPSASHIPEENSKQLTAKARLLNFRLTEAYEEILEVEAIRTGQSKTTVLKAALAMYNSQDENIKNHWLLESAKIN
>NZ_LT904873.1|WP_000051065.1|1681_1912_+|partitioning-protein
MSLEKAHTAVKKMTFGENRDLERVVTAPVSSGKIKRVNVNFDEEKHTRFKAACAKKGTSITNVVNQLVDKWLKENE
>NZ_LT904873.1|WP_000864791.1|1009_1630_+|ParA-family-protein
MKVISFLNPKGGSGKTTAVINIATALSRSGYNIAVVDTDPQMSLTNWSKAGKAAFDVFTAASEKDVYGIRKDLADYDFAIVDGAGSLSVITSAAVMVSDLVIIPVTPSPLDFSAAGSVVTVLEAQAYSRKVEARFLITRKIEMATMLNVLKESIKDTGVKSFRTAITQRQVYVKSILDGDSVFESSDGAAKGEIEILTKEIVSTFE
>NZ_LT904873.1|WP_000203204.1|94_724_-|recombinase-family-protein
MTSNAPTSFVRAYLRASTAEQDASRALETIEAFARERGLIICSYYIENESGSRLERPELFRLLRDCQQNDILLIEDVDRLSRLSGEDWNTLKKMIRQKDIRVMAVNVPTTWINSGMSEFDSRLFAAINDMLLDMLAAVARRDYEQRRERQKQGIEKARKDGKYKGRKPNQARHDAIIRLIESGSSWTQVQKVLGCSRGTISSAIKRKTG
>NZ_LT904873.1|WP_000121743.1|6634_6886_+|plasmid-stabilization-protein
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNLDDL
>NZ_LT904873.1|WP_000220561.1|6875_7157_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGRRESSEVYQIADMR
>NZ_LT904873.1|WP_001025387.1|7505_8021_+|J-domain-containing-protein
MNIQEALNIFGLSGDLTEKDIKAAYRKAALKYHPDRNPLGAELMKAVNAAFDFLMANIDKINQFQSTDENARYNYGEDLEKVLNTLSGLTGIVYEVIGNWVWISGETITHKETLKEIGCKWAAKKKQWFYRPEEHKSYWNREEHTIEEIRAKYGSTGQRRATGWQQVETRA
>NZ_LT904873.1|WP_001178641.1|8094_8643_+|hypothetical-protein
MQNDKFFERYQPVFEIVCRILGNGWRVNLLDDCQYRIKLTSPQYKNYSIHIRMEKGRLVIIGSVDSRSWRSPYHTCTVSPERNPVEIAADIEKKILTDAFENVEKAMEYERQLQKKREQTQILKGMLSRLIRLDSWHGTLTGFKVENGLDGNVSERGGGFEMVIRGLSVDQLIKVAGFIKQL
>NZ_LT904873.1|WP_001446884.1|8708_8921_+|hypothetical-protein
MSEDATRLFIELEKLMKVRSKEADKKTTKKVVFHKSFYYEEFCNVKDEIDDPILLQFYTDTIVKVLNHEF
>NZ_LT904873.1|WP_000008708.1|8910_9153_+|hypothetical-protein
MSFKPTPEEVKQARIKAGFTQQEAAKRFGFSLSAWQAKETSGKTSRGLAAGTYELLLLLADEHPDYQLVKREKNQNKETK
>NZ_LT904873.1|WP_000866654.1|9246_9576_+|hypothetical-protein
MKVLTFKNDTVSVGDVFVSSWGYEQTNVTFYQVLSVHGKKTVTVREIRANSEYTDSMVGFKTPVLNDFTGECFKRQIKDFGDELAIKIEDFETAYKTLPEEKHRFSSYY
>NZ_LT904873.1|WP_000167280.1|10030_10303_+|hypothetical-protein
MTKSDFVSFVSGELRQGAVRFSLAFNSKGEIVLHWTNKAGIRVWRILSGNRGKKPSKANLERMSNFRRWLFDARQGMEGYTQQPEQSNLS
>NZ_LT904873.1|WP_001426313.1|10628_11174_+|hypothetical-protein
MKKVQFRIDENQHDDLLDCLKTLYPDEPALTVAKGMKLLANALLKSKAGSKDINTFFDNNDFIKTTMYLTGKQRADIERAANRHGWTLSRECRYRIQTTLENELDFFDQELLMMNRCRNSIDKIGRNFHYIIVNDQTRVLDKDGFYQDAERLTTEIFNLKNQFENYIMLCKGRTVSNKVEM
>NZ_LT904873.1|WP_000343717.1|12967_14176_-|IS256-family-transposase
MDEKQLQALANELAKNLKTPEDLSQFDRLLKKLSVEAALNAEMTHHLGYEKNQSRPGANSRNGFSTKTVITGDGPLELRTPRDRDGTFEPQLVKKNQTRITGMDNQILSLYAKGMTTREIAAAFKELYDADVSPALISKVTDAVMEQVVEWQNRPLDAVYPIVYLDCIVLKVRQDSRVINKSVFLALGINIEGQKELLGMWLAENEGAKFWLNVLTELKNRGLNDILIACVDGLKGFPDAINTVYPKARIQLCIVHMVRNSLRFVSWKDYKAVTRDLKAIYQAPTEEAGQQALEAFAAAWDCRYPQISRSWQANWPNLATFFAYPTDIRKVIYTTNAIESLNSVIRHAIKKRKVFPTDDSVKKVVWLAIQAASQKWTMPLRDWRMAMSRFIIEFGDRLDGHF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_KX518744	Escherichia coli strain HYEC7 plasmid pHYEC7-110, complete sequence	63874-63907	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP041286	Escherichia coli strain 54 plasmid p54-tetX, complete sequence	64169-64202	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_KU321583	Escherichia coli strain E80 plasmid pE80, complete sequence	38215-38248	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_KT990220	Escherichia coli strain 42-2 plasmid p42-2, complete sequence	37006-37039	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP010164	Escherichia coli strain H2 plasmid A, complete sequence	20751-20784	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP019647	Salmonella enterica subsp. enterica serovar Typhimurium strain TW-Stm6 plasmid pSTM6-275, complete sequence	239581-239614	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP022964	Salmonella enterica subsp. enterica serovar Pullorum strain QJ-2D-Sal plasmid pQJDsal1, complete sequence	30266-30299	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP024467	Shigella dysenteriae strain BU53M1 plasmid unnamed1, complete sequence	17630-17663	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_LS999563	Escherichia coli isolate EC-TO143 plasmid 4, complete sequence	16611-16644	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_LS999563	Escherichia coli isolate EC-TO143 plasmid 4, complete sequence	53074-53107	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP019284	Escherichia coli strain 13P484A plasmid p13P484A-4, complete sequence	32601-32634	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP047093	Salmonella sp. S13 plasmid pS13-4, complete sequence	1762-1795	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP051432	Escherichia sp. SCLE84 plasmid pSCLE2, complete sequence	23725-23758	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP046002	Escherichia coli strain 1916D6 plasmid p1916D6-2, complete sequence	35337-35370	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP045188	Escherichia coli strain NT1F31 plasmid pNT1F31-tetX4, complete sequence	26770-26803	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP031548	Escherichia coli strain cq9 plasmid unnamed2, complete sequence	41390-41423	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP031548	Escherichia coli strain cq9 plasmid unnamed2, complete sequence	60962-60995	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP032386	Salmonella enterica subsp. enterica serovar Dublin strain CVM N53043 plasmid pN53043_2, complete sequence	39391-39424	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP032389	Salmonella enterica subsp. enterica serovar Dublin strain CVM N45955 plasmid pN45955_2, complete sequence	9889-9922	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_LT904873	Salmonella enterica subsp. enterica serovar Typhi strain ERL11909 plasmid 2	5696-5729	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_KT754163	Shigella dysenteriae 1 strain A5468 plasmid pA5468, complete sequence	12265-12298	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP033383	Salmonella enterica subsp. enterica strain CFSA300 plasmid pCFSA300-2, complete sequence	7366-7399	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP020836	Escherichia coli strain CFSAN051542 plasmid pCFSAN051542, complete sequence	20407-20440	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP038140	Escherichia coli strain G3X16-2 plasmid pG3X16-2-3, complete sequence	93494-93527	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP043216	Salmonella enterica subsp. enterica serovar Heidelberg strain SL-312 plasmid pET8.2-IncX1, complete sequence	32193-32226	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP042617	Escherichia coli strain NCYU-26-73 plasmid pNCYU-26-73-2, complete sequence	25537-25570	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP031361	Salmonella enterica subsp. enterica serovar Heidelberg strain 5 plasmid p2, complete sequence	27033-27066	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP044153	Shigella flexneri strain AR-0425 plasmid pAR-0425-1, complete sequence	25749-25782	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP040929	Escherichia coli strain YY76-1 plasmid pYY76-1-2, complete sequence	2187-2220	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP033386	Salmonella enterica subsp. enterica strain CFSA1007 plasmid pCFSA1007-2, complete sequence	34721-34754	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP041177	Salmonella enterica subsp. enterica serovar Enteritidis strain SJTUF12367v2 plasmid p12367A, complete sequence	4942-4975	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP034761	Klebsiella pneumoniae strain NB5306 plasmid unnamed2, complete sequence	47580-47613	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP050707	Salmonella enterica subsp. enterica serovar Enteritidis strain SE124 plasmid pSE124-1, complete sequence	14631-14664	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP047339	Klebsiella pneumoniae strain 2019036D plasmid p2019036D-35kb, complete sequence	28949-28982	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NC_010860	Salmonella enterica subsp. enterica serovar Enteritidis plasmid pSE34, complete sequence	32623-32656	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP022453	Salmonella enterica subsp. enterica serovar Indiana strain D90 plasmid pD90-3, complete sequence	5893-5926	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP024153	Escherichia coli strain 14EC033 plasmid p14EC033f, complete sequence	53536-53569	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP030208	Salmonella enterica strain SA19992307 plasmid pSA19992307.1, complete sequence	39815-39848	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP005994	Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002064 plasmid unnamed, complete sequence	30028-30061	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP032450	Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69838 plasmid pSDU1-USMARC-69838, complete sequence	29110-29143	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP010155	Escherichia coli strain D9 plasmid C, complete genome	14497-14530	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP050174	Escherichia coli strain STB20-1 plasmid pSTB20-1T, complete sequence	58667-58700	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP029061	Escherichia coli strain FORC_081 plasmid pFORC_081_4, complete sequence	10786-10819	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP042589	Escherichia coli strain PK6 plasmid pRHEcCUB-1, complete sequence	29459-29492	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP025677	Escherichia albertii strain ChinaSP140150 plasmid pEA-1, complete sequence	79278-79311	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP041453	Escherichia coli strain YPE3 plasmid pYPE3-92k-tetX4, complete sequence	54169-54202	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	MN816373	Escherichia coli strain A127 plasmid pA127-X1, complete sequence	29459-29492	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP052879	Escherichia coli strain C21 plasmid pC21-2, complete sequence	61147-61180	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP033379	Escherichia coli strain L73 plasmid pL73-2, complete sequence	99797-99830	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP033632	Escherichia coli isolate ECCNB12-2 plasmid pTB-nb1, complete sequence	88012-88045	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP050724	Salmonella enterica subsp. enterica serovar Enteritidis strain SE74 plasmid pSE74-1, complete sequence	41949-41982	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP047573	Escherichia coli strain 2EC1 plasmid p2EC1-2, complete sequence	53619-53652	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NC_019106	Salmonella enterica subsp. enterica serovar Dublin plasmid pSD_77, complete sequence	32551-32584	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP010127	Escherichia coli strain C8 plasmid B, complete genome	33248-33281	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP027138	Escherichia coli strain AR_0369 plasmid unnamed2	85971-86004	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP022072	Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_321 plasmid unnamed2, complete sequence	18650-18683	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP043935	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-3, complete sequence	20398-20431	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP043935	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-3, complete sequence	147056-147089	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP045998	Escherichia coli strain 1916D18 plasmid p1916D18-1, complete sequence	35339-35372	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP032394	Salmonella enterica subsp. enterica serovar Dublin strain CVM 22453 plasmid p22453_2, complete sequence	32800-32833	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NC_019256	Shigella sp. LN126 plasmid pLN126_33, complete sequence	2112-2145	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	MH884649	Salmonella sp. strain Sa21 plasmid pSa21-IncX1-28K, complete sequence	16816-16849	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	MH884651	Salmonella sp. strain Sa21 plasmid pSa21-TC-CIP, complete sequence	68260-68293	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	MH229869	Escherichia coli plasmid pKANJ7, complete sequence	90-123	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP050713	Salmonella enterica subsp. enterica serovar Enteritidis strain SE104 plasmid pSE104-1, complete sequence	33434-33467	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP041439	Escherichia coli strain YPE12 plasmid pYPE12-106k, complete sequence	96892-96925	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP041443	Escherichia coli strain YPE12 plasmid pYPE12-101k-tetX4, complete sequence	63333-63366	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_MK461931	Escherichia coli strain F2_14D plasmid pF2_14D_HI2, complete sequence	238663-238696	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_MK656937	Escherichia coli strain T3 plasmid pT3, complete sequence	37880-37913	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_MK731977	Escherichia coli strain ENV103 plasmid pSGMCR103, complete sequence	22155-22188	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_MK673546	Salmonella enterica subsp. enterica serovar Typhimurium strain GDD27-24 plasmid pGDD27-24, complete sequence	28203-28236	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP032447	Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69840 plasmid pSDU1-USMARC-69840, complete sequence	18380-18413	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_MH179305	Salmonella enterica subsp. enterica serovar Indiana strain JT01 plasmid pJT01, complete sequence	118004-118037	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_MH179305	Salmonella enterica subsp. enterica serovar Indiana strain JT01 plasmid pJT01, complete sequence	151970-152003	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_MH287085	Escherichia coli strain F2_12B plasmid pSDC-F2_12BHI2, complete sequence	243053-243086	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_MH287084	Escherichia coli O157 strain SvETEC plasmid pSDE-SvHI2, complete sequence	241163-241196	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP025558	Salmonella enterica subsp. enterica serovar Enteritidis strain PIR00532 plasmid p2PIR00532, complete sequence	11939-11972	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	MT219825	Escherichia coli strain RW7-1 plasmid pRW7-1_235k_tetX, complete sequence	90443-90476	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	MT219826	Escherichia coli strain RW8-1 plasmid pRW8-1_122k_tetX, complete sequence	43726-43759	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_MG904998	Escherichia coli strain 15OD0495 plasmid p15ODTXV, complete sequence	48918-48951	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_MG197491	Escherichia coli strain FKU92 plasmid pHNFKU92, complete sequence	33352-33385	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_MG197498	Escherichia coli strain HZMCC14 plasmid pHNMCC14, complete sequence	58347-58380	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_MG197503	Escherichia coli strain ZYTM118 plasmid pHNZY118, complete sequence	61256-61289	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_MG197495	Escherichia coli strain AHC24 plasmid pHNAH24, complete sequence	61256-61289	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_MF589339	Escherichia coli strain 2271 plasmid pCTXM-2271, complete sequence	27964-27997	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_MG197502	Escherichia coli strain ZYTF32 plasmid pHNZY32, complete sequence	61256-61289	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	MT219818	Escherichia coli strain RF148-1 plasmid pRF148-1_119k_tetX, complete sequence	43736-43769	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	MT219820	Escherichia coli strain RF108-2 plasmid pRF108-2_97k_tetX, complete sequence	80789-80822	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	MT219822	Escherichia coli strain RF14-1 plasmid pRF14-1_50k_tetX, complete sequence	38970-39003	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	MT219823	Escherichia coli strain RF10-1 plasmid pRF10-1_119k_tetX, complete sequence	73817-73850	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NC_023323	Escherichia coli ACN001 plasmid pACN001-A, complete sequence	18865-18898	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	MF554637	uncultured bacterium clone AA-100 plasmid pPIMMR, complete sequence	14942-14975	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP016575	Salmonella enterica subsp. enterica serovar Heidelberg strain AMR588-04-00435 plasmid pAMR588-04-00435_37, complete sequence	296-329	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP020060	Escherichia coli strain AR_0061 plasmid unitig_2, complete sequence	30572-30605	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP032994	Escherichia coli strain W5-6 plasmid p2_W5-6, complete sequence	10049-10082	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	MN783746	Escherichia coli plasmid pIncX1_p1, complete sequence	5290-5323	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_KX815983	Salmonella enterica subsp. enterica serovar Dublin strain N13-01125 plasmid pN13-01125, complete sequence	40397-40430	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_KU254580	Escherichia coli strain YD786 plasmid pYD786-3, complete sequence	25507-25540	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP042633	Escherichia coli strain NCYU-25-82 plasmid pNCYU-25-82-6, complete sequence	38916-38949	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP032392	Salmonella enterica subsp. enterica serovar Dublin strain CVM 34981 plasmid p34981_2, complete sequence	67739-67772	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP019272	Escherichia coli strain 13P460A plasmid p13P460A-1, complete sequence	35028-35061	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP053728	Escherichia coli strain CP61_Sichuan plasmid pCP61-IncN, complete sequence	69102-69135	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP037995	Salmonella enterica subsp. enterica serovar Brancaster strain sg_ww281 plasmid psg_ww281	7255-7288	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP053740	Escherichia coli strain CP8-3_Sichuan plasmid pCP8-3-IncX1, complete sequence	9971-10004	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP016580	Salmonella enterica subsp. enterica serovar Heidelberg strain SH13-006 plasmid pSH13-006_37, complete sequence	23703-23736	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP046001	Escherichia coli strain 1916D6 plasmid p1916D6-1, complete sequence	49989-50022	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP021103	Escherichia coli strain 13P477T plasmid p13P477T-7, complete sequence	56470-56503	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP029182	Escherichia coli strain H9Ecoli plasmid p3-H9, complete sequence	2302-2335	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	MN086778	Escherichia coli plasmid p16EC-IncN, complete sequence	90173-90206	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP053047	Escherichia fergusonii strain HNCF11W plasmid pHNCF11W-tetX4, complete sequence	9874-9907	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP014974	Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1898 isolate ST073 plasmid pSTY3-1898, complete sequence	295-328	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP032397	Salmonella enterica subsp. enterica serovar Dublin strain CVM 22429 plasmid p22429, complete sequence	220331-220364	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP035774	Klebsiella pneumoniae strain R46 plasmid pR46-27, complete sequence	12757-12790	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP044182	Salmonella enterica subsp. enterica serovar Heidelberg strain AR-0404 plasmid pAR-0404-1, complete sequence	25543-25576	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP042608	Escherichia coli strain NCYU-29-19 plasmid pNCYU-29-19-2_MCR3, complete sequence	7171-7204	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	MK461930	Escherichia coli strain 2009_36 plasmid p2009_36_HI2, complete sequence	45261-45294	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NC_019046	Escherichia coli plasmid pNMEC31_31, complete sequence	31361-31394	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP047460	Escherichia coli strain ZF31 plasmid pZF31-tetX-119kb, complete sequence	89191-89224	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP047466	Escherichia coli strain ZF34 plasmid pZF34-tetX-114kb, complete sequence	30748-30781	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP035315	Escherichia coli strain D72 plasmid pD72-IncX1, complete sequence	28493-28526	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP050748	Salmonella enterica subsp. enterica serovar Typhimurium strain ST53 plasmid pST53-3, complete sequence	5878-5911	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NC_024961	Escherichia coli plasmid pIS15_43, strain ISI5, complete sequence	905-938	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NC_021842	Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069 plasmid pCFSAN002069_02, complete sequence	4017-4050	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_LT985261	Escherichia coli strain 657 plasmid RCS50_p, complete sequence	42585-42618	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_AP019678	Escherichia coli strain GSH8M-2 plasmid pGSH8M-2-3, complete sequence	49115-49148	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP009074	Escherichia coli ATCC 25922 plasmid unnamed, complete sequence	21137-21170	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP010168	Escherichia coli strain H3 plasmid A, complete genome	25682-25715	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NC_010378	Escherichia coli plasmid pOLA52, complete sequence	34562-34595	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	CP016512	Salmonella enterica subsp. enterica serovar Heidelberg strain SH14-028 plasmid pSH14-028_37, complete sequence	23704-23737	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP016529	Salmonella enterica subsp. enterica serovar Heidelberg strain 09-036813-1A plasmid p09-036813-1A_42, complete sequence	23704-23737	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP016518	Salmonella enterica subsp. enterica serovar Heidelberg strain CE-R2-11-0435 plasmid pCE-R2-11-0435_37, complete sequence	23705-23738	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP032988	Escherichia coli strain BE2-5 plasmid p2_BE2-5, complete sequence	50710-50743	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP017633	Escherichia coli strain SLK172 plasmid pSLK172-2, complete sequence	23885-23918	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP012922	Salmonella enterica subsp. enterica serovar Heidelberg strain SA02DT10168701 plasmid pSA02DT10168701_37, complete sequence	23704-23737	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP033093	Escherichia coli strain CP53 plasmid pCP53-38k, complete sequence	19532-19565	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP012926	Salmonella enterica subsp. enterica serovar Heidelberg strain 12-4374 plasmid p12-4374_37, complete sequence	37369-37402	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP023360	Escherichia coli strain 1943 plasmid p54, complete sequence	52726-52759	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	CP043734	Escherichia coli strain CVM N17EC1164 plasmid pN17EC1164-1, complete sequence	37807-37840	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP039600	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014867 plasmid p12-6334.1, complete sequence	32872-32905	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP030283	Escherichia coli strain E308 plasmid pLKSZ02, complete sequence	49947-49980	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NC_011204	Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 plasmid pCT02021853_74, complete sequence	70648-70681	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NC_017624	Salmonella enterica subsp. enterica serovar Heidelberg str. B182 plasmid pB182_37, complete sequence	23689-23722	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP050710	Salmonella enterica subsp. enterica serovar Enteritidis strain SE109 plasmid pSE109-1, complete sequence	15569-15602	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP024290	Escherichia coli O178:H19 strain 2012C-4431 plasmid unnamed1, complete sequence	33653-33686	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP048777	Salmonella enterica subsp. enterica serovar Agona strain SG17-135 plasmid pSG17-135-X, complete sequence	1446-1479	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP041631	Escherichia coli strain PE15 plasmid pPE15-27K, complete sequence	4799-4832	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP050773	Salmonella enterica subsp. enterica serovar Indiana strain SI102 plasmid pSI102-2, complete sequence	30707-30740	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP041444	Escherichia coli strain YPE10 plasmid pYPE10-78k, complete sequence	38005-38038	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP019180	Salmonella enterica subsp. enterica serovar Dublin str. ATCC 39184 plasmid pATCC39184, complete sequence	24566-24599	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP050765	Salmonella enterica subsp. enterica serovar Indiana strain SI111 plasmid pSI111-1, complete sequence	6593-6626	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NC_010422	Salmonella enterica subsp. enterica serovar Dublin plasmid pOU1115, complete sequence	59434-59467	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP050759	Salmonella enterica subsp. enterica serovar Indiana strain SI173 plasmid pSI173-2, complete sequence	5734-5767	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_AP022652	Escherichia coli strain 09-02E plasmid p2-09-02E, complete sequence	295-328	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP024136	Escherichia coli strain 14EC017 plasmid p14EC017b, complete sequence	79478-79511	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_LT985315	Escherichia coli strain ECOR 70 plasmid RCS99_p, complete sequence	47119-47152	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	MN436006	Escherichia coli strain JS1-EC05 plasmid pEC05-X4, complete sequence	27492-27525	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	MN436007	Escherichia coli strain JS3-EC12 plasmid pEC12-X4, complete sequence	27131-27164	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_MK360096	Salmonella enterica strain 13-SA02717 plasmid pSE13-SA02717, complete sequence	44664-44697	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP045839	Citrobacter sp. H12-3-2 plasmid pH12-2, complete sequence	48284-48317	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP032381	Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69807 plasmid pSDU2-USMARC-69807, complete sequence	12454-12487	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_MG825381	Escherichia coli strain 1108 plasmid p1108-NDM, complete sequence	43402-43435	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	MT197111	Escherichia coli strain RB3-1 plasmid pRB3-1_31K_tetX, complete sequence	12897-12930	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	MT219817	Escherichia coli strain RF148-2 plasmid pRF148-2_101k_tetX, complete sequence	59284-59317	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	MT219819	Escherichia coli strain RF52-1 plasmid pRF52-1_119k_tetX, complete sequence	118931-118964	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	MT219821	Escherichia coli strain RF45-1 plasmid pRF45-1_31k_tetX, complete sequence	3734-3767	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_MG288677	Klebsiella pneumoniae strain F160070 plasmid p160070-CTXM, complete sequence	29004-29037	0	1.0
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP030195	Salmonella enterica strain SA20080453 plasmid pSA20080453.1, complete sequence	159-192	1	0.971
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP033353	Salmonella enterica subsp. enterica strain CFSA664 plasmid pCFSA664-1, complete sequence	78450-78483	2	0.941
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP050780	Salmonella enterica subsp. enterica serovar Indiana strain SI85 plasmid pSI85-1, complete sequence	203947-203980	2	0.941
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP022061	Salmonella enterica strain FDAARGOS_312 plasmid unnamed2, complete sequence	1711-1744	2	0.941
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	CP048927	Salmonella enterica subsp. enterica serovar Saintpaul strain NY-N14748 plasmid pN14748, complete sequence	45611-45644	2	0.941
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP029841	Salmonella enterica subsp. enterica serovar Typhimurium strain 01ST04081 plasmid p01ST04081A, complete sequence	98434-98467	2	0.941
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP028313	Salmonella enterica subsp. enterica serovar Heidelberg strain CFSAN067218 plasmid pSH-04-2, complete sequence	41569-41602	2	0.941
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP018662	Salmonella enterica subsp. enterica serovar Enteritidis strain 95-0621 plasmid pSE95-0621-1, complete sequence	41992-42025	2	0.941
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	CP049987	Salmonella enterica subsp. enterica serovar Saintpaul strain CVM N16S133 plasmid pN16S133, complete sequence	41386-41419	2	0.941
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	CP049982	Salmonella enterica subsp. enterica serovar Saintpaul strain CVM N52030 plasmid pN52030, complete sequence	42740-42773	2	0.941
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NC_010421	Salmonella enterica subsp. enterica serovar Dublin plasmid pOU1114, complete sequence	27662-27695	2	0.941
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_MK625201	Salmonella enterica subsp. enterica serovar Pullorum strain S9804 plasmid pSPUR, complete sequence	41824-41857	2	0.941
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP023476	Salmonella enterica subsp. enterica serovar Enteritidis strain FORC_075 plasmid pFORC75_2, complete sequence	33473-33506	2	0.941
NZ_LT904873_1	1.1\|5696\|34\|NZ_LT904873\|CRISPRCasFinder	5696-5729	34	NZ_CP044292	Escherichia coli strain P43A plasmid pP43A-1, complete sequence	44259-44292	4	0.882

1. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_KX518744 (Escherichia coli strain HYEC7 plasmid pHYEC7-110, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

2. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP041286 (Escherichia coli strain 54 plasmid p54-tetX, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

3. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_KU321583 (Escherichia coli strain E80 plasmid pE80, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

4. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_KT990220 (Escherichia coli strain 42-2 plasmid p42-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

5. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP010164 (Escherichia coli strain H2 plasmid A, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

6. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP019647 (Salmonella enterica subsp. enterica serovar Typhimurium strain TW-Stm6 plasmid pSTM6-275, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

7. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP022964 (Salmonella enterica subsp. enterica serovar Pullorum strain QJ-2D-Sal plasmid pQJDsal1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

8. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP024467 (Shigella dysenteriae strain BU53M1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

9. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_LS999563 (Escherichia coli isolate EC-TO143 plasmid 4, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

10. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_LS999563 (Escherichia coli isolate EC-TO143 plasmid 4, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

11. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP019284 (Escherichia coli strain 13P484A plasmid p13P484A-4, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

12. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP047093 (Salmonella sp. S13 plasmid pS13-4, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

13. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP051432 (Escherichia sp. SCLE84 plasmid pSCLE2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

14. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP046002 (Escherichia coli strain 1916D6 plasmid p1916D6-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

15. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP045188 (Escherichia coli strain NT1F31 plasmid pNT1F31-tetX4, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

16. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP031548 (Escherichia coli strain cq9 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

17. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP031548 (Escherichia coli strain cq9 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

18. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP032386 (Salmonella enterica subsp. enterica serovar Dublin strain CVM N53043 plasmid pN53043_2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

19. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP032389 (Salmonella enterica subsp. enterica serovar Dublin strain CVM N45955 plasmid pN45955_2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

20. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_LT904873 (Salmonella enterica subsp. enterica serovar Typhi strain ERL11909 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

21. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_KT754163 (Shigella dysenteriae 1 strain A5468 plasmid pA5468, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

22. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP033383 (Salmonella enterica subsp. enterica strain CFSA300 plasmid pCFSA300-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

23. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP020836 (Escherichia coli strain CFSAN051542 plasmid pCFSAN051542, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

24. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP038140 (Escherichia coli strain G3X16-2 plasmid pG3X16-2-3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

25. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP043216 (Salmonella enterica subsp. enterica serovar Heidelberg strain SL-312 plasmid pET8.2-IncX1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

26. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP042617 (Escherichia coli strain NCYU-26-73 plasmid pNCYU-26-73-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

27. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP031361 (Salmonella enterica subsp. enterica serovar Heidelberg strain 5 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

28. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP044153 (Shigella flexneri strain AR-0425 plasmid pAR-0425-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

29. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP040929 (Escherichia coli strain YY76-1 plasmid pYY76-1-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

30. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP033386 (Salmonella enterica subsp. enterica strain CFSA1007 plasmid pCFSA1007-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

31. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP041177 (Salmonella enterica subsp. enterica serovar Enteritidis strain SJTUF12367v2 plasmid p12367A, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

32. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP034761 (Klebsiella pneumoniae strain NB5306 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

33. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP050707 (Salmonella enterica subsp. enterica serovar Enteritidis strain SE124 plasmid pSE124-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

34. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP047339 (Klebsiella pneumoniae strain 2019036D plasmid p2019036D-35kb, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

35. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NC_010860 (Salmonella enterica subsp. enterica serovar Enteritidis plasmid pSE34, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

36. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP022453 (Salmonella enterica subsp. enterica serovar Indiana strain D90 plasmid pD90-3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

37. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP024153 (Escherichia coli strain 14EC033 plasmid p14EC033f, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

38. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP030208 (Salmonella enterica strain SA19992307 plasmid pSA19992307.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

39. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP005994 (Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002064 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

40. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP032450 (Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69838 plasmid pSDU1-USMARC-69838, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

41. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP010155 (Escherichia coli strain D9 plasmid C, complete genome) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

42. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP050174 (Escherichia coli strain STB20-1 plasmid pSTB20-1T, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

43. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP029061 (Escherichia coli strain FORC_081 plasmid pFORC_081_4, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

44. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP042589 (Escherichia coli strain PK6 plasmid pRHEcCUB-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

45. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP025677 (Escherichia albertii strain ChinaSP140150 plasmid pEA-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

46. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP041453 (Escherichia coli strain YPE3 plasmid pYPE3-92k-tetX4, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

47. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to MN816373 (Escherichia coli strain A127 plasmid pA127-X1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

48. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP052879 (Escherichia coli strain C21 plasmid pC21-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

49. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP033379 (Escherichia coli strain L73 plasmid pL73-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

50. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP033632 (Escherichia coli isolate ECCNB12-2 plasmid pTB-nb1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

51. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP050724 (Salmonella enterica subsp. enterica serovar Enteritidis strain SE74 plasmid pSE74-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

52. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP047573 (Escherichia coli strain 2EC1 plasmid p2EC1-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

53. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NC_019106 (Salmonella enterica subsp. enterica serovar Dublin plasmid pSD_77, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

54. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP010127 (Escherichia coli strain C8 plasmid B, complete genome) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

55. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP027138 (Escherichia coli strain AR_0369 plasmid unnamed2) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

56. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP022072 (Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_321 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

57. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP043935 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

58. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP043935 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

59. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP045998 (Escherichia coli strain 1916D18 plasmid p1916D18-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

60. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP032394 (Salmonella enterica subsp. enterica serovar Dublin strain CVM 22453 plasmid p22453_2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

61. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NC_019256 (Shigella sp. LN126 plasmid pLN126_33, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

62. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to MH884649 (Salmonella sp. strain Sa21 plasmid pSa21-IncX1-28K, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

63. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to MH884651 (Salmonella sp. strain Sa21 plasmid pSa21-TC-CIP, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

64. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to MH229869 (Escherichia coli plasmid pKANJ7, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

65. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP050713 (Salmonella enterica subsp. enterica serovar Enteritidis strain SE104 plasmid pSE104-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

66. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP041439 (Escherichia coli strain YPE12 plasmid pYPE12-106k, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

67. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP041443 (Escherichia coli strain YPE12 plasmid pYPE12-101k-tetX4, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

68. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_MK461931 (Escherichia coli strain F2_14D plasmid pF2_14D_HI2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

69. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_MK656937 (Escherichia coli strain T3 plasmid pT3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

70. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_MK731977 (Escherichia coli strain ENV103 plasmid pSGMCR103, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

71. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_MK673546 (Salmonella enterica subsp. enterica serovar Typhimurium strain GDD27-24 plasmid pGDD27-24, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

72. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP032447 (Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69840 plasmid pSDU1-USMARC-69840, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

73. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_MH179305 (Salmonella enterica subsp. enterica serovar Indiana strain JT01 plasmid pJT01, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

74. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_MH179305 (Salmonella enterica subsp. enterica serovar Indiana strain JT01 plasmid pJT01, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

75. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_MH287085 (Escherichia coli strain F2_12B plasmid pSDC-F2_12BHI2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

76. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_MH287084 (Escherichia coli O157 strain SvETEC plasmid pSDE-SvHI2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

77. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP025558 (Salmonella enterica subsp. enterica serovar Enteritidis strain PIR00532 plasmid p2PIR00532, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

78. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to MT219825 (Escherichia coli strain RW7-1 plasmid pRW7-1_235k_tetX, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

79. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to MT219826 (Escherichia coli strain RW8-1 plasmid pRW8-1_122k_tetX, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

80. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_MG904998 (Escherichia coli strain 15OD0495 plasmid p15ODTXV, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

81. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_MG197491 (Escherichia coli strain FKU92 plasmid pHNFKU92, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

82. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_MG197498 (Escherichia coli strain HZMCC14 plasmid pHNMCC14, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

83. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_MG197503 (Escherichia coli strain ZYTM118 plasmid pHNZY118, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

84. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_MG197495 (Escherichia coli strain AHC24 plasmid pHNAH24, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

85. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_MF589339 (Escherichia coli strain 2271 plasmid pCTXM-2271, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

86. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_MG197502 (Escherichia coli strain ZYTF32 plasmid pHNZY32, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

87. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to MT219818 (Escherichia coli strain RF148-1 plasmid pRF148-1_119k_tetX, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

88. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to MT219820 (Escherichia coli strain RF108-2 plasmid pRF108-2_97k_tetX, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

89. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to MT219822 (Escherichia coli strain RF14-1 plasmid pRF14-1_50k_tetX, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

90. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to MT219823 (Escherichia coli strain RF10-1 plasmid pRF10-1_119k_tetX, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

91. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NC_023323 (Escherichia coli ACN001 plasmid pACN001-A, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

92. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to MF554637 (uncultured bacterium clone AA-100 plasmid pPIMMR, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

93. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP016575 (Salmonella enterica subsp. enterica serovar Heidelberg strain AMR588-04-00435 plasmid pAMR588-04-00435_37, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

94. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP020060 (Escherichia coli strain AR_0061 plasmid unitig_2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

95. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP032994 (Escherichia coli strain W5-6 plasmid p2_W5-6, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

96. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to MN783746 (Escherichia coli plasmid pIncX1_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

97. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_KX815983 (Salmonella enterica subsp. enterica serovar Dublin strain N13-01125 plasmid pN13-01125, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

98. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_KU254580 (Escherichia coli strain YD786 plasmid pYD786-3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

99. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP042633 (Escherichia coli strain NCYU-25-82 plasmid pNCYU-25-82-6, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

100. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP032392 (Salmonella enterica subsp. enterica serovar Dublin strain CVM 34981 plasmid p34981_2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

101. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP019272 (Escherichia coli strain 13P460A plasmid p13P460A-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

102. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP053728 (Escherichia coli strain CP61_Sichuan plasmid pCP61-IncN, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

103. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP037995 (Salmonella enterica subsp. enterica serovar Brancaster strain sg_ww281 plasmid psg_ww281) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

104. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP053740 (Escherichia coli strain CP8-3_Sichuan plasmid pCP8-3-IncX1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

105. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP016580 (Salmonella enterica subsp. enterica serovar Heidelberg strain SH13-006 plasmid pSH13-006_37, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

106. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP046001 (Escherichia coli strain 1916D6 plasmid p1916D6-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

107. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP021103 (Escherichia coli strain 13P477T plasmid p13P477T-7, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

108. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP029182 (Escherichia coli strain H9Ecoli plasmid p3-H9, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

109. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to MN086778 (Escherichia coli plasmid p16EC-IncN, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

110. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP053047 (Escherichia fergusonii strain HNCF11W plasmid pHNCF11W-tetX4, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

111. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP014974 (Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1898 isolate ST073 plasmid pSTY3-1898, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

112. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP032397 (Salmonella enterica subsp. enterica serovar Dublin strain CVM 22429 plasmid p22429, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

113. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP035774 (Klebsiella pneumoniae strain R46 plasmid pR46-27, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

114. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP044182 (Salmonella enterica subsp. enterica serovar Heidelberg strain AR-0404 plasmid pAR-0404-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

115. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP042608 (Escherichia coli strain NCYU-29-19 plasmid pNCYU-29-19-2_MCR3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

116. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to MK461930 (Escherichia coli strain 2009_36 plasmid p2009_36_HI2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

117. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NC_019046 (Escherichia coli plasmid pNMEC31_31, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

118. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP047460 (Escherichia coli strain ZF31 plasmid pZF31-tetX-119kb, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

119. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP047466 (Escherichia coli strain ZF34 plasmid pZF34-tetX-114kb, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

120. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP035315 (Escherichia coli strain D72 plasmid pD72-IncX1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

121. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP050748 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST53 plasmid pST53-3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

122. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NC_024961 (Escherichia coli plasmid pIS15_43, strain ISI5, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

123. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NC_021842 (Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069 plasmid pCFSAN002069_02, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

124. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_LT985261 (Escherichia coli strain 657 plasmid RCS50_p, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

125. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_AP019678 (Escherichia coli strain GSH8M-2 plasmid pGSH8M-2-3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

126. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP009074 (Escherichia coli ATCC 25922 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

127. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP010168 (Escherichia coli strain H3 plasmid A, complete genome) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

128. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NC_010378 (Escherichia coli plasmid pOLA52, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

129. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to CP016512 (Salmonella enterica subsp. enterica serovar Heidelberg strain SH14-028 plasmid pSH14-028_37, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

130. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP016529 (Salmonella enterica subsp. enterica serovar Heidelberg strain 09-036813-1A plasmid p09-036813-1A_42, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

131. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP016518 (Salmonella enterica subsp. enterica serovar Heidelberg strain CE-R2-11-0435 plasmid pCE-R2-11-0435_37, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

132. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP032988 (Escherichia coli strain BE2-5 plasmid p2_BE2-5, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

133. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP017633 (Escherichia coli strain SLK172 plasmid pSLK172-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

134. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP012922 (Salmonella enterica subsp. enterica serovar Heidelberg strain SA02DT10168701 plasmid pSA02DT10168701_37, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

135. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP033093 (Escherichia coli strain CP53 plasmid pCP53-38k, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

136. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP012926 (Salmonella enterica subsp. enterica serovar Heidelberg strain 12-4374 plasmid p12-4374_37, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

137. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP023360 (Escherichia coli strain 1943 plasmid p54, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

138. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to CP043734 (Escherichia coli strain CVM N17EC1164 plasmid pN17EC1164-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

139. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP039600 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014867 plasmid p12-6334.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

140. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP030283 (Escherichia coli strain E308 plasmid pLKSZ02, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

141. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NC_011204 (Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 plasmid pCT02021853_74, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

142. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NC_017624 (Salmonella enterica subsp. enterica serovar Heidelberg str. B182 plasmid pB182_37, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

143. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP050710 (Salmonella enterica subsp. enterica serovar Enteritidis strain SE109 plasmid pSE109-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

144. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP024290 (Escherichia coli O178:H19 strain 2012C-4431 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

145. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP048777 (Salmonella enterica subsp. enterica serovar Agona strain SG17-135 plasmid pSG17-135-X, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

146. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP041631 (Escherichia coli strain PE15 plasmid pPE15-27K, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

147. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP050773 (Salmonella enterica subsp. enterica serovar Indiana strain SI102 plasmid pSI102-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

148. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP041444 (Escherichia coli strain YPE10 plasmid pYPE10-78k, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

149. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP019180 (Salmonella enterica subsp. enterica serovar Dublin str. ATCC 39184 plasmid pATCC39184, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

150. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP050765 (Salmonella enterica subsp. enterica serovar Indiana strain SI111 plasmid pSI111-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

151. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NC_010422 (Salmonella enterica subsp. enterica serovar Dublin plasmid pOU1115, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

152. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP050759 (Salmonella enterica subsp. enterica serovar Indiana strain SI173 plasmid pSI173-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

153. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_AP022652 (Escherichia coli strain 09-02E plasmid p2-09-02E, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

154. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP024136 (Escherichia coli strain 14EC017 plasmid p14EC017b, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

155. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_LT985315 (Escherichia coli strain ECOR 70 plasmid RCS99_p, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

156. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to MN436006 (Escherichia coli strain JS1-EC05 plasmid pEC05-X4, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

157. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to MN436007 (Escherichia coli strain JS3-EC12 plasmid pEC12-X4, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

158. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_MK360096 (Salmonella enterica strain 13-SA02717 plasmid pSE13-SA02717, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

159. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP045839 (Citrobacter sp. H12-3-2 plasmid pH12-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

160. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP032381 (Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69807 plasmid pSDU2-USMARC-69807, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

161. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_MG825381 (Escherichia coli strain 1108 plasmid p1108-NDM, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

162. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to MT197111 (Escherichia coli strain RB3-1 plasmid pRB3-1_31K_tetX, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

163. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to MT219817 (Escherichia coli strain RF148-2 plasmid pRF148-2_101k_tetX, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

164. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to MT219819 (Escherichia coli strain RF52-1 plasmid pRF52-1_119k_tetX, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

165. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to MT219821 (Escherichia coli strain RF45-1 plasmid pRF45-1_31k_tetX, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

166. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_MG288677 (Klebsiella pneumoniae strain F160070 plasmid p160070-CTXM, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

167. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP030195 (Salmonella enterica strain SA20080453 plasmid pSA20080453.1, complete sequence) position: , mismatch: 1, identity: 0.971

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaatcacag	Protospacer
*****************************.****

168. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP033353 (Salmonella enterica subsp. enterica strain CFSA664 plasmid pCFSA664-1, complete sequence) position: , mismatch: 2, identity: 0.941

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gcccgcagccatccacctttcatgaaaattacag	Protospacer
*. *******************************

169. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP050780 (Salmonella enterica subsp. enterica serovar Indiana strain SI85 plasmid pSI85-1, complete sequence) position: , mismatch: 2, identity: 0.941

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gcccgcagccatccacctttcatgaaaattacag	Protospacer
*. *******************************

170. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP022061 (Salmonella enterica strain FDAARGOS_312 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.941

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgtacccatccacctttcatgaaaattacag	Protospacer
*****.* **************************

171. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to CP048927 (Salmonella enterica subsp. enterica serovar Saintpaul strain NY-N14748 plasmid pN14748, complete sequence) position: , mismatch: 2, identity: 0.941

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgtacccatccacctttcatgaaaattacag	Protospacer
*****.* **************************

172. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP029841 (Salmonella enterica subsp. enterica serovar Typhimurium strain 01ST04081 plasmid p01ST04081A, complete sequence) position: , mismatch: 2, identity: 0.941

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgtacccatccacctttcatgaaaattacag	Protospacer
*****.* **************************

173. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP028313 (Salmonella enterica subsp. enterica serovar Heidelberg strain CFSAN067218 plasmid pSH-04-2, complete sequence) position: , mismatch: 2, identity: 0.941

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgtacccatccacctttcatgaaaattacag	Protospacer
*****.* **************************

174. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP018662 (Salmonella enterica subsp. enterica serovar Enteritidis strain 95-0621 plasmid pSE95-0621-1, complete sequence) position: , mismatch: 2, identity: 0.941

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgtacccatccacctttcatgaaaattacag	Protospacer
*****.* **************************

175. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to CP049987 (Salmonella enterica subsp. enterica serovar Saintpaul strain CVM N16S133 plasmid pN16S133, complete sequence) position: , mismatch: 2, identity: 0.941

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgtacccatccacctttcatgaaaattacag	Protospacer
*****.* **************************

176. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to CP049982 (Salmonella enterica subsp. enterica serovar Saintpaul strain CVM N52030 plasmid pN52030, complete sequence) position: , mismatch: 2, identity: 0.941

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgtacccatccacctttcatgaaaattacag	Protospacer
*****.* **************************

177. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NC_010421 (Salmonella enterica subsp. enterica serovar Dublin plasmid pOU1114, complete sequence) position: , mismatch: 2, identity: 0.941

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgtacccatccacctttcatgaaaattacag	Protospacer
*****.* **************************

178. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_MK625201 (Salmonella enterica subsp. enterica serovar Pullorum strain S9804 plasmid pSPUR, complete sequence) position: , mismatch: 2, identity: 0.941

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgtacccatccacctttcatgaaaattacag	Protospacer
*****.* **************************

179. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP023476 (Salmonella enterica subsp. enterica serovar Enteritidis strain FORC_075 plasmid pFORC75_2, complete sequence) position: , mismatch: 2, identity: 0.941

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgtacccatccacctttcatgaaaattacag	Protospacer
*****.* **************************

180. spacer 1.1|5696|34|NZ_LT904873|CRISPRCasFinder matches to NZ_CP044292 (Escherichia coli strain P43A plasmid pP43A-1, complete sequence) position: , mismatch: 4, identity: 0.882

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
tcgaacagccatccacctttcatgaaaattacag	Protospacer
 .* .*****************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_LT904872

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_LT904872_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_LT904872_1

4075845-4076143

TypeI-E

I-E

Consensus_repeat	Method
CGGTTTATCCCCGCTGGCGCGGGGAACAC	CRT
GTTTATCCCCGCTGGCGCGGGGAACAC	PILER-CR
GTTTATCCCCGCTGGCGCGGGGAACAC	CRISPRCasFinder

4 spacers

cas2,cas1,cas6e,cas5,cas7,cse2gr11,cas8e

The CRISPR arrays of NZ_LT904872_1

>merge|NZ_LT904872|1|4075845-4076143|CRT,PILER-CR,CRISPRCasFinder
GTGTTTATCCCCGCTGGCGCGGGGAACACGGACAGCAACCCGTGTCGGATATCAGACAGATCGGTTTATCCCCGCTGGCGCGGGGAACACACGCGAATCGCCAATCGCCGCCGCGTGAATTGCGGTTTATCCCCGCTGGCGCGGGGAACACATTAAAAAAGATTAATGTTGGTTATAGTTTTACGGTTTATCCCCGCTGGTGCGGGGAACACTAAAACACCGGTTGCGCAACCTCCGCGGGGATCGGTTTATCCCCGCTGGCGCGGGGATCGGTTTATCCCCGCTGGCGCGGGGAACAC

>NZ_LT904872|1|1|4075845-4076117|CRT
GTGTTTATCCCCGCTGGCGCGGGGAACAC	GGACAGCAACCCGTGTCGGATATCAGACAGAT
CGGTTTATCCCCGCTGGCGCGGGGAACAC	ACGCGAATCGCCAATCGCCGCCGCGTGAATTG
CGGTTTATCCCCGCTGGCGCGGGGAACAC	ATTAAAAAAGATTAATGTTGGTTATAGTTTTA
CGGTTTATCCCCGCTGGTGCGGGGAACAC	TAAAACACCGGTTGCGCAACCTCCGCGGGGAT
CGGTTTATCCCCGCTGGCGCGGGGATCGG

>NZ_LT904872|1|1|4075847-4076143|PILER-CR
GTTTATCCCCGCTGGCGCGGGGAACAC	GGACAGCAACCCGTGTCGGATATCAGACAGATCG
GTTTATCCCCGCTGGCGCGGGGAACAC	ACGCGAATCGCCAATCGCCGCCGCGTGAATTGCG
GTTTATCCCCGCTGGCGCGGGGAACAC	ATTAAAAAAGATTAATGTTGGTTATAGTTTTACG
GTTTATCCCCGCTGGTGCGGGGAACAC	TAAAACACCGGTTGCGCAACCTCCGCGGGGATCGGTTTATCCCCGCTGGCGCGGGGATCG
GTTTATCCCCGCTGGCGCGGGGAACAC

>NZ_LT904872|1|1|4075847-4076117|CRISPRCasFinder
GTTTATCCCCGCTGGCGCGGGGAACAC	GGACAGCAACCCGTGTCGGATATCAGACAGATCG
GTTTATCCCCGCTGGCGCGGGGAACAC	ACGCGAATCGCCAATCGCCGCCGCGTGAATTGCG
GTTTATCCCCGCTGGCGCGGGGAACAC	ATTAAAAAAGATTAATGTTGGTTATAGTTTTACG
GTTTATCCCCGCTGGTGCGGGGAACAC	TAAAACACCGGTTGCGCAACCTCCGCGGGGATCG
GTTTATCCCCGCTGGCGCGGGGATCGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_LT904872.1\|WP_000935107.1\|4079960_4080563_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	cd09670_cse2gr11_CAS-I-E	gnl\|CDD\|274193
NZ_LT904872.1\|WP_001537530.1\|4071209_4071533_-\|DUF3561-family-protein	unknown	unknown	gnl\|CDD\|371891
NZ_LT904872.1\|WP_000118669.1\|4076523_4077441_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
NZ_LT904872.1\|WP_001145541.1\|4085553_4086507_+\|SPI-1-type-III-secretion-system-effector-SopD	unknown	unknown	gnl\|CDD\|185277
NZ_LT904872.1\|WP_000517480.1\|4070707_4071019_-\|cell-division-protein-FtsB	unknown	unknown	gnl\|CDD\|179156
NZ_LT904872.1\|WP_000281411.1\|4077440_4078145_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	cd09664_cas6e_CAS-I-E	gnl\|CDD\|187795
NZ_LT904872.1\|WP_000666425.1\|4078144_4078870_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	gnl\|CDD\|187776
NZ_LT904872.1\|WP_001219244.1\|4069499_4069979_-\|2-C-methyl-D-erythritol-2,4-cyclodiphosphate-synthase	unknown	unknown	gnl\|CDD\|178851
NZ_LT904872.1\|WP_000134253.1\|4068453_4069503_-\|tRNA-pseudouridine(13)-synthase-TruD	unknown	unknown	gnl\|CDD\|234884
NZ_LT904872.1\|WP_001092273.1\|4072175_4073615_-\|sulfate-adenylyltransferase-subunit-CysN	unknown	unknown	gnl\|CDD\|235349
NZ_LT904872.1\|WP_000490486.1\|4074783_4075830_+\|aminopeptidase	unknown	unknown	gnl\|CDD\|182299
NZ_LT904872.1\|WP_000080393.1\|4086594_4087329_-\|phosphoadenosine-phosphosulfate-reductase	unknown	unknown	gnl\|CDD\|234997
NZ_LT904872.1\|WP_000372384.1\|4073624_4074533_-\|sulfate-adenylyltransferase-subunit-CysD	unknown	unknown	gnl\|CDD\|235375
NZ_LT904872.1\|WP_000366321.1\|4080579_4082115_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09669_cas8e_CAS-I-E	gnl\|CDD\|274192
NZ_LT904872.1\|WP_000741649.1\|4069978_4070689_-\|2-C-methyl-D-erythritol-4-phosphate-cytidylyltransferase	unknown	unknown	gnl\|CDD\|234670
NZ_LT904872.1\|WP_001291998.1\|4087404_4089117_-\|assimilatory-sulfite-reductase-(NADPH)-hemoprotein-subunit	unknown	unknown	gnl\|CDD\|237402
NZ_LT904872.1\|WP_001221538.1\|4067711_4068473_-\|5'/3'-nucleotidase-SurE	unknown	unknown	gnl\|CDD\|234732
NZ_LT904872.1\|WP_001681565.1\|4078879_4079938_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
NZ_LT904872.1\|WP_001173663.1\|4071583_4072189_-\|adenylyl-sulfate-kinase	unknown	unknown	gnl\|CDD\|179661
NZ_LT904872.1\|WP_000062282.1\|4076227_4076521_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	cas2	cd09648_cas2_CAS-I-E	gnl\|CDD\|236930

Protein	Function_ID	Function_description	E-value
NZ_LT904872.1\|WP_000935107.1\|4079960_4080563_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|274193	TIGR02548, CRISPR_system_Cascade_subunit_CasB, CRISPR type I-E/ECOLI-associated protein CasB/Cse2. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This model family is found in Ecoli subtype CRISPR/Cas regions of many bacteria, most of which are mesophiles, and not in Archaea. It was designated Cse2 originally, and renamed CasB based on its characterization in the CASCADE complex.	5.74874e-39
NZ_LT904872.1\|WP_001537530.1\|4071209_4071533_-\|DUF3561-family-protein	gnl\|CDD\|371891	pfam12084, DUF3561, Protein of unknown function (DUF3561). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are about 110 amino acids in length.	3.31009e-48
NZ_LT904872.1\|WP_000118669.1\|4076523_4077441_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	1.77553e-155
NZ_LT904872.1\|WP_001145541.1\|4085553_4086507_+\|SPI-1-type-III-secretion-system-effector-SopD	gnl\|CDD\|185277	PRK15379, PRK15379, type III secretion system effector SopD.	0
NZ_LT904872.1\|WP_000517480.1\|4070707_4071019_-\|cell-division-protein-FtsB	gnl\|CDD\|179156	PRK00888, ftsB, cell division protein FtsB; Reviewed.	1.08865e-64
NZ_LT904872.1\|WP_000281411.1\|4077440_4078145_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|187795	cd09664, Cas6_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas6e. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas6e is an endoribonuclease that generates crRNA; This family is specific for CRISPR/Cas system I-E subtype; Homologous to Cas6 (RAMP superfamily protein); Possesses double RRM/ferredoxin fold; also known as Cse3 family.	2.23447e-89
NZ_LT904872.1\|WP_000666425.1\|4078144_4078870_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|187776	cd09645, Cas5_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex.	3.27863e-48
NZ_LT904872.1\|WP_001219244.1\|4069499_4069979_-\|2-C-methyl-D-erythritol-2,4-cyclodiphosphate-synthase	gnl\|CDD\|178851	PRK00084, ispF, 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase; Reviewed.	1.27909e-104
NZ_LT904872.1\|WP_000134253.1\|4068453_4069503_-\|tRNA-pseudouridine(13)-synthase-TruD	gnl\|CDD\|234884	PRK00984, truD, tRNA pseudouridine synthase D; Reviewed.	0
NZ_LT904872.1\|WP_001092273.1\|4072175_4073615_-\|sulfate-adenylyltransferase-subunit-CysN	gnl\|CDD\|235349	PRK05124, cysN, sulfate adenylyltransferase subunit 1; Provisional.	0
NZ_LT904872.1\|WP_000490486.1\|4074783_4075830_+\|aminopeptidase	gnl\|CDD\|182299	PRK10199, PRK10199, alkaline phosphatase isozyme conversion aminopeptidase; Provisional.	0
NZ_LT904872.1\|WP_000080393.1\|4086594_4087329_-\|phosphoadenosine-phosphosulfate-reductase	gnl\|CDD\|234997	PRK02090, PRK02090, phosphoadenylyl-sulfate reductase.	6.97131e-138
NZ_LT904872.1\|WP_000372384.1\|4073624_4074533_-\|sulfate-adenylyltransferase-subunit-CysD	gnl\|CDD\|235375	PRK05253, PRK05253, sulfate adenylyltransferase subunit CysD.	0
NZ_LT904872.1\|WP_000366321.1\|4080579_4082115_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|274192	TIGR02547, CRISPR_system_Cascade_subunit_CasA, CRISPR type I-E/ECOLI-associated protein CasA/Cse1. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This model family, represented by CT1972 from Chlorobium tepidum, is found in Ecoli subtype CRISPR/Cas regions of many bacteria, most of which are mesophiles, and not in Archaea. It is designated Cse1.	0
NZ_LT904872.1\|WP_000741649.1\|4069978_4070689_-\|2-C-methyl-D-erythritol-4-phosphate-cytidylyltransferase	gnl\|CDD\|234670	PRK00155, ispD, D-ribitol-5-phosphate cytidylyltransferase.	2.24126e-119
NZ_LT904872.1\|WP_001291998.1\|4087404_4089117_-\|assimilatory-sulfite-reductase-(NADPH)-hemoprotein-subunit	gnl\|CDD\|237402	PRK13504, PRK13504, NADPH-dependent assimilatory sulfite reductase hemoprotein subunit.	0
NZ_LT904872.1\|WP_001221538.1\|4067711_4068473_-\|5'/3'-nucleotidase-SurE	gnl\|CDD\|234732	PRK00346, surE, 5'(3')-nucleotidase/polyphosphatase; Provisional.	1.7078e-146
NZ_LT904872.1\|WP_001681565.1\|4078879_4079938_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	3.49739e-119
NZ_LT904872.1\|WP_001173663.1\|4071583_4072189_-\|adenylyl-sulfate-kinase	gnl\|CDD\|179661	PRK03846, PRK03846, adenylylsulfate kinase; Provisional.	4.61291e-146
NZ_LT904872.1\|WP_000062282.1\|4076227_4076521_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|236930	PRK11558, PRK11558, putative ssRNA endonuclease; Provisional.	5.81067e-65

