CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP013010	Enterococcus faecium strain UW7606x64/3 TC1 plasmid pWCF-TC1, complete sequence	0 crisprs	NA	0	0	1	0
NZ_CP013009	Enterococcus faecium strain UW7606x64/3 TC1 chromosome, complete genome	1 crisprs	cas3,csa3,cas14j,cas2,DinG,DEDDh	0	0	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2211 : 54103

Streptococcus_phage(57.14%)

protease,transposase,holin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002300034.1\|2211_4269_-\|protease	serine protease	NA	NA	NA	NA
WP_002300033.1\|4413_4605_-	hypothetical protein	NA	NA	NA	NA
WP_002300032.1\|4792_5248_+	hypothetical protein	NA	NA	NA	NA
WP_002305782.1\|5244_5487_+	DUF5415 family protein	NA	NA	NA	NA
WP_002302862.1\|5504_5807_+	hypothetical protein	NA	NA	NA	NA
WP_002302860.1\|5875_7930_+	hypothetical protein	NA	NA	NA	NA
WP_002302859.1\|7929_10542_+	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_002302858.1\|10538_12917_+	hypothetical protein	NA	NA	NA	NA
WP_002302857.1\|12977_13520_+	hypothetical protein	NA	NA	NA	NA
WP_002302856.1\|13597_13930_+	hypothetical protein	NA	NA	NA	NA
WP_002302855.1\|13930_14524_+	hypothetical protein	NA	NA	NA	NA
WP_002302854.1\|14545_16570_+	hypothetical protein	NA	NA	NA	NA
WP_002302853.1\|16569_17769_+	peptidoglycan DD-metalloendopeptidase family protein	Q6SEC2	Lactobacillus_prophage	2.5e-32	38.1
WP_060475445.1\|17784_18429_+	hypothetical protein	NA	NA	NA	NA
WP_002302851.1\|18439_19246_+	hypothetical protein	NA	NA	NA	NA
WP_033582323.1\|19656_20592_+	DUF4199 domain-containing protein	NA	NA	NA	NA
WP_002305788.1\|20635_20905_+	hypothetical protein	NA	NA	NA	NA
WP_002302849.1\|21180_21456_+	hypothetical protein	NA	NA	NA	NA
WP_002302844.1\|21497_21920_+	hypothetical protein	NA	NA	NA	NA
WP_033582318.1\|21939_23532_+	hypothetical protein	NA	NA	NA	NA
WP_002302842.1\|23552_23888_+	hypothetical protein	NA	NA	NA	NA
WP_002302840.1\|24033_24228_+	hypothetical protein	NA	NA	NA	NA
WP_002297404.1\|24363_25614_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002305801.1\|26023_28396_+	hypothetical protein	B5SP25	Lactococcus_phage	3.4e-12	29.7
WP_002347152.1\|28456_29917_+	hypothetical protein	NA	NA	NA	NA
WP_002305772.1\|29927_32132_+	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	6.1e-117	50.7
WP_002303311.1\|32372_32966_+	abortive infection protein	NA	NA	NA	NA
WP_002303312.1\|32978_33878_+	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_002303313.1\|33880_34366_+	single-stranded DNA-binding protein	W6LM61	Streptococcus_phage	5.8e-44	59.3
WP_002316074.1\|34506_34710_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_002295623.1\|34784_35045_+	hypothetical protein	A0A0S2MYI8	Enterococcus_phage	1.2e-11	51.4
WP_002347218.1\|35481_35688_+	hypothetical protein	NA	NA	NA	NA
WP_002296238.1\|35687_35939_+	hypothetical protein	NA	NA	NA	NA
WP_002300851.1\|35953_36391_+	hypothetical protein	NA	NA	NA	NA
WP_002303117.1\|36383_37091_+	hypothetical protein	NA	NA	NA	NA
WP_001120991.1\|37471_37651_+	hypothetical protein	NA	NA	NA	NA
WP_000388479.1\|37781_38051_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_000588503.1\|38043_38301_+	Txe/YoeB family addiction module toxin	NA	NA	NA	NA
WP_001809248.1\|38938_39763_+	hypothetical protein	NA	NA	NA	NA
WP_002302440.1\|40000_41302_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-48	33.6
WP_001261742.1\|41428_42043_-	recombinase family protein	M9Q1K0	Clostridium_phage	3.8e-16	30.9
WP_002303116.1\|42280_42703_+	hypothetical protein	NA	NA	NA	NA
WP_002299573.1\|42712_42916_+	hypothetical protein	NA	NA	NA	NA
WP_002299575.1\|43127_43712_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	5.9e-43	51.7
WP_002303115.1\|44082_45408_+	Y-family DNA polymerase	M1Q231	Streptococcus_phage	7.7e-99	43.4
WP_002303114.1\|45400_45751_+	hypothetical protein	NA	NA	NA	NA
WP_002297218.1\|46014_47310_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A1S5SBP9	Streptococcus_phage	1.0e-42	29.1
WP_060475447.1\|47335_48010_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.6e-116	99.0
WP_002347151.1\|48063_48282_-	hypothetical protein	NA	NA	NA	NA
WP_002303415.1\|48329_48602_-	hypothetical protein	NA	NA	NA	NA
WP_002303414.1\|48591_48801_-	hypothetical protein	NA	NA	NA	NA
WP_002349053.1\|48931_49252_-	hypothetical protein	NA	NA	NA	NA
WP_002303412.1\|49514_49823_-	hypothetical protein	NA	NA	NA	NA
WP_002347150.1\|49996_50365_-	hypothetical protein	NA	NA	NA	NA
WP_002347149.1\|50478_51294_-	replication initiation protein	NA	NA	NA	NA
WP_001015311.1\|51377_52058_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6
WP_000026576.1\|52429_52720_+	hypothetical protein	NA	NA	NA	NA
WP_059355959.1\|52924_54103_-\|transposase	IS256-like element ISEf1 family transposase	A0A220NQR7	Corynebacterium_phage	3.0e-30	25.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP013009

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013009_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013009_1

461529-461638

Orphan

Consensus_repeat	Method
TGATGAACAATACTGGTTGAGCAAAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013009_1

>merge|NZ_CP013009|1|461529-461638|CRISPRCasFinder
TGATGAACAATACTGGTTGAGCAAAGCGAAAGGAGTTTCCTTTCGAGCAAAGCGAGTAGAATCACTATGAACGAAGTGAATAGGTGATGAATAATACTGGTTGAGCAAAG

>NZ_CP013009|1|1|461529-461638|CRISPRCasFinder
TGATGAACAATACTGGTTGAGCAAAG	CGAAAGGAGTTTCCTTTCGAGCAAAGCGAGTAGAATCACTATGAACGAAGTGAATAGG
TGATGAATAATACTGGTTGAGCAAAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013009.1\|WP_002295743.1\|464654_465563_+\|IS982-like-element-ISEfm1-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_CP013009.1\|WP_002294578.1\|453901_454054_+\|50S-ribosomal-protein-L33	unknown	unknown	gnl\|CDD\|234783
NZ_CP013009.1\|WP_002290558.1\|465952_467485_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP013009.1\|WP_002296327.1\|462740_463430_+\|TVP38/TMEM64-family-protein	unknown	unknown	gnl\|CDD\|223475
NZ_CP013009.1\|WP_002294577.1\|453095_453740_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341358
NZ_CP013009.1\|WP_002294579.1\|454077_454248