>NZ_LT904872.1|WP_000490486.1|4074783_4075830_+|aminopeptidase
MFSATRRFAVILALGVGFILPAQAASPGPGEIANTQARHIATFFPGRMTGSPAEMLSADYLRQQFTQMGYQSDIRTFNSRFIYTTKDNRKNWHNVTGSTVIAAHEGRVPQQIIIMAHLDTYAPQSDADVDANLGGLTLQGMDDNAAGLGVMLELAARLKDIPTHYGIRFIATSGEEEGKLGAENLLKRMSDAEKKNTLLVINLNNLIVGDKLYFNSGKNTPEAVRTLTRDRALAIARRYGIAANTNPGRNPSYPKGTGCCNDAEVFDKAGISVLSVEATNWNLGKKDGYQQRVKNASFPNGNSWHDVRLDNQQHIDKALPGRIERRSRDVVRIMLPLVKELAKAEKTS
>NZ_LT904872.1|WP_000372384.1|4073624_4074533_-|sulfate-adenylyltransferase-subunit-CysD
MDQKRLTHLRQLEAESIHIIREVAAEFANPVMLYSIGKDSSVMLHLARKAFYPGTLPFPLLHVDTGWKFREMYAFRDRTANAYGCELLVHKNPEGVAMGINPFVHGSAKHTDIMKTEGLKQALNKYGFDAAFGGARRDEEKSRAKERIYSFRDRFHRWDPKNQRPELWRNYNGQINKGESIRVFPLSNWTEQDIWQYIWLENIDIVPLYLAAERPVLERDGMLMMVDDDRIDLQPGEVIKKRMVRFRTLGCWPLTGAVESHAQTLPEIIEEMLVSTTSERQGRMIDRDQAGSMELKKRQGYF
>NZ_LT904872.1|WP_001092273.1|4072175_4073615_-|sulfate-adenylyltransferase-subunit-CysN
MNTILAQQIASEGGVEAWMIAQQHKSLLRFLTCGSVDDGKSTLIGRLLHDTLQIYEDQLSSLHNDSKRHGTQGEKLDLALLVDGLQAEREQGITIDVAYRYFSTEKRKFIIADTPGHEQYTRNMATGASTCDLAILLIDARKGVLDQTRRHSFISTLLGIKHLVVAINKMDLVDYREETFARIREDYLTFAEQLPGDLDIRFVPLSALEGDNVAAQSANMRWYSGPTLLEVLETVDIQRAVDRQPMRFPVQYVNRPNPDFRGYAGTLASGSVKVGERIKVLPSGVESSVARIVTFDGDKEEVCAGEAITLVLNDDIDISRGDLLLAANETLAPARHAAIDVVWMAEQPLAPGQSYDVKLAGKKTRARIEAICYQIDINNLTQRDVESLPLNGIGLVEMTFDEPLALDIYQQNPVTGGLIFIDRLSNVTVGAGMVRELDERGATPPVEYSAFELELNALVRRHFPHWDARDLLGDKHGAA
>NZ_LT904872.1|WP_001173663.1|4071583_4072189_-|adenylyl-sulfate-kinase
MALHDENVVWHSHPVTVAAREQLHGHRGVVLWFTGLSGSGKSTVAGALEEALHQRGVSTYLLDGDNVRHGLCRDLGFSDADRQENIRRVGEVASLMADAGLIVLTAFISPHRAERQLVKERVGHDRFIEIYVNTPLAICEQRDPKGLYKKARAGELRNFTGIDAIYEAPDSPQVHLNGEQLVTNLVSQLLDLLRRRDIIRS
>NZ_LT904872.1|WP_001537530.1|4071209_4071533_-|DUF3561-family-protein
MRNSHNITFTRSDAFMVDDDATSAFPGAVVGFVSWLLALGIPFLLYGPNTLFFFLYTWPFFLALMPVSVIIGIALHLLVKGKILFSIMFTLLAVGALFGALFIWLLG
>NZ_LT904872.1|WP_000517480.1|4070707_4071019_-|cell-division-protein-FtsB
MGKLTLLLLALLVWLQYSLWFGKNGIHDYSRVNDDVVAQQATNAKLKARNDQLFAEIDDLNGGQEAIEERARNELSMTKPGETFYRLVPDASKRAATAGQTHR
>NZ_LT904872.1|WP_000741649.1|4069978_4070689_-|2-C-methyl-D-erythritol-4-phosphate-cytidylyltransferase
MAATLLDVCAVVPAAGFGRRMQTECPKQYLSIGNKTILEHSVHALLAHPRVTRVVIAISPGDHRFAQLPLANHPQITVVDGGNERADSVLAGLQAVAKAQWVLVHDAARPCLHQDDLARLLAISENSRVGGILASPVRDTMKRGEPGKNAIAHTVERADLWHALTPQFFPRELLHDCLTRALNEGATITDEASALEYCGFHPALVEGRADNIKVTRPEDLALAEFYLTRTIHQEKA
>NZ_LT904872.1|WP_001219244.1|4069499_4069979_-|2-C-methyl-D-erythritol-2,4-cyclodiphosphate-synthase
MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLMKAAK
>NZ_LT904872.1|WP_000134253.1|4068453_4069503_-|tRNA-pseudouridine(13)-synthase-TruD
MTEFDNLTWLHGKPQGSGLLKANPEDFVVVEDLGFTPDGEGEHILLRILKNGCNTRFVADVLAKFLKIHAREVSFAGQKDKHAVTEQWLCARVPGKEMPDFSAFQLEGCKVLEYARHKRKLRLGALKGNAFTLVLREISDRRDVETRLQAIRDGGVPNYFGAQRFGIGGSNLQGALRWAQSNAPVRDRNKRSFWLSAARSALFNQIVHQRLKKPDFNQVVDGDALQLAGRGSWFVATSEELPELQRRVDEKELMITASLPGSGEWGTQRAALAFEQDAIAQETVLQSLLLREKVEASRRAMLLYPQQLSWNWWDDVTVELRFWLPAGSFATSVVRELINTMGDYAHIAE
>NZ_LT904872.1|WP_001221538.1|4067711_4068473_-|5'/3'-nucleotidase-SurE
MRILLSNDDGVHAPGIQTLAKALREFADVQVVAPDRNRSGASNSLTLESSLRTFTFDNGDIAVQMGTPTDCVYLGVNALMRPRPDIVVSGINAGPNLGDDVIYSGTVAAAMEGRHLGFPALAVSLNGYQHYDTAAAVTCALLRGLSREPLRTGRILNVNVPDLPLAQVKGIRVTRCGSRHPADKVIPQEDPRGNTLYWIGPPGDKYDAGPDTDFAAVDEGYVSVTPLHVDLTAHSAHDVVSDWLDSVGVGTQW
>NZ_LT904872.1|WP_000062282.1|4076227_4076521_-|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MSMLVVVTENVPPRLRGRLAVWLLEIRAGVYVGDVSAKIREMIWQQVSVLADEGNVVMAWATNTESGFEFQTFGVNRRIPVDLDGLRLVSFLPVENQ
>NZ_LT904872.1|WP_000118669.1|4076523_4077441_-|type-I-E-CRISPR-associated-endonuclease-Cas1
MSWLPLNPIPLKDRVSMIFLQYGQIDVIDGAFVLIDKTGVRTHIPVGSVACIMLEPGTRVSHAAVRLAATVGTLLVWGGEAGVRVYASGQPGGARSDKLLYQAKLALDEDLRLKVVRKMFELRFGEPAPSRRSVDQLRGIEGSRVRATYALLAKQYGVKWQGRRYDPKDWEKGDVINQCISSATSCLYGVTEAAILAAGYAPAIGFVHTGKPLSFVYDIADIIKFEIVVPKAFEIARRNPAEPDRDVRIACRDIFRSGKTLAKLIPLIEDVLAAGEIQPPLPPEDSHPIAIPLPVALGDSGHRST
>NZ_LT904872.1|WP_000281411.1|4077440_4078145_-|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MYLSRIQLRFNNLRPEMLAKWNSARPYASHQWLWQLFPEQELRQFLFREEAHGGFFMLSAIPPLLQHSLFLIETKLFNPQLTNGLELDFQLRANPVITRNGKRSDVMMNAKHQAKANGVEKERWWELQQQAAQAWLEQQGQQHGFRLIAPEPDDFAMWAGDEYSELQAHCGCVQAYQQHRFVRKDQETPITFSSVDFSGALCITDAALFKQALFSGLGKSKALGCGMLMVKRKR
>NZ_LT904872.1|WP_000666425.1|4078144_4078870_-|type-I-E-CRISPR-associated-protein-Cas5/CasD
MKEYLVFQLYAPLASWGEEASGEIRHSATVPTRSALLGLLAAALGIRRDEEARLNNFNRHYHLAVHALASQDRWLRDYHTVSAPRENKKYRYYTRRDELTLASDEVGTLISQREYRCDGYWHVAISATPDAPYSLSELREALLTPHFPLYLGRKSCPLALPLAARLMTGTLKEVFTHAVEEISAAELSGFTLREGICYWDDPDEESLVWQQKQHSNNQPVSRQRWQFGGYTRFNGPLQERT
>NZ_LT904872.1|WP_001681565.1|4078879_4079938_-|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MTTFIQLHLLTAYAPANLNRDESGRPKTAFMGGVERLRVSSQSLKRAWRVSETFEAAMDGFMGKRTRRIGVDYVYRPMKDAGIEEKIAKSSSELIAKQFGKLKSDKDAKPEKNLEIEQIVHVSNHEISLIKQLVDTLIADKREPNDEEVKLLRKEQRSVDMALFDRMLASSPEFNVEAACQVSHALGVSAVTVESDFFTAVDDLNNKEEDAGSGHMGEQGFASALFYTYVCISRDLLVENLGGNEELAKRTIAALTETALTVSPTGKQNSFASRAYATYALAEVGQKQPRSLAAAFFQPVRDTDQIPAAITRLKQQRASFDSVYGNCADDYRELNVQEGTGSLAELLAFVSQ
>NZ_LT904872.1|WP_000935107.1|4079960_4080563_-|type-I-E-CRISPR-associated-protein-Cse2/CasB
MLNSNTAVLCRILHPDAQKALLDWFATLSERYERKDGKRVNGRAWRAELKRMAPPYGVMICEGHDALRQALLKHMRLQPLDEMALALFVSVAVHIKSHKENISFAAQLGEKLKGSTSCVSGLRFERLQKASDPETFCQLLIQAVKIRGTEGVNVLSLADGIFLWMEEWQRRENHQPEFRNPFERSRIRWANEYLSTSRGK
>NZ_LT904872.1|WP_000366321.1|4080579_4082115_-|type-I-E-CRISPR-associated-protein-Cse1/CasA
MDLTKEKWLPVIFSNGDKKKISLRDLLDNRIQDLAYPRADFQGAAWQMLIGILQCTVAPEDKEEWADIWHESIEFEQWEKALNTISLALQFGEQKPSFLQSFDPLDSEYGSIAGLLVDAPGGNALKLNKDHFVKRGNVEQICPHCAAIALFAIQTNSPAGGAGYRVGMRGGGPLTTLVVPQEEDKYPLWKKLWLNVLPQEEPPNVTQHPLIFPWLAPTKTSEKAGNVVTPDNAHPLQAYWGMPRRIELDFTHTVAGICDLCGEHHESLLLQMRSKNYGVQYDSWLHPFSPYRQALKDPSAPWLAFKGQPGGLSYKDWLGLMLNREDKFNKMQPAKVVRAAGQRNKMSLWCFAWDMNKAKVRCWYQHRIPLISVSHEEQFLAALNIVLVLASESLSLLRNALKSAKFDCPKEAKMDFSMVDIAFWQETEPAFRTLQEALAVDPLRQDTQTRHAVSQWEAELAHYLFHVFDRDALTNPDCPDDILQRQLTARQDLASSYRKHKARKDVLALVE
>NZ_LT904872.1|WP_001145541.1|4085553_4086507_+|SPI-1-type-III-secretion-system-effector-SopD
MPVTLSFGNHQNYTLNESRLAHLLSADKEKAIHMGGWDKVQDHFRAEKKDHALEVLHSIIHGQGRGEPGEMEVNVEDINKIYAFKRLQHLACPAHQDLFTIKMDASQTQFLLMVGDTVISQSNIKDILNISDDAVIESMSREERQLFLQICEVIGAKMTWHPELLQESISTLRKEVTGNAQIKAAVYEMMRPAEAPDHPLVEWQDSLTEDEKSMLACINAGNFEPTTQFCKIGYQEVQGEVAFSMMHPCISYLLHTYSPFAEFKPTNSGFLKKLNQDYNDYHAKKMFIDVILEKLYLTHERSLHIGKDGCSRNILLT
>NZ_LT904872.1|WP_000080393.1|4086594_4087329_-|phosphoadenosine-phosphosulfate-reductase
MSQLDLNALNELPKVDRVLALAETNAQLETLTAEERVAWALENLPGEYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGYLFPETYQFIDELTDKLKLNLKVYRAGESPAWQEARYGKLWEQGVEGIEKYNEINKVEPMNRALKELNAQTWFVGLRREQSGSRAHLPVLAIQRGVFKVLPIIDWDNRTVYQYLQKHGLKYHPLWAQGYLSVGDTHTTRKWEPGMAEEETRFFGLKRECGLHEG
>NZ_LT904872.1|WP_001291998.1|4087404_4089117_-|assimilatory-sulfite-reductase-(NADPH)-hemoprotein-subunit
MSEKYPGPLVVEGKLSDAERMKLESNYLRGTIAEDLNDGLTGGFKGDNFLLIRFHGMYQQDDRDIRAERAAQKLEPRHAMLLRCRLPGGVITTTQWQAIDKFAADNTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLHSVGLDALATANDMNRNVLCTSNPYESELHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTDEEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAENGKLVGFNLLVGGGLSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGLETFKAEVERRAGITFEPIRPYEFTGRGDRIGWVKGIDDKWHLTLFIENGRILDYPGRPLKTGLLEIAKIHQGEFRITANQNLIIASVPESQKAKIEKLARDHGLMNAVSAQRENSMACVSFPTCPLAMAEAERFLPSFTDKVEAILEKHGIPDEHIVMRVTGCPNGCGRAMLAEIGLVGKAPGRYNLHLGGNRIGSRIPRMYQENITEPDIQASLDELIGRWAKEREAGEGFGDFTVRAGIIRPVLDPARDFWE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_LT904872_1	1.3\|4075996\|32\|NZ_LT904872\|CRT	4075996-4076027	32	KJ019071	Synechococcus phage ACG-2014g isolate Syn7803US105, complete genome	59609-59640	7	0.781
NZ_LT904872_1	1.3\|4075996\|32\|NZ_LT904872\|CRT	4075996-4076027	32	MN694480	Marine virus AFVG_250M133, complete genome	20886-20917	7	0.781
NZ_LT904872_1	1.3\|4075996\|32\|NZ_LT904872\|CRT	4075996-4076027	32	MN694671	Marine virus AFVG_250M145, complete genome	23163-23194	7	0.781
NZ_LT904872_1	1.3\|4075996\|32\|NZ_LT904872\|CRT	4075996-4076027	32	MN694753	Marine virus AFVG_250M144, complete genome	25459-25490	7	0.781
NZ_LT904872_1	1.3\|4075996\|32\|NZ_LT904872\|CRT	4075996-4076027	32	MN694231	Marine virus AFVG_250M143, complete genome	21163-21194	7	0.781
NZ_LT904872_1	1.3\|4075996\|32\|NZ_LT904872\|CRT	4075996-4076027	32	MN693981	Marine virus AFVG_250M146, complete genome	18773-18804	7	0.781
NZ_LT904872_1	1.3\|4075996\|32\|NZ_LT904872\|CRT	4075996-4076027	32	NZ_CP046723	Pantoea agglomerans strain ASB05 plasmid pASB05p1, complete sequence	559039-559070	8	0.75
NZ_LT904872_1	1.3\|4075996\|32\|NZ_LT904872\|CRT	4075996-4076027	32	NZ_CP034470	Pantoea agglomerans strain CFSAN047153 plasmid pCFSAN047153_1, complete sequence	214654-214685	8	0.75
NZ_LT904872_1	1.3\|4075996\|32\|NZ_LT904872\|CRT	4075996-4076027	32	NZ_CP034149	Pantoea agglomerans strain L15 plasmid pPagL15_1, complete sequence	578776-578807	8	0.75
NZ_LT904872_1	1.3\|4075996\|32\|NZ_LT904872\|CRT	4075996-4076027	32	NZ_CP034475	Pantoea agglomerans strain CFSAN047154 plasmid pCFSAN047154_1, complete sequence	592092-592123	8	0.75
NZ_LT904872_1	1.3\|4075996\|32\|NZ_LT904872\|CRT	4075996-4076027	32	MN694115	Marine virus AFVG_250M901, complete genome	49467-49498	8	0.75
NZ_LT904872_1	1.7\|4075996\|34\|NZ_LT904872\|PILER-CR,CRISPRCasFinder	4075996-4076029	34	NZ_CP046723	Pantoea agglomerans strain ASB05 plasmid pASB05p1, complete sequence	559037-559070	8	0.765
NZ_LT904872_1	1.7\|4075996\|34\|NZ_LT904872\|PILER-CR,CRISPRCasFinder	4075996-4076029	34	NZ_CP034470	Pantoea agglomerans strain CFSAN047153 plasmid pCFSAN047153_1, complete sequence	214652-214685	8	0.765
NZ_LT904872_1	1.7\|4075996\|34\|NZ_LT904872\|PILER-CR,CRISPRCasFinder	4075996-4076029	34	NZ_CP034149	Pantoea agglomerans strain L15 plasmid pPagL15_1, complete sequence	578774-578807	8	0.765
NZ_LT904872_1	1.7\|4075996\|34\|NZ_LT904872\|PILER-CR,CRISPRCasFinder	4075996-4076029	34	NZ_CP034475	Pantoea agglomerans strain CFSAN047154 plasmid pCFSAN047154_1, complete sequence	592092-592125	8	0.765
NZ_LT904872_1	1.3\|4075996\|32\|NZ_LT904872\|CRT	4075996-4076027	32	NZ_CP046630	Streptococcus equinus strain CNU G6 plasmid p1_CNU_G6, complete sequence	66427-66458	9	0.719
NZ_LT904872_1	1.3\|4075996\|32\|NZ_LT904872\|CRT	4075996-4076027	32	NZ_CP046920	Streptococcus sp. CNU G2 plasmid p_CNU_G2, complete sequence	70206-70237	9	0.719
NZ_LT904872_1	1.3\|4075996\|32\|NZ_LT904872\|CRT	4075996-4076027	32	MN694046	Marine virus AFVG_250M906, complete genome	22321-22352	9	0.719
NZ_LT904872_1	1.3\|4075996\|32\|NZ_LT904872\|CRT	4075996-4076027	32	MN693836	Marine virus AFVG_250M487, complete genome	10882-10913	9	0.719
NZ_LT904872_1	1.3\|4075996\|32\|NZ_LT904872\|CRT	4075996-4076027	32	MN693891	Marine virus AFVG_250M480, complete genome	21841-21872	9	0.719
NZ_LT904872_1	1.3\|4075996\|32\|NZ_LT904872\|CRT	4075996-4076027	32	MK268344	Salmonella phage Munch, complete genome	122526-122557	9	0.719
NZ_LT904872_1	1.3\|4075996\|32\|NZ_LT904872\|CRT	4075996-4076027	32	MN694071	Marine virus AFVG_250M483, complete genome	16976-17007	9	0.719
NZ_LT904872_1	1.3\|4075996\|32\|NZ_LT904872\|CRT	4075996-4076027	32	MN694294	Marine virus AFVG_250M486, complete genome	8469-8500	9	0.719
NZ_LT904872_1	1.3\|4075996\|32\|NZ_LT904872\|CRT	4075996-4076027	32	MN693751	Marine virus AFVG_250M485, complete genome	13096-13127	9	0.719
NZ_LT904872_1	1.3\|4075996\|32\|NZ_LT904872\|CRT	4075996-4076027	32	MN694002	Marine virus AFVG_250M481, complete genome	18787-18818	9	0.719
NZ_LT904872_1	1.3\|4075996\|32\|NZ_LT904872\|CRT	4075996-4076027	32	MN694650	Marine virus AFVG_250M482, complete genome	20198-20229	9	0.719
NZ_LT904872_1	1.3\|4075996\|32\|NZ_LT904872\|CRT	4075996-4076027	32	MN693906	Marine virus AFVG_250M905, complete genome	17506-17537	9	0.719
NZ_LT904872_1	1.3\|4075996\|32\|NZ_LT904872\|CRT	4075996-4076027	32	MN694711	Marine virus AFVG_250M484, complete genome	24974-25005	9	0.719
NZ_LT904872_1	1.4\|4076057\|32\|NZ_LT904872\|CRT	4076057-4076088	32	KR052482	Sinorhizobium phage phiN3, complete genome	197290-197321	9	0.719
NZ_LT904872_1	1.7\|4075996\|34\|NZ_LT904872\|PILER-CR,CRISPRCasFinder	4075996-4076029	34	KJ019071	Synechococcus phage ACG-2014g isolate Syn7803US105, complete genome	59609-59642	9	0.735

1. spacer 1.3|4075996|32|NZ_LT904872|CRT matches to KJ019071 (Synechococcus phage ACG-2014g isolate Syn7803US105, complete genome) position: , mismatch: 7, identity: 0.781

attaaaaaagattaatgttggttatagtttta	CRISPR spacer
aattacaatggttaatgttggttatagtttag	Protospacer
* * * ** *.******************* .

2. spacer 1.3|4075996|32|NZ_LT904872|CRT matches to MN694480 (Marine virus AFVG_250M133, complete genome) position: , mismatch: 7, identity: 0.781

attaaaaaa----gattaatgttggttatagtttta	CRISPR spacer
----gaaaatttcgattaatgttagttgtagtttta	Protospacer
    .****    **********.***.********

3. spacer 1.3|4075996|32|NZ_LT904872|CRT matches to MN694671 (Marine virus AFVG_250M145, complete genome) position: , mismatch: 7, identity: 0.781

attaaaaaa----gattaatgttggttatagtttta	CRISPR spacer
----gaaaatttcgattaatgttagttgtagtttta	Protospacer
    .****    **********.***.********

4. spacer 1.3|4075996|32|NZ_LT904872|CRT matches to MN694753 (Marine virus AFVG_250M144, complete genome) position: , mismatch: 7, identity: 0.781

attaaaaaa----gattaatgttggttatagtttta	CRISPR spacer
----gaaaatttcgattaatgttagttgtagtttta	Protospacer
    .****    **********.***.********

5. spacer 1.3|4075996|32|NZ_LT904872|CRT matches to MN694231 (Marine virus AFVG_250M143, complete genome) position: , mismatch: 7, identity: 0.781

attaaaaaa----gattaatgttggttatagtttta	CRISPR spacer
----gaaaatttcgattaatgttagttgtagtttta	Protospacer
    .****    **********.***.********

6. spacer 1.3|4075996|32|NZ_LT904872|CRT matches to MN693981 (Marine virus AFVG_250M146, complete genome) position: , mismatch: 7, identity: 0.781

attaaaaaa----gattaatgttggttatagtttta	CRISPR spacer
----gaaaatttcgattaatgttagttgtagtttta	Protospacer
    .****    **********.***.********

7. spacer 1.3|4075996|32|NZ_LT904872|CRT matches to NZ_CP046723 (Pantoea agglomerans strain ASB05 plasmid pASB05p1, complete sequence) position: , mismatch: 8, identity: 0.75

attaaaaaagattaatgttggtta--tagtttta	CRISPR spacer
attaagaaagattaatgttgtttaatcaacgt--	Protospacer
*****.************** ***  .*.. *

8. spacer 1.3|4075996|32|NZ_LT904872|CRT matches to NZ_CP034470 (Pantoea agglomerans strain CFSAN047153 plasmid pCFSAN047153_1, complete sequence) position: , mismatch: 8, identity: 0.75

attaaaaaagattaatgttggtta--tagtttta	CRISPR spacer
attaagaaagattaatgttgtttaatcaacgt--	Protospacer
*****.************** ***  .*.. *

9. spacer 1.3|4075996|32|NZ_LT904872|CRT matches to NZ_CP034149 (Pantoea agglomerans strain L15 plasmid pPagL15_1, complete sequence) position: , mismatch: 8, identity: 0.75

attaaaaaagattaatgttggtta--tagtttta	CRISPR spacer
attaagaaagattaatgttgtttaatcaacgt--	Protospacer
*****.************** ***  .*.. *

10. spacer 1.3|4075996|32|NZ_LT904872|CRT matches to NZ_CP034475 (Pantoea agglomerans strain CFSAN047154 plasmid pCFSAN047154_1, complete sequence) position: , mismatch: 8, identity: 0.75

attaaaaaagattaatgttggtta--tagtttta	CRISPR spacer
attaagaaagattaatgttgtttaatcaacgt--	Protospacer
*****.************** ***  .*.. *

11. spacer 1.3|4075996|32|NZ_LT904872|CRT matches to MN694115 (Marine virus AFVG_250M901, complete genome) position: , mismatch: 8, identity: 0.75

attaaaaaagattaatgttggttatagtttta	CRISPR spacer
attaaaaaatattaatcttggttcttccgtaa	Protospacer
********* ****** ****** *  . * *

12. spacer 1.7|4075996|34|NZ_LT904872|PILER-CR,CRISPRCasFinder matches to NZ_CP046723 (Pantoea agglomerans strain ASB05 plasmid pASB05p1, complete sequence) position: , mismatch: 8, identity: 0.765

attaaaaaagattaatgttggttatagttttacg---	CRISPR spacer
attaagaaagattaatgttgttta---atcaacgtat	Protospacer
*****.************** ***    *. ***

13. spacer 1.7|4075996|34|NZ_LT904872|PILER-CR,CRISPRCasFinder matches to NZ_CP034470 (Pantoea agglomerans strain CFSAN047153 plasmid pCFSAN047153_1, complete sequence) position: , mismatch: 8, identity: 0.765

attaaaaaagattaatgttggttatagttttacg---	CRISPR spacer
attaagaaagattaatgttgttta---atcaacgtat	Protospacer
*****.************** ***    *. ***

14. spacer 1.7|4075996|34|NZ_LT904872|PILER-CR,CRISPRCasFinder matches to NZ_CP034149 (Pantoea agglomerans strain L15 plasmid pPagL15_1, complete sequence) position: , mismatch: 8, identity: 0.765

attaaaaaagattaatgttggttatagttttacg---	CRISPR spacer
attaagaaagattaatgttgttta---atcaacgtat	Protospacer
*****.************** ***    *. ***

15. spacer 1.7|4075996|34|NZ_LT904872|PILER-CR,CRISPRCasFinder matches to NZ_CP034475 (Pantoea agglomerans strain CFSAN047154 plasmid pCFSAN047154_1, complete sequence) position: , mismatch: 8, identity: 0.765

attaaaaaagattaatgttggttatagttttacg---	CRISPR spacer
attaagaaagattaatgttgttta---atcaacgtat	Protospacer
*****.************** ***    *. ***

16. spacer 1.3|4075996|32|NZ_LT904872|CRT matches to NZ_CP046630 (Streptococcus equinus strain CNU G6 plasmid p1_CNU_G6, complete sequence) position: , mismatch: 9, identity: 0.719

attaaaaaagattaatgttggttatagtttta	CRISPR spacer
aagaaaaatgattaatgttgtttataataact	Protospacer
*  ***** *********** *****.*  .

17. spacer 1.3|4075996|32|NZ_LT904872|CRT matches to NZ_CP046920 (Streptococcus sp. CNU G2 plasmid p_CNU_G2, complete sequence) position: , mismatch: 9, identity: 0.719

attaaaaaagattaatgttggttatagtttta	CRISPR spacer
aagaaaaatgattaatgttgtttataataact	Protospacer
*  ***** *********** *****.*  .

18. spacer 1.3|4075996|32|NZ_LT904872|CRT matches to MN694046 (Marine virus AFVG_250M906, complete genome) position: , mismatch: 9, identity: 0.719

attaaaaaa-----gattaatgttggttatagtttta	CRISPR spacer
-----gaagttttcgattaatgttagttgtagtttta	Protospacer
     .**.     **********.***.********

19. spacer 1.3|4075996|32|NZ_LT904872|CRT matches to MN693836 (Marine virus AFVG_250M487, complete genome) position: , mismatch: 9, identity: 0.719

attaaaaaa-----gattaatgttggttatagtttta	CRISPR spacer
-----gaagttttcgattaatgttagttgtagtttta	Protospacer
     .**.     **********.***.********

20. spacer 1.3|4075996|32|NZ_LT904872|CRT matches to MN693891 (Marine virus AFVG_250M480, complete genome) position: , mismatch: 9, identity: 0.719

attaaaaaa-----gattaatgttggttatagtttta	CRISPR spacer
-----gaagttttcgattaatgttagttgtagtttta	Protospacer
     .**.     **********.***.********

21. spacer 1.3|4075996|32|NZ_LT904872|CRT matches to MK268344 (Salmonella phage Munch, complete genome) position: , mismatch: 9, identity: 0.719

attaaaaaagattaatgttggttatagtttta	CRISPR spacer
ggcagcattgattaatgatggttttagtttta	Protospacer
. .*. *  ******** ***** ********

22. spacer 1.3|4075996|32|NZ_LT904872|CRT matches to MN694071 (Marine virus AFVG_250M483, complete genome) position: , mismatch: 9, identity: 0.719

attaaaaaa-----gattaatgttggttatagtttta	CRISPR spacer
-----gaagttttcgattaatgttagttgtagtttta	Protospacer
     .**.     **********.***.********

23. spacer 1.3|4075996|32|NZ_LT904872|CRT matches to MN694294 (Marine virus AFVG_250M486, complete genome) position: , mismatch: 9, identity: 0.719

attaaaaaa-----gattaatgttggttatagtttta	CRISPR spacer
-----gaagttttcgattaatgttagttgtagtttta	Protospacer
     .**.     **********.***.********

24. spacer 1.3|4075996|32|NZ_LT904872|CRT matches to MN693751 (Marine virus AFVG_250M485, complete genome) position: , mismatch: 9, identity: 0.719

attaaaaaa-----gattaatgttggttatagtttta	CRISPR spacer
-----gaagttttcgattaatgttagttgtagtttta	Protospacer
     .**.     **********.***.********

25. spacer 1.3|4075996|32|NZ_LT904872|CRT matches to MN694002 (Marine virus AFVG_250M481, complete genome) position: , mismatch: 9, identity: 0.719

attaaaaaa-----gattaatgttggttatagtttta	CRISPR spacer
-----gaagttttcgattaatgttagttgtagtttta	Protospacer
     .**.     **********.***.********

26. spacer 1.3|4075996|32|NZ_LT904872|CRT matches to MN694650 (Marine virus AFVG_250M482, complete genome) position: , mismatch: 9, identity: 0.719

attaaaaaa-----gattaatgttggttatagtttta	CRISPR spacer
-----gaagttttcgattaatgttagttgtagtttta	Protospacer
     .**.     **********.***.********

27. spacer 1.3|4075996|32|NZ_LT904872|CRT matches to MN693906 (Marine virus AFVG_250M905, complete genome) position: , mismatch: 9, identity: 0.719

attaaaaaa-----gattaatgttggttatagtttta	CRISPR spacer
-----gaagttttcgattaatgttagttgtagtttta	Protospacer
     .**.     **********.***.********

28. spacer 1.3|4075996|32|NZ_LT904872|CRT matches to MN694711 (Marine virus AFVG_250M484, complete genome) position: , mismatch: 9, identity: 0.719

attaaaaaa-----gattaatgttggttatagtttta	CRISPR spacer
-----gaagttttcgattaatgttagttgtagtttta	Protospacer
     .**.     **********.***.********

29. spacer 1.4|4076057|32|NZ_LT904872|CRT matches to KR052482 (Sinorhizobium phage phiN3, complete genome) position: , mismatch: 9, identity: 0.719

taaaacaccggttgcgcaacctccgcggggat	CRISPR spacer
aacaacaccggttgcgaaacctacgcaaaaaa	Protospacer
 * ************* ***** ***....*

30. spacer 1.7|4075996|34|NZ_LT904872|PILER-CR,CRISPRCasFinder matches to KJ019071 (Synechococcus phage ACG-2014g isolate Syn7803US105, complete genome) position: , mismatch: 9, identity: 0.735

attaaaaaagattaatgttggttatagttttacg	CRISPR spacer
aattacaatggttaatgttggttatagtttagga	Protospacer
* * * ** *.******************* . .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

74 : 61838

Salmonella_phage(58.33%)

tail,protease,transposase,tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000905046.1\|74_641_+	recombinase family protein	A0A0F7LA37	Escherichia_phage	1.1e-86	86.3
WP_000046142.1\|783_1956_+\|tail	phage tail sheath protein	A0A1S6KZY7	Salmonella_phage	3.5e-204	90.3
WP_001207656.1\|1965_2481_+\|tail	phage major tail tube protein	A0A1S6L002	Salmonella_phage	5.6e-90	95.9
WP_001280897.1\|2535_2838_+\|tail	phage tail assembly protein	A0A1S6KZZ9	Salmonella_phage	7.0e-40	89.0
WP_000763311.1\|2852_2972_+\|tail	GpE family phage tail protein	E5G6Q0	Salmonella_phage	2.8e-13	87.2
WP_001282796.1\|2964_6042_+\|tail	phage tail tape measure protein	E5G6Q1	Salmonella_phage	0.0e+00	63.1
WP_000980381.1\|6038_6524_+\|tail	phage tail protein	E5G6Q2	Salmonella_phage	2.4e-66	80.0
WP_001011760.1\|6520_7621_+	phage late control D family protein	A0A1S6KZZ5	Salmonella_phage	1.0e-176	88.3
WP_000972391.1\|7711_7930_+	ogr/Delta-like zinc finger family protein	Q53ZE7	Salmonella_virus	7.5e-20	69.0
WP_000502114.1\|9511_9970_+\|transposase	IS200/IS605 family transposase	NA	NA	NA	NA
WP_000840996.1\|10077_10416_-	macrodomain Ori organization protein MaoP	NA	NA	NA	NA
WP_001541181.1\|10522_11371_+	HTH-type transcriptional regulator HdfR	NA	NA	NA	NA
WP_000201804.1\|17350_18202_-	glutamate racemase	NA	NA	NA	NA
WP_000591414.1\|18146_19991_-	TonB-dependent vitamin B12 receptor BtuB	A0A0P0I887	Acinetobacter_phage	2.2e-11	30.0
WP_000186987.1\|20364_21465_+\|tRNA	tRNA (uridine(54)-C5)-methyltransferase TrmA	NA	NA	NA	NA
WP_000813838.1\|21511_21871_-	YijD family membrane protein	NA	NA	NA	NA
WP_000971958.1\|21886_22522_-	HTH-type transcriptional repressor FabR	NA	NA	NA	NA
WP_001120789.1\|22720_24121_+	Si-specific NAD(P)(+) transhydrogenase	NA	NA	NA	NA
WP_001025919.1\|24103_25021_-	DNA-binding transcriptional regulator OxyR	NA	NA	NA	NA
WP_094516705.1\|25304_26672_-	argininosuccinate lyase	NA	NA	NA	NA
WP_001575262.1\|26797_27574_-	acetylglutamate kinase	NA	NA	NA	NA
WP_000935332.1\|27581_28586_-	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
WP_000800208.1\|28674_29826_+	acetylornithine deacetylase	NA	NA	NA	NA
WP_001192092.1\|33046_34780_+	phosphoethanolamine transferase CptA	NA	NA	NA	NA
WP_000424865.1\|36030_36693_+	fructose-6-phosphate aldolase	M4SLG0	Cyanophage	1.2e-28	34.1
WP_000374033.1\|36704_37808_+	glycerol dehydrogenase	NA	NA	NA	NA
WP_000108110.1\|37914_40095_-	catalase/peroxidase HPI	NA	NA	NA	NA
WP_000007507.1\|40259_41150_-	methylenetetrahydrofolate reductase	NA	NA	NA	NA
WP_001090459.1\|41428_42910_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_000976816.1\|42854_43961_-	alanine racemase	NA	NA	NA	NA
WP_000609328.1\|43957_45196_-	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	5.9e-101	53.4
WP_000865256.1\|45459_47016_-	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_001134817.1\|47151_48276_+	hypothetical protein	NA	NA	NA	NA
WP_000110811.1\|49002_51435_-	bifunctional aspartate kinase/homoserine dehydrogenase II	NA	NA	NA	NA
WP_000197208.1\|51437_52598_-	cystathionine gamma-synthase	NA	NA	NA	NA
WP_000852811.1\|52862_53180_+	met regulon transcriptional regulator MetJ	NA	NA	NA	NA
WP_000792797.1\|55624_56287_+	TIGR02117 family protein	NA	NA	NA	NA
WP_000715284.1\|56332_56545_-	50S ribosomal protein L31	NA	NA	NA	NA
WP_000109394.1\|56748_58947_+	primosomal protein N'	NA	NA	NA	NA
WP_000841337.1\|59101_60127_+	DNA-binding transcriptional regulator CytR	NA	NA	NA	NA
WP_000068796.1\|60220_61216_+	cell division protein FtsN	NA	NA	NA	NA
WP_000208240.1\|61307_61838_+\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA

DBSCAN-SWA_2

851210 : 942598

Salmonella_phage(78.0%)

terminase,capsid,tail,head,lysis,transposase,portal,plate,integrase

attL 854359:854418|attR 942611:943926

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000089603.1\|851210_852362_+\|integrase	site-specific integrase	B5WZU7	Pseudomonas_phage	6.3e-49	44.8
WP_000455463.1\|852458_852926_+	hypothetical protein	NA	NA	NA	NA
WP_000994659.1\|853137_854013_+	hypothetical protein	NA	NA	NA	NA
854359:854418	attL	NA	NA	NA	NA
WP_000343717.1\|854430_855639_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.7e-47	45.2
WP_000214158.1\|855842_856757_+	hypothetical protein	NA	NA	NA	NA
WP_001768408.1\|856775_857516_+	TIGR03759 family integrating conjugative element protein	NA	NA	NA	NA
WP_000013624.1\|857494_858181_+	lytic transglycosylase domain-containing protein	NA	NA	NA	NA
WP_000253629.1\|858216_858717_+	integrating conjugative element protein	NA	NA	NA	NA
WP_000626967.1\|858726_859296_+	restriction endonuclease	NA	NA	NA	NA
WP_000071290.1\|859315_861406_+	type IV conjugative transfer system coupling protein TraD	NA	NA	NA	NA
WP_010989289.1\|861402_862161_+	TIGR03747 family integrating conjugative element membrane protein	NA	NA	NA	NA
WP_000252871.1\|862397_862652_+	hypothetical protein	NA	NA	NA	NA
WP_001251281.1\|862651_862891_+	TIGR03758 family integrating conjugative element protein	NA	NA	NA	NA
WP_000949576.1\|862920_863283_+	TIGR03745 family integrating conjugative element membrane protein	NA	NA	NA	NA
WP_000848326.1\|863292_863667_+	TIGR03750 family conjugal transfer protein	NA	NA	NA	NA
WP_000086082.1\|863663_864317_+	TIGR03746 family integrating conjugative element protein	NA	NA	NA	NA
WP_001240640.1\|864316_865216_+	TIGR03749 family integrating conjugative element protein	NA	NA	NA	NA
WP_001165842.1\|865205_866684_+	TIGR03752 family integrating conjugative element protein	NA	NA	NA	NA
WP_000244536.1\|866670_867120_+	TIGR03751 family conjugal transfer lipoprotein	NA	NA	NA	NA
WP_000054770.1\|870110_870497_+	hypothetical protein	NA	NA	NA	NA
WP_000821941.1\|870651_871044_+	TIGR03757 family integrating conjugative element protein	NA	NA	NA	NA
WP_000838927.1\|871040_872009_+	TIGR03756 family integrating conjugative element protein	NA	NA	NA	NA
WP_010989292.1\|872023_873454_+	integrating conjugative element protein	NA	NA	NA	NA
WP_000213770.1\|873786_875292_+	conjugal transfer protein TraG N-terminal domain-containing protein	NA	NA	NA	NA
WP_000993574.1\|875327_875717_-	hypothetical protein	NA	NA	NA	NA
WP_000623988.1\|875940_876183_-	hypothetical protein	NA	NA	NA	NA
WP_001283066.1\|876587_877835_+	phosphoadenosine phosphosulfate reductase	A0A068F1U8	Mycobacterium_phage	6.0e-61	33.1
WP_000502502.1\|877819_878461_+	ParB N-terminal domain-containing protein	A0A0F7L444	uncultured_marine_virus	1.1e-55	53.7
WP_010989295.1\|878671_879214_-	DUF1062 domain-containing protein	NA	NA	NA	NA
WP_000907593.1\|880479_881400_+\|integrase	integrase domain-containing protein	NA	NA	NA	NA
WP_000343717.1\|881600_882809_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.7e-47	45.2
WP_001222413.1\|882928_883198_-	hypothetical protein	NA	NA	NA	NA
WP_000457555.1\|883329_884604_-	Y-family DNA polymerase	F1C5A5	Cronobacter_phage	7.5e-152	62.0
WP_001039750.1\|884823_885201_+	hypothetical protein	NA	NA	NA	NA
WP_001775272.1\|885287_885506_-	ogr/Delta-like zinc finger family protein	E5G6Q4	Salmonella_phage	4.9e-27	75.0
WP_001011750.1\|885573_886674_-	phage late control D family protein	E5G6Q3	Salmonella_phage	7.9e-190	92.1
WP_000980405.1\|886670_887156_-\|tail	phage tail protein	E5G6Q2	Salmonella_phage	9.4e-71	93.2
WP_161976233.1\|887155_889702_-\|tail	phage tail tape measure protein	A0A2H4JGB2	uncultured_Caudovirales_phage	1.2e-113	42.7
WP_000763315.1\|889928_890048_-\|tail	GpE family phage tail protein	E5G6Q0	Salmonella_phage	1.2e-14	94.9
WP_001280965.1\|890062_890365_-\|tail	phage tail assembly protein	E5G6P9	Salmonella_phage	3.3e-42	93.9
WP_001207653.1\|890419_890935_-\|tail	phage major tail tube protein	E5G6P8	Salmonella_phage	2.7e-92	99.4
WP_000046101.1\|890944_892117_-\|tail	phage tail sheath protein	A0A1S6KZY7	Salmonella_phage	9.8e-223	99.5
WP_000388790.1\|892219_892438_-	Hin recombinase	A0A1S6L009	Salmonella_phage	1.4e-29	90.3
WP_000161708.1\|892651_893374_+	SPI-1 type III secretion system guanine nucleotide exchange factor SopE	NA	NA	NA	NA
WP_000006337.1\|893571_893979_-\|tail	tail fiber assembly protein	A0A1B0V844	Salmonella_phage	4.1e-59	84.2
WP_000104806.1\|893985_895605_-\|tail	phage tail protein	E5G6P0	Salmonella_phage	2.7e-154	90.9
WP_001086816.1\|895601_896207_-\|tail	phage tail protein I	A0A1S6L000	Salmonella_phage	2.0e-110	92.0
WP_000268327.1\|896199_897108_-\|plate	baseplate assembly protein	E5G6N8	Salmonella_phage	5.2e-155	97.0
WP_000177408.1\|897094_897454_-	GPW/gp25 family protein	A0A1S6KZZ4	Salmonella_phage	6.8e-58	96.6
WP_000993749.1\|897450_898029_-\|plate	phage baseplate assembly protein V	E5G6N6	Salmonella_phage	3.9e-108	99.5
WP_000343944.1\|898097_898544_-	phage virion morphogenesis protein	A0A1S6L001	Salmonella_phage	2.2e-66	90.4
WP_001039961.1\|898536_898968_-\|tail	phage tail protein	A0A1S6KZY0	Salmonella_phage	1.1e-75	99.3
WP_024131238.1\|899063_899492_-\|lysis	LysB family phage lysis regulatory protein	A0A1S6KZX8	Salmonella_phage	3.3e-67	97.9
WP_001097942.1\|899870_900380_-	lysozyme	A0A1S6KZY9	Salmonella_phage	1.3e-91	97.0
WP_000171566.1\|900360_900576_-	hypothetical protein	E5G6N0	Salmonella_phage	3.8e-32	98.6
WP_000868184.1\|900579_900783_-\|tail	tail protein X	E5G6M9	Salmonella_phage	3.8e-34	100.0
WP_000673540.1\|900782_901247_-\|head	head completion/stabilization protein	A0A1S6KZW8	Salmonella_phage	2.4e-84	98.1
WP_000059175.1\|901340_901991_-\|terminase	terminase endonuclease subunit	E5G6M7	Salmonella_phage	2.4e-114	99.5
WP_057484674.1\|901994_903059_-\|capsid	phage major capsid protein, P2 family	A0A1S6KZZ3	Salmonella_phage	4.3e-193	98.0
WP_000216272.1\|903075_903909_-\|capsid	GPO family capsid scaffolding protein	E5G6M5	Salmonella_phage	6.1e-126	87.4
WP_057484673.1\|904051_905818_+\|terminase	terminase ATPase subunit family protein	A0A1S6KZW3	Salmonella_phage	0.0e+00	96.3
WP_001681813.1\|905817_906861_+\|portal	phage portal protein	A0A1S6KZW5	Salmonella_phage	2.1e-176	86.6
WP_000080839.1\|906909_907605_-	hypothetical protein	NA	NA	NA	NA
WP_000789323.1\|907624_908689_-	hypothetical protein	NA	NA	NA	NA
WP_000829584.1\|908685_909750_-	hypothetical protein	NA	NA	NA	NA
WP_000835188.1\|909759_909978_-	hypothetical protein	NA	NA	NA	NA
WP_001217561.1\|910073_910307_-	DinI family protein	A0A1S6L014	Salmonella_phage	2.2e-33	92.2
WP_001154438.1\|910318_910507_-	hypothetical protein	A0A1S6L006	Salmonella_phage	7.9e-26	96.8
WP_000301193.1\|910674_913083_-	replication endonuclease	A0A1S6L028	Salmonella_phage	0.0e+00	95.1
WP_000104130.1\|913073_913934_-	DNA adenine methylase	E5G6L8	Salmonella_phage	3.4e-132	81.8
WP_001090717.1\|913930_914515_-	3'-5' exonuclease	A0A1S6L012	Salmonella_phage	1.1e-76	73.7
WP_000785510.1\|914511_914739_-	TraR/DksA family transcriptional regulator	A0A1S6L007	Salmonella_phage	1.0e-35	94.7
WP_001244240.1\|914738_914972_-	DUF2732 domain-containing protein	A0A1S6L021	Salmonella_phage	9.8e-26	84.4
WP_000963479.1\|915039_915381_-	DUF5347 domain-containing protein	A0A1S6L019	Salmonella_phage	4.6e-56	99.1
WP_000956167.1\|915344_915545_-	DUF2724 domain-containing protein	A0A1S6L005	Salmonella_phage	4.6e-32	97.0
WP_000460852.1\|915552_916062_-	phage regulatory CII family protein	A0A1S6L008	Salmonella_phage	1.3e-83	94.1
WP_000102106.1\|916094_916337_-	Rha family transcriptional regulator	A0A1S6KZZ6	Salmonella_phage	2.3e-38	98.8
WP_000052560.1\|916453_917086_+	helix-turn-helix domain-containing protein	A0A1S6KZZ7	Salmonella_phage	1.4e-66	58.6
WP_000027757.1\|917089_918115_+\|integrase	site-specific integrase	A0A1S6L016	Salmonella_phage	2.7e-200	98.2
WP_001681810.1\|919221_919479_+	YjhX family toxin	NA	NA	NA	NA
WP_001681808.1\|919489_920380_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_000354257.1\|920379_921126_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_000052242.1\|921427_923398_-	Vi polysaccharide transport protein VexE	NA	NA	NA	NA
WP_000431675.1\|923417_924722_-	Vi polysaccharide ABC transporter inner membrane protein VexD	NA	NA	NA	NA
WP_000467404.1\|924744_925440_-	Vi polysaccharide ABC transporter ATP-binding protein VexC	NA	NA	NA	NA
WP_001023498.1\|925465_926260_-	Vi polysaccharide ABC transporter inner membrane protein VexB	NA	NA	NA	NA
WP_000720235.1\|926269_927337_-	Vi polysaccharide ABC transporter protein VexA	NA	NA	NA	NA
WP_057484672.1\|927381_929118_-	Vi polysaccharide biosynthesis glycosyltransferase TviE	NA	NA	NA	NA
WP_010989299.1\|929117_931613_-	Vi polysaccharide biosynthesis protein TviD	NA	NA	NA	NA
WP_000127915.1\|931636_932683_-	Vi polysaccharide biosynthesis UDP-N-acetylglucosaminuronic acid C-4 epimerase TviC	A0A2K9L0I7	Tupanvirus	1.4e-74	45.0
WP_000466893.1\|932685_933963_-	Vi polysaccharide biosynthesis UDP-N-acetylglucosamine C-6 dehydrogenase TviB	M1HYW7	Paramecium_bursaria_Chlorella_virus	1.3e-21	26.7
WP_001210944.1\|934207_934747_-	Vi polysaccharide biosynthesis regulator TviA	NA	NA	NA	NA
WP_001120833.1\|935600_937112_+	ATP-dependent helicase	A0A126DN25	Acinetobacter_phage	2.0e-42	29.0
WP_000488995.1\|937095_938685_+	TraI domain-containing protein	NA	NA	NA	NA
WP_000449622.1\|938848_939862_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_001143724.1\|940288_940582_+	DUF1778 domain-containing protein	NA	NA	NA	NA
WP_000622308.1\|940578_941067_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000343717.1\|941389_942598_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.7e-47	45.2
942611:943926	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1092445 : 1105106

Enterobacteria_phage(55.56%)

integrase

attL 1082980:1082993|attR 1096111:1096124

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1082980:1082993	attL	NA	NA	NA	NA
WP_000152561.1\|1092445_1093936_-	alcohol dehydrogenase catalytic domain-containing protein	A0A0G2Y405	Acanthamoeba_polyphaga_mimivirus	4.0e-11	36.1
WP_000772672.1\|1094406_1095672_+\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	1.6e-74	41.0
WP_000573583.1\|1095734_1096811_-	serine/threonine protein kinase	A0A2H4UU60	Bodo_saltans_virus	7.8e-17	28.2
1096111:1096124	attR	NA	NA	NA	NA
WP_000700163.1\|1096807_1097866_-	serine/threonine protein kinase	G9BWE0	Planktothrix_phage	4.9e-56	44.7
WP_000493739.1\|1097855_1099019_-	hypothetical protein	NA	NA	NA	NA
WP_000214423.1\|1099294_1099861_-	Polarity suppression protein	Q7M2A1	Enterobacteria_phage	1.8e-60	64.9
WP_000468230.1\|1099876_1100116_-	ogr/Delta-like zinc finger family protein	Q7M294	Enterobacteria_phage	3.7e-20	60.5
WP_001779443.1\|1100119_1100863_-	hypothetical protein	NA	NA	NA	NA
WP_000556588.1\|1101402_1101669_+	AlpA family transcriptional regulator	Q7M299	Enterobacteria_phage	5.8e-30	70.5
WP_015701354.1\|1101665_1102217_+	host cell division inhibitor Icd-like protein	Q7M2A7	Enterobacteria_phage	1.1e-30	70.4
WP_001216603.1\|1102213_1102441_+	hypothetical protein	NA	NA	NA	NA
WP_000795388.1\|1102437_1102758_+	DUF5375 domain-containing protein	NA	NA	NA	NA
WP_000783716.1\|1102772_1105106_+	toprim domain-containing protein	Q7M2A8	Enterobacteria_phage	0.0e+00	86.5

DBSCAN-SWA_4

1461073 : 1526002

uncultured_Mediterranean_phage(11.11%)

protease,transposase,tRNA,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000753959.1\|1461073_1462501_+\|protease	serine endoprotease DegP	A0A1B1IT49	uncultured_Mediterranean_phage	2.1e-25	28.8
WP_000929456.1\|1462653_1463811_+	DNA-binding transcriptional regulator CdaR	NA	NA	NA	NA
WP_000272193.1\|1463899_1464286_-	DUF3461 family protein	NA	NA	NA	NA
WP_001186669.1\|1465871_1466696_-	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
WP_001094518.1\|1466725_1469398_-	bifunctional uridylyltransferase/uridylyl-removing protein GlnD	NA	NA	NA	NA
WP_001018214.1\|1469510_1470305_-	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_000246886.1\|1470754_1471480_+	30S ribosomal protein S2	NA	NA	NA	NA
WP_000808106.1\|1471737_1472589_+	elongation factor Ts	NA	NA	NA	NA
WP_000224567.1\|1472733_1473459_+	UMP kinase	NA	NA	NA	NA
WP_000622423.1\|1473605_1474163_+	ribosome recycling factor	NA	NA	NA	NA
WP_000811892.1\|1474304_1475501_+	1-deoxy-D-xylulose-5-phosphate reductoisomerase	NA	NA	NA	NA
WP_000947409.1\|1475813_1476572_+	(2E,6E)-farnesyl-diphosphate-specific ditrans,polycis-undecaprenyl-diphosphate synthase	R9W0U9	Flavobacterium_phage	2.5e-25	42.2
WP_000922422.1\|1476584_1477442_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_000949016.1\|1477453_1478806_+\|protease	sigma E protease regulator RseP	NA	NA	NA	NA
WP_001240921.1\|1478837_1481249_+	outer membrane protein assembly factor BamA	NA	NA	NA	NA
WP_000758966.1\|1481371_1481857_+	molecular chaperone Skp	NA	NA	NA	NA
WP_001139265.1\|1481860_1482886_+	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
WP_000210741.1\|1482991_1483447_+	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_000566033.1\|1483450_1484239_+	acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase	NA	NA	NA	NA
WP_000741216.1\|1484238_1485387_+	lipid-A-disaccharide synthase	NA	NA	NA	NA
WP_000569412.1\|1485383_1485980_+	ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	1.5e-25	39.3
WP_001294828.1\|1486003_1489486_+	DNA polymerase III subunit alpha	Q8W6C3	Saccharomonospora_phage	4.8e-209	36.9
WP_000055753.1\|1489498_1490458_+	acetyl-CoA carboxylase carboxyl transferase subunit alpha	NA	NA	NA	NA
WP_000502118.1\|1490649_1491108_+\|transposase	IS200/IS605-like element IS200F family transposase	NA	NA	NA	NA
WP_001021059.1\|1493186_1495328_+	lysine decarboxylase LdcC	NA	NA	NA	NA
WP_000901086.1\|1495383_1495773_+	VOC family protein	NA	NA	NA	NA
WP_000210062.1\|1495835_1497128_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_000062330.1\|1497211_1497472_-	Rho-binding antiterminator	NA	NA	NA	NA
WP_001518678.1\|1497458_1497659_-	YaeP family protein	NA	NA	NA	NA
WP_001185319.1\|1497856_1498402_+	YaeQ family protein	NA	NA	NA	NA
WP_000560526.1\|1498398_1498821_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_000252574.1\|1498852_1499554_+	envelope stress response activation lipoprotein NlpE	NA	NA	NA	NA
WP_000502118.1\|1499661_1500120_-\|transposase	IS200/IS605-like element IS200F family transposase	NA	NA	NA	NA
WP_001260683.1\|1500338_1502057_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_000093978.1\|1502167_1502875_-\|tRNA	tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO	NA	NA	NA	NA
WP_001202315.1\|1502871_1503276_-	Rcs stress response system protein RcsF	NA	NA	NA	NA
WP_000874217.1\|1503394_1504210_-	methionine ABC transporter substrate-binding lipoprotein MetQ	NA	NA	NA	NA
WP_001287483.1\|1504248_1504902_-	methionine ABC transporter permease MetI	NA	NA	NA	NA
WP_000594016.1\|1504894_1505926_-	methionine ABC transporter ATP-binding protein MetN	G9BWD6	Planktothrix_phage	1.2e-35	40.2
WP_001140158.1\|1506115_1506682_+	D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase	NA	NA	NA	NA
WP_000154870.1\|1512467_1513271_+	2,5-didehydrogluconate reductase DkgB	A0A1V0SDE7	Indivirus	2.7e-38	35.4
WP_000648539.1\|1513291_1514206_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_001127546.1\|1514310_1515486_+	MFS transporter	NA	NA	NA	NA
WP_001230964.1\|1515617_1516418_+	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_000207227.1\|1516495_1517266_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_000644706.1\|1517321_1518689_-	murein transglycosylase D	A0A0A7NU10	Lactobacillus_phage	1.4e-10	33.0
WP_001052766.1\|1518760_1519516_-	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
WP_000801233.1\|1519550_1520273_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_000917872.1\|1520269_1520737_-	ribonuclease HI	J9Q745	Salmonella_phage	4.7e-51	58.9
WP_001670675.1\|1520800_1521532_+	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	6.4e-39	39.9
WP_000145233.1\|1523126_1524122_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_000371495.1\|1524118_1526002_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA

DBSCAN-SWA_5

2151174 : 2158486

Dickeya_phage(16.67%)

protease,integrase

attL 2152425:2152439|attR 2163791:2163805

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001201759.1\|2151174_2152293_+	macrolide transporter subunit MacA	A0A140XAI1	Dickeya_phage	8.1e-09	39.8
WP_000125880.1\|2152289_2154236_+	macrolide ABC transporter ATP-binding protein/permease MacB	G9BWD6	Planktothrix_phage	2.0e-39	43.1
2152425:2152439	attL	NA	NA	NA	NA
WP_000447499.1\|2154365_2154587_-	cold shock-like protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	9.3e-18	64.2
WP_000520789.1\|2154910_2155231_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	4.5e-13	45.7
WP_000934058.1\|2155261_2157538_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.8e-164	42.2
WP_001117984.1\|2157749_2157947_-	hypothetical protein	NA	NA	NA	NA
WP_001539594.1\|2158108_2158486_-\|integrase	integrase	A0A077KET4	Ralstonia_phage	1.2e-20	41.0
2163791:2163805	attR	NA	NA	NA	NA

DBSCAN-SWA_6

2229798 : 2310093

Salmonella_phage(68.85%)

terminase,tail,protease,head,transposase,plate,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001262313.1\|2229798_2231091_-	DUF3596 domain-containing protein	S4TSP2	Salmonella_phage	5.0e-252	99.8
WP_000065276.1\|2231135_2231384_-	excisionase family protein	S4TND0	Salmonella_phage	4.7e-42	100.0
WP_001754984.1\|2231424_2231664_-	DUF4060 family protein	S4TR31	Salmonella_phage	9.7e-37	96.2
WP_010989138.1\|2231669_2232551_-	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A0M4R347	Salmonella_phage	1.2e-153	93.0
WP_000034527.1\|2232547_2233612_-	DGQHR domain-containing protein	T1SBJ4	Salmonella_phage	6.3e-152	74.6
WP_000187053.1\|2233689_2234370_-	YqaJ viral recombinase family protein	A0A0M3ULE0	Salmonella_phage	1.9e-130	98.7
WP_001764962.1\|2234366_2235152_-	phage recombination protein Bet	A0A0M4RD39	Salmonella_phage	9.7e-150	99.6
WP_000995349.1\|2235157_2235454_-	host-nuclease inhibitor protein Gam	A0A0M5M5Z9	Salmonella_phage	4.4e-47	96.9
WP_000186242.1\|2235544_2235745_-	cell division protein FtsZ	G8C7T2	Escherichia_phage	2.4e-12	48.4
WP_001009036.1\|2236033_2236438_-	transcriptional regulator	H6WRX4	Salmonella_phage	7.1e-72	99.3
WP_000869365.1\|2236567_2236804_+	helix-turn-helix domain-containing protein	H6WRX5	Salmonella_phage	1.1e-37	98.7
WP_001574095.1\|2236769_2237144_+	hypothetical protein	S4TTD7	Salmonella_phage	3.9e-64	99.2
WP_001681803.1\|2237228_2238212_+	replication protein	H6WRX7	Salmonella_phage	2.1e-162	99.7
WP_000800010.1\|2238214_2238964_+	ATP-binding protein	S4TNF5	Salmonella_phage	3.6e-138	99.6
WP_000113623.1\|2238974_2239322_+	DUF977 family protein	H6WRX9	Salmonella_phage	4.8e-53	90.4
WP_000065105.1\|2239318_2239843_+	ead/Ea22-like family protein	A0A220NQV2	Salmonella_phage	1.8e-91	99.4
WP_000445792.1\|2239842_2240316_+	class I SAM-dependent methyltransferase	H9C170	Pectobacterium_phage	1.6e-67	80.1
WP_000208074.1\|2240319_2240892_+	DUF550 domain-containing protein	S4TSR6	Salmonella_phage	1.3e-66	68.0
WP_000509711.1\|2241737_2241917_+	hypothetical protein	NA	NA	NA	NA
WP_000963896.1\|2241927_2242425_+	type II toxin-antitoxin system death-on-curing family toxin	NA	NA	NA	NA
WP_001217670.1\|2242609_2242849_+	DinI family protein	H6WRY5	Salmonella_phage	3.9e-38	100.0
WP_000929790.1\|2243183_2243786_+	DUF1367 family protein	S4TTI0	Salmonella_phage	7.5e-110	99.5
WP_001096560.1\|2243994_2244606_+	recombination protein NinG	A0A0M4RU10	Salmonella_phage	2.5e-92	99.5
WP_001617856.1\|2244602_2244749_+	YlcG family protein	A0A0M5M7B2	Salmonella_phage	4.3e-19	97.9
WP_001047634.1\|2244738_2245536_+	antitermination protein	A0A0M4S661	Salmonella_phage	3.4e-150	99.2
WP_000343717.1\|2245847_2247056_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.7e-47	45.2
WP_001534733.1\|2247257_2247383_+	hypothetical protein	NA	NA	NA	NA
WP_000798706.1\|2247518_2247968_-	lipoprotein	NA	NA	NA	NA
WP_001294876.1\|2248184_2248574_+\|holin	phage holin family protein	K7PHB9	Enterobacterial_phage	3.1e-40	70.2
WP_000226307.1\|2248560_2248842_+\|holin	phage holin family protein	K7PKN9	Enterobacterial_phage	2.6e-36	80.6
WP_001075998.1\|2248841_2249456_+	glycoside hydrolase family 19 protein	Q8HA86	Salmonella_phage	3.2e-108	93.1
WP_001050879.1\|2249452_2249992_+	DUF2514 domain-containing protein	A0A291LBG9	Klebsiella_phage	2.5e-08	38.4
WP_000495544.1\|2250034_2250412_+	hypothetical protein	Q6UAR9	Klebsiella_phage	4.9e-43	68.5
WP_001070544.1\|2250508_2250736_+	hypothetical protein	NA	NA	NA	NA
WP_001118118.1\|2250825_2251578_+	hypothetical protein	A0A0M3ULJ9	Salmonella_phage	3.4e-11	56.5
WP_000204794.1\|2251543_2252947_+\|terminase	PBSX family phage terminase large subunit	A0A077KAW0	Edwardsiella_phage	6.5e-189	70.1
WP_000113511.1\|2252946_2254416_+	DUF1073 domain-containing protein	A0A0M4S6U1	Salmonella_phage	1.7e-280	99.2
WP_138010671.1\|2254300_2255038_+\|head	phage head morphogenesis protein	A0A0M4REK0	Salmonella_phage	7.8e-101	88.1
WP_057484671.1\|2255052_2256285_+	DUF2213 domain-containing protein	A0A0M4R5A6	Salmonella_phage	5.3e-227	98.8
WP_000128060.1\|2256289_2256787_+	hypothetical protein	A0A0M4QWZ6	Salmonella_phage	8.7e-88	99.4
WP_000627464.1\|2256798_2257740_+	DUF2184 domain-containing protein	A0A0M3ULD3	Salmonella_phage	3.1e-179	100.0
WP_001040702.1\|2257781_2258150_+	hypothetical protein	A0A0M4RTX5	Salmonella_phage	8.7e-61	100.0
WP_001125675.1\|2258115_2258523_+	DUF4054 domain-containing protein	A0A0M5M3S2	Salmonella_phage	7.1e-72	97.8
WP_000008737.1\|2258519_2259074_+	hypothetical protein	A0A0M4S631	Salmonella_phage	4.8e-95	100.0
WP_001142488.1\|2259060_2259450_+	hypothetical protein	A0A0M3ULK0	Salmonella_phage	6.0e-68	98.4
WP_000389379.1\|2259424_2259988_+	hypothetical protein	A0A0M4R331	Salmonella_phage	8.9e-81	75.3
WP_001135544.1\|2259991_2261137_+	DUF3383 domain-containing protein	A0A2H4J8G4	uncultured_Caudovirales_phage	2.2e-163	74.5
WP_000257259.1\|2261148_2261589_+	DUF3277 family protein	A0A2H4J619	uncultured_Caudovirales_phage	3.5e-56	74.7
WP_000389047.1\|2261592_2262045_+	hypothetical protein	A0A0M4S6U8	Salmonella_phage	1.9e-57	76.6
WP_000990867.1\|2262222_2264175_+	hypothetical protein	A0A0M4REK7	Salmonella_phage	1.8e-181	56.0
WP_000346974.1\|2264174_2264825_+	hypothetical protein	A0A0M3ULD5	Salmonella_phage	3.0e-56	60.6
WP_000388505.1\|2264828_2265131_+	hypothetical protein	A0A2H4J495	uncultured_Caudovirales_phage	2.0e-26	57.0
WP_000042301.1\|2265133_2266165_+	hypothetical protein	A0A2H4J1B2	uncultured_Caudovirales_phage	1.2e-96	51.4
WP_000826019.1\|2266161_2266497_+	hypothetical protein	A0A2H4J1A5	uncultured_Caudovirales_phage	1.1e-20	52.2
WP_000050472.1\|2266691_2267423_+	hypothetical protein	NA	NA	NA	NA
WP_001144794.1\|2267422_2267851_+	hypothetical protein	NA	NA	NA	NA
WP_001685627.1\|2267909_2268665_+	hypothetical protein	A0A0M5M1K7	Salmonella_phage	4.1e-105	85.3
WP_001270647.1\|2268905_2269259_+	hypothetical protein	A0A0M4R339	Salmonella_phage	3.2e-60	98.3
WP_001197092.1\|2269259_2270459_+\|plate	baseplate J/gp47 family protein	A0A0M4RD32	Salmonella_phage	8.5e-214	97.5
WP_000049938.1\|2270455_2271136_+	DUF2612 domain-containing protein	A0A0M5M1K4	Salmonella_phage	6.9e-128	98.7
WP_001681975.1\|2271135_2272647_+	hypothetical protein	S4TP62	Salmonella_phage	1.5e-111	59.4
WP_000421106.1\|2272661_2273180_+\|tail	tail fiber assembly protein	A0A1B0VCD0	Salmonella_phage	1.7e-46	62.8
WP_000480169.1\|2274101_2274803_-	DUF1076 domain-containing protein	NA	NA	NA	NA
WP_000193884.1\|2275819_2278432_+	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	1.1e-19	22.6
WP_000291724.1\|2278639_2279650_+	quinone-dependent dihydroorotate dehydrogenase	NA	NA	NA	NA
WP_001220671.1\|2279815_2280358_+	cell division protein ZapC	NA	NA	NA	NA
WP_000224084.1\|2280354_2281464_-	MOSC domain-containing protein	NA	NA	NA	NA
WP_001086472.1\|2281562_2283671_+	bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL	W6LLI2	Streptococcus_phage	5.1e-20	29.6
WP_000053045.1\|2283683_2285591_+	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	2.4e-53	29.8
WP_000333152.1\|2285605_2286859_+	membrane integrity-associated transporter subunit PqiA	NA	NA	NA	NA
WP_000433416.1\|2286863_2288504_+	intermembrane transport protein PqiB	NA	NA	NA	NA
WP_000759136.1\|2288500_2289064_+	membrane integrity-associated transporter subunit PqiC	NA	NA	NA	NA
WP_001764860.1\|2289317_2289485_+	ribosome modulation factor	NA	NA	NA	NA
WP_000227928.1\|2289584_2290103_-	bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase	NA	NA	NA	NA
WP_000156455.1\|2290171_2291932_-\|protease	Lon protease family protein	NA	NA	NA	NA
WP_000877174.1\|2292117_2292570_+	macrodomain Ter protein MatP	NA	NA	NA	NA
WP_010989142.1\|2292641_2293694_-	porin OmpA	NA	NA	NA	NA
WP_000288732.1\|2294048_2294558_-	cell division inhibitor SulA	NA	NA	NA	NA
WP_001202371.1\|2294774_2295380_+	TfoX/Sxy family DNA transformation protein	NA	NA	NA	NA
WP_000950867.1\|2295366_2297520_-	TIGR01666 family membrane protein	NA	NA	NA	NA
WP_001261222.1\|2297538_2297985_-	YccF domain-containing protein	NA	NA	NA	NA
WP_000420526.1\|2298108_2300163_+	DNA helicase IV	A7KV33	Bacillus_phage	6.5e-20	27.6
WP_000424187.1\|2300198_2300657_-	methylglyoxal synthase	NA	NA	NA	NA
WP_000847719.1\|2300751_2301414_-	DUF2057 family protein	NA	NA	NA	NA
WP_001537782.1\|2301587_2302001_+	CoA-binding protein	NA	NA	NA	NA
WP_000561983.1\|2302045_2302363_-	heat shock protein HspQ	NA	NA	NA	NA
WP_000140485.1\|2302420_2303632_-	23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI	NA	NA	NA	NA
WP_000502118.1\|2304763_2305222_+\|transposase	IS200/IS605-like element IS200F family transposase	NA	NA	NA	NA
WP_000072884.1\|2305958_2306240_+	acylphosphatase	NA	NA	NA	NA
WP_000904446.1\|2306236_2306566_-	sulfurtransferase TusE	NA	NA	NA	NA
WP_000374046.1\|2306652_2307312_-\|protease	FtsH protease modulator YccA	A0A2H4JFM9	uncultured_Caudovirales_phage	2.7e-44	52.4
WP_000502118.1\|2307975_2308434_+\|transposase	IS200/IS605-like element IS200F family transposase	NA	NA	NA	NA
WP_000343717.1\|2308884_2310093_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.7e-47	45.2

DBSCAN-SWA_7

2977650 : 2982062

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000497451.1\|2977650_2977890_+	virulence protein MsgA	K7P6H1	Enterobacteria_phage	8.5e-33	88.6
WP_001529135.1\|2978762_2979572_+	cytolethal distending toxin S-CDT	A5LH53	Enterobacteria_phage	2.1e-62	50.0
WP_001277616.1\|2979644_2980022_+	DUF1353 domain-containing protein	I1TQ41	Pseudomonas_phage	2.2e-14	38.4
WP_000158843.1\|2980169_2980712_-	glycoside hydrolase family 108 protein	A0A0U2S643	Escherichia_phage	6.2e-71	67.0
WP_001766395.1\|2980903_2981632_-	pertussis-like toxin subunit ArtA	A0A0U2KD26	Escherichia_phage	4.9e-63	53.3
WP_000281950.1\|2981648_2982062_-	subtilase cytotoxin subunit B	A0A0U2KD34	Escherichia_phage	1.4e-19	38.6

DBSCAN-SWA_8

3185964 : 3193198

Morganella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001157299.1\|3185964_3187395_-	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	1.0e-104	57.4
WP_000377043.1\|3187468_3188164_-	phosphohydrolase	S4W232	Pandoravirus	2.1e-07	27.5
WP_000107435.1\|3188243_3188555_-	hypothetical protein	NA	NA	NA	NA
WP_001080666.1\|3189205_3190390_+	porin OmpS1	Q1MVN1	Enterobacteria_phage	1.4e-107	56.4
WP_024131163.1\|3190650_3190839_-	hypothetical protein	NA	NA	NA	NA
WP_000208507.1\|3190849_3191062_-	cold-shock protein	A0A1W6JNX5	Morganella_phage	1.5e-20	70.0
WP_000457648.1\|3191507_3192776_-	Y-family DNA polymerase	I6RSM4	Salmonella_phage	3.3e-224	91.2
WP_000394197.1\|3192778_3193198_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	8.5e-36	60.5

DBSCAN-SWA_9

3276940 : 3287447

Enterobacteria_phage(37.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000126347.1\|3276940_3278254_-	lipopolysaccharide biosynthesis protein RfbH	H8ZJ36	Ostreococcus_tauri_virus	7.0e-52	35.1
WP_000565909.1\|3278280_3279360_-	CDP-glucose 4,6-dehydratase	A0A222YY99	Synechococcus_phage	1.3e-16	24.1
WP_000648783.1\|3279364_3280138_-	glucose-1-phosphate cytidylyltransferase	NA	NA	NA	NA
WP_000018220.1\|3280153_3281128_-	CDP-6-deoxy-delta-3,4-glucoseen reductase	NA	NA	NA	NA
WP_000973711.1\|3281133_3281685_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	7.7e-53	58.6
WP_000857536.1\|3281685_3282564_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	2.3e-107	64.8
WP_001023656.1\|3282611_3283511_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	7.9e-31	36.3
WP_000697846.1\|3283510_3284596_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.6e-102	53.9
WP_000981469.1\|3284972_3285866_-	GalU regulator GalF	A0A127AW70	Bacillus_phage	4.8e-44	42.2
WP_001111852.1\|3286043_3287447_-	colanic acid biosynthesis protein WcaM	A0A291LBB9	Klebsiella_phage	1.1e-21	26.5

DBSCAN-SWA_10

3363339 : 3372510

Enterobacteria_phage(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000195338.1\|3363339_3365373_+\|tRNA	methionine--tRNA ligase	A0A1V0SDF2	Indivirus	6.1e-55	26.9
WP_000703137.1\|3365613_3366072_+	YehR family lipoprotein	Q9EYF5	Enterobacteria_phage	8.4e-53	72.5
WP_001197951.1\|3366243_3366774_+	YehR family lipoprotein	NA	NA	NA	NA
WP_000950413.1\|3366830_3367298_-	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	3.9e-74	90.3
WP_000598632.1\|3367344_3368064_-	two-component system response regulator BtsR	NA	NA	NA	NA
WP_057484634.1\|3368060_3369746_-	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	5.3e-278	90.9
WP_001240415.1\|3369968_3370700_+	HTH-type transcriptional regulator MlrA	Q9EYF2	Enterobacteria_phage	4.5e-101	87.9
WP_001261696.1\|3370759_3370867_+	protein YohO	NA	NA	NA	NA
WP_000824854.1\|3370847_3371579_-	ABC transporter permease	NA	NA	NA	NA
WP_000569166.1\|3371562_3372510_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.2

DBSCAN-SWA_11

3606968 : 3612999

Salmonella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000377769.1\|3606968_3607910_+	formate/nitrite transporter family protein	E7DYY8	Enterobacteria_phage	2.4e-147	88.2
WP_001682026.1\|3609152_3609542_+	GtrA family protein	A0A192Y6N5	Salmonella_phage	6.9e-56	91.5
WP_000703599.1\|3609510_3609765_+	glycosyltransferase	A8CG95	Salmonella_phage	3.1e-25	79.5
WP_000400611.1\|3609781_3611704_+	acyltransferase	A0A1R3Y5Q6	Salmonella_virus	5.6e-300	77.2
WP_106417236.1\|3612693_3612837_-	hypothetical protein	A0A1R3Y5S2	Salmonella_virus	9.0e-14	87.8
WP_106417237.1\|3612852_3612999_-	hypothetical protein	A0A1R3Y5S2	Salmonella_virus	1.1e-14	73.9

DBSCAN-SWA_12

3845976 : 3922641

Salmonella_phage(33.33%)

tail,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000083348.1\|3845976_3846714_-\|tRNA	tRNA(1)(Val) (adenine(37)-N(6))-methyltransferase TrmN	NA	NA	NA	NA
WP_000219176.1\|3846843_3848178_+	ATP-dependent RNA helicase SrmB	A0A1B1IS59	uncultured_Mediterranean_phage	1.6e-43	29.7
WP_000188410.1\|3849195_3849783_+	cysteine/O-acetylserine transporter	NA	NA	NA	NA
WP_000627811.1\|3849844_3850228_-	autonomous glycyl radical cofactor GrcA	Q7Y524	Enterobacteria_phage	6.1e-33	74.0
WP_000179978.1\|3850546_3851236_+	uracil-DNA glycosylase	A0A172DS90	Canid_alphaherpesvirus	4.6e-55	49.5
WP_000997368.1\|3851351_3852389_-\|tRNA	tRNA/rRNA methyltransferase	NA	NA	NA	NA
WP_001098738.1\|3852592_3853012_+	thioredoxin TrxC	A0A0K2FIM3	Achromobacter_phage	2.6e-16	40.6
WP_050153409.1\|3853084_3853765_+	DTW domain-containing protein	NA	NA	NA	NA
WP_000082656.1\|3853818_3856479_+	protein lysine acetyltransferase	NA	NA	NA	NA
WP_000949286.1\|3856593_3857949_+	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
WP_001264473.1\|3857993_3858317_+	YfiM family lipoprotein	NA	NA	NA	NA
WP_000807800.1\|3858313_3859615_-	MFS transporter	Q6JIH2	Burkholderia_virus	2.2e-42	29.9
WP_000985648.1\|3859718_3860174_-	DUF4385 domain-containing protein	E3SMI8	Prochlorococcus_phage	1.9e-33	49.3
WP_001235094.1\|3866334_3868908_-	ATP-dependent chaperone ClpB	H6X3M6	Enterobacteria_phage	9.0e-128	35.6
WP_000992642.1\|3869037_3869769_-	polyphenol oxidase	NA	NA	NA	NA
WP_000079130.1\|3869765_3870746_-	23S rRNA pseudouridine(1911/1915/1917) synthase RluD	NA	NA	NA	NA
WP_000197667.1\|3870877_3871615_+	outer membrane protein assembly factor BamD	NA	NA	NA	NA
WP_000178449.1\|3871886_3872225_+	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_010989056.1\|3872328_3872376_+	hypothetical protein	NA	NA	NA	NA
WP_000200079.1\|3872475_3873636_+	bifunctional chorismate mutase/prephenate dehydratase	NA	NA	NA	NA
WP_000210976.1\|3873596_3874505_-	SMP-30/gluconolactonase/LRE family protein	NA	NA	NA	NA
WP_000225191.1\|3874562_3875684_-	bifunctional chorismate mutase/prephenate dehydrogenase	NA	NA	NA	NA
WP_001168062.1\|3875693_3876764_-	3-deoxy-7-phosphoheptulonate synthase AroF	A0A0F6R6T6	Escherichia_coli_O157_typing_phage	2.4e-90	51.8
WP_001212373.1\|3877203_3877722_+	YfiR family protein	NA	NA	NA	NA
WP_001030993.1\|3877714_3878935_+	diguanylate cyclase DgcN	A0A2K8I9Y5	Pseudomonas_phage	1.7e-07	37.0
WP_000065257.1\|3879091_3879439_-	50S ribosomal protein L19	NA	NA	NA	NA
WP_000469802.1\|3879479_3880247_-\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_000043266.1\|3880291_3880840_-	ribosome maturation factor RimM	NA	NA	NA	NA
WP_000256453.1\|3880858_3881107_-	30S ribosomal protein S16	NA	NA	NA	NA
WP_000460052.1\|3881450_3882812_-	signal recognition particle protein	NA	NA	NA	NA
WP_001537507.1\|3882977_3883769_+	inner membrane protein YpjD	NA	NA	NA	NA
WP_127172650.1\|3883788_3885075_+	HlyC/CorC family transporter	NA	NA	NA	NA
WP_001682111.1\|3885195_3885753_+	hypothetical protein	NA	NA	NA	NA
WP_001518875.1\|3885834_3886425_-	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_001059155.1\|3886548_3887427_+	NAD(+) kinase	NA	NA	NA	NA
WP_000880973.1\|3887512_3889174_+	DNA repair protein RecN	NA	NA	NA	NA
WP_001203445.1\|3889322_3889661_+	outer membrane protein assembly factor BamE	NA	NA	NA	NA
WP_001112990.1\|3889826_3890117_-	RnfH family protein	NA	NA	NA	NA
WP_000242603.1\|3890106_3890583_-	type II toxin-antitoxin system RatA family toxin	NA	NA	NA	NA
WP_001518569.1\|3890732_3891215_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	5.2e-29	47.4
WP_001237656.1\|3891834_3902709_+	Ig-like domain repeat protein	NA	NA	NA	NA
WP_000533850.1\|3902772_3904182_+	TolC family outer membrane protein	NA	NA	NA	NA
WP_000196138.1\|3904178_3906359_+	type I secretion system permease/ATPase	F2Y302	Organic_Lake_phycodnavirus	1.3e-18	34.0
WP_010989217.1\|3906366_3907530_+	HlyD family type I secretion periplasmic adaptor subunit	NA	NA	NA	NA
WP_000151542.1\|3908072_3908846_-	reverse transcriptase	NA	NA	NA	NA
WP_000380485.1\|3908814_3908988_-	hypothetical protein	NA	NA	NA	NA
WP_000972389.1\|3909249_3909468_-	ogr/Delta-like zinc finger family protein	Q53ZE7	Salmonella_virus	1.9e-18	71.9
WP_001011760.1\|3909558_3910659_-	phage late control D family protein	A0A1S6KZZ5	Salmonella_phage	1.0e-176	88.3
WP_000980381.1\|3910655_3911141_-\|tail	phage tail protein	E5G6Q2	Salmonella_phage	2.4e-66	80.0
WP_001282796.1\|3911137_3914215_-\|tail	phage tail tape measure protein	E5G6Q1	Salmonella_phage	0.0e+00	63.1
WP_000763311.1\|3914207_3914327_-\|tail	GpE family phage tail protein	E5G6Q0	Salmonella_phage	2.8e-13	87.2
WP_001280897.1\|3914341_3914644_-\|tail	phage tail assembly protein	A0A1S6KZZ9	Salmonella_phage	7.0e-40	89.0
WP_001207656.1\|3914698_3915214_-\|tail	phage major tail tube protein	A0A1S6L002	Salmonella_phage	5.6e-90	95.9
WP_000046142.1\|3915223_3916396_-\|tail	phage tail sheath protein	A0A1S6KZY7	Salmonella_phage	3.5e-204	90.3
WP_000905046.1\|3916538_3917105_-	recombinase family protein	A0A0F7LA37	Escherichia_phage	1.1e-86	86.3
WP_001221113.1\|3917788_3918904_+	salmochelin biosynthesis C-glycosyltransferase IroB	NA	NA	NA	NA
WP_001111827.1\|3918984_3922641_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.0e-44	28.6

DBSCAN-SWA_13

4242587 : 4285391

Bacillus_virus(20.0%)

protease,transposase,tRNA,integrase

attL 4232703:4232716|attR 4293023:4293036

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4232703:4232716	attL	NA	NA	NA	NA
WP_001204111.1\|4242587_4243046_-\|transposase	IS200/IS605-like element IS200F family transposase	NA	NA	NA	NA
WP_000034386.1\|4243235_4244315_-	class II fructose-bisphosphate aldolase	NA	NA	NA	NA
WP_000111274.1\|4244416_4245580_-	phosphoglycerate kinase	NA	NA	NA	NA
WP_000218338.1\|4245601_4246648_-	erythrose-4-phosphate dehydrogenase	NA	NA	NA	NA
WP_000218564.1\|4247021_4247447_+	DNA-binding protein	NA	NA	NA	NA
WP_000124001.1\|4247472_4248051_+	ECF transporter S component	NA	NA	NA	NA
WP_000553254.1\|4248051_4248759_+	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_001775599.1\|4248746_4249424_+	energy-coupling factor ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_000956919.1\|4249417_4250074_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.6e-09	28.6
WP_000502119.1\|4250178_4250637_-\|transposase	IS200/IS605-like element IS200F family transposase	NA	NA	NA	NA
WP_000098658.1\|4250825_4252817_-	transketolase	NA	NA	NA	NA
WP_000701830.1\|4253092_4253851_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_000105550.1\|4253951_4254872_-	agmatinase	NA	NA	NA	NA
WP_001278580.1\|4255099_4257076_-	biosynthetic arginine decarboxylase	NA	NA	NA	NA
WP_000729109.1\|4257084_4257216_-	acid stress response protein YqgB	NA	NA	NA	NA
WP_077905074.1\|4257349_4257514_+	hypothetical protein	NA	NA	NA	NA
WP_001803086.1\|4257510_4257810_-	hypothetical protein	NA	NA	NA	NA
WP_001062140.1\|4257865_4259020_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.5e-130	63.9
WP_001113171.1\|4259512_4260907_+	galactose/proton symporter	NA	NA	NA	NA
WP_000856775.1\|4260985_4261483_+\|protease	SprT family zinc-dependent metalloprotease	NA	NA	NA	NA
WP_000286121.1\|4261578_4262286_+	deoxyribonuclease I	NA	NA	NA	NA
WP_001800534.1\|4262362_4263094_+	16S rRNA (uracil(1498)-N(3))-methyltransferase	NA	NA	NA	NA
WP_000593242.1\|4263113_4264061_+	glutathione synthase	NA	NA	NA	NA
WP_001053167.1\|4264276_4264840_+	YqgE/AlgH family protein	NA	NA	NA	NA
WP_001285491.1\|4264839_4265256_+	Holliday junction resolvase RuvX	NA	NA	NA	NA
WP_000098333.1\|4265302_4265989_-	global regulatory protein	NA	NA	NA	NA
WP_001055657.1\|4266118_4267099_-	type IV pilus twitching motility protein PilT	NA	NA	NA	NA
WP_000997790.1\|4267116_4267821_+	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_001094848.1\|4267839_4268406_+	YggT family protein	NA	NA	NA	NA
WP_001277205.1\|4268402_4268693_+	YggU family protein	NA	NA	NA	NA
WP_001174773.1\|4268700_4269294_+	XTP/dITP diphosphatase	NA	NA	NA	NA
WP_001096530.1\|4269286_4270423_+	radical SAM family heme chaperone HemW	NA	NA	NA	NA
WP_000252198.1\|4270513_4271521_-	DUF1202 domain-containing protein	NA	NA	NA	NA
WP_000394189.1\|4271653_4272700_-	L-asparaginase 2	NA	NA	NA	NA
WP_000502119.1\|4273018_4273477_+\|transposase	IS200/IS605-like element IS200F family transposase	NA	NA	NA	NA
WP_000343717.1\|4273536_4274745_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.7e-47	45.2
WP_000984827.1\|4274922_4275642_-	DUF2884 domain-containing protein	NA	NA	NA	NA
WP_001107559.1\|4275691_4276018_-	YggL family protein	NA	NA	NA	NA
WP_000786887.1\|4276017_4276737_-\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_001148958.1\|4276891_4277944_+	A/G-specific adenine glycosylase	NA	NA	NA	NA
WP_000091706.1\|4277971_4278247_+	oxidative damage protection protein	NA	NA	NA	NA
WP_000976287.1\|4278359_4279445_+	membrane-bound lytic murein transglycosylase MltC	A0A0H3V0Q1	Geobacillus_virus	5.8e-12	39.0
WP_001049802.1\|4279661_4280918_+	nucleoside permease	NA	NA	NA	NA
WP_000234466.1\|4283528_4284236_+	DUF554 domain-containing protein	NA	NA	NA	NA
WP_001681938.1\|4284577_4284862_+	DUF4102 domain-containing protein	A0A0P0IRB7	Acinetobacter_phage	3.2e-10	35.2
WP_014341481.1\|4285046_4285391_+\|integrase	integrase	NA	NA	NA	NA
4293023:4293036	attR	NA	NA	NA	NA

DBSCAN-SWA_14

4706987 : 4732489

Salmonella_phage(83.33%)

terminase,capsid,tail,head,lysis,transposase,portal,plate,integrase

attL 4701951:4701965|attR 4714117:4714131

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4701951:4701965	attL	NA	NA	NA	NA
WP_001012560.1\|4706987_4708634_-	acetolactate synthase 2 catalytic subunit	A0A0P0CDR3	Ostreococcus_lucimarinus_virus	9.0e-65	31.5
WP_001311244.1\|4708773_4708872_-	ilv operon leader peptide	NA	NA	NA	NA
WP_000290950.1\|4709497_4710550_-\|integrase	tyrosine-type recombinase/integrase	A0A218M4I3	Erwinia_phage	3.6e-107	57.3
WP_000900883.1\|4710738_4710930_-	hypothetical protein	A0A0R6PIH8	Moraxella_phage	6.8e-09	65.9
WP_001047327.1\|4710945_4711515_-	phage repressor protein CI	A0A1S6KZZ7	Salmonella_phage	2.5e-38	43.4
WP_001247706.1\|4711640_4711862_+	hypothetical protein	NA	NA	NA	NA
WP_000460893.1\|4711894_4712404_+	phage regulatory CII family protein	E5G6L3	Salmonella_phage	5.8e-87	98.8
WP_000956176.1\|4712411_4712708_+	DUF2724 domain-containing protein	E5G6L4	Salmonella_phage	4.9e-22	90.4
WP_000996717.1\|4712825_4713167_+	DUF5347 domain-containing protein	E5G6L5	Salmonella_phage	1.7e-55	98.2
WP_001244218.1\|4713234_4713468_+	DUF2732 domain-containing protein	E5G6L6	Salmonella_phage	2.0e-31	94.8
WP_000752613.1\|4713467_4713695_+	TraR/DksA family transcriptional regulator	E5G6L7	Salmonella_phage	2.7e-36	100.0
WP_000104152.1\|4713691_4714549_+	DNA adenine methylase	E5G6L8	Salmonella_phage	3.5e-161	97.2
4714117:4714131	attR	NA	NA	NA	NA
WP_000017503.1\|4714545_4716960_+	replication endonuclease	E5G6L9	Salmonella_phage	0.0e+00	97.5
WP_001580533.1\|4717113_4717302_+	hypothetical protein	E5G6M0	Salmonella_phage	7.9e-26	95.2
WP_000343717.1\|4717437_4718646_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.7e-47	45.2
WP_000822803.1\|4718692_4718992_-	hypothetical protein	NA	NA	NA	NA
WP_001251692.1\|4719100_4719979_-	hypothetical protein	A0A2H4J8D6	uncultured_Caudovirales_phage	6.1e-52	49.4
WP_001146827.1\|4720592_4721507_+	hypothetical protein	NA	NA	NA	NA
WP_000185757.1\|4721503_4722244_+	restriction endonuclease	NA	NA	NA	NA
WP_000518064.1\|4722278_4723316_-\|portal	phage portal protein	A0A1S6KZW5	Salmonella_phage	1.3e-173	89.5
WP_001098422.1\|4723315_4725082_-\|terminase	terminase ATPase subunit family protein	A0A1S6KZW3	Salmonella_phage	0.0e+00	99.5
WP_000216244.1\|4725224_4726058_+\|capsid	GPO family capsid scaffolding protein	A0A1S6KZW9	Salmonella_phage	1.5e-121	90.6
WP_000742518.1\|4726074_4727133_+\|capsid	phage major capsid protein, P2 family	E5G6M6	Salmonella_phage	1.4e-180	93.1
WP_000059191.1\|4727136_4727787_+\|terminase	terminase endonuclease subunit	E5G6M7	Salmonella_phage	8.7e-112	96.3
WP_000673504.1\|4727882_4728347_+\|head	head completion/stabilization protein	A0A1S6KZW8	Salmonella_phage	1.4e-76	89.0
WP_000868175.1\|4728346_4728550_+\|tail	tail protein X	E5G6M9	Salmonella_phage	1.4e-31	92.5
WP_000171568.1\|4728553_4728769_+	hypothetical protein	E5G6N0	Salmonella_phage	1.8e-26	80.3
WP_001069905.1\|4728749_4729262_+	lysozyme	E5G6N1	Salmonella_phage	3.1e-88	92.3
WP_000727853.1\|4729263_4729641_+	hypothetical protein	A0A1S6KZZ2	Salmonella_phage	2.3e-16	40.0
WP_001080928.1\|4729637_4730066_+\|lysis	LysB family phage lysis regulatory protein	E5G6N2	Salmonella_phage	2.2e-47	77.3
WP_001039939.1\|4730161_4730593_+\|tail	phage tail protein	E5G6N3	Salmonella_phage	1.5e-72	95.1
WP_000829146.1\|4730585_4731032_+	phage virion morphogenesis protein	A0A1S6L001	Salmonella_phage	6.6e-63	85.6
WP_000993754.1\|4731100_4731679_+\|plate	phage baseplate assembly protein V	A0A1S6KZX7	Salmonella_phage	5.5e-94	86.5
WP_000177595.1\|4731675_4732035_+	GPW/gp25 family protein	A0A1S6KZZ4	Salmonella_phage	6.1e-51	84.9
WP_001784853.1\|4732021_4732489_+\|plate	baseplate J/gp47 family protein	A0A1S6KZY6	Salmonella_phage	1.8e-66	86.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_LT904873

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_LT904872

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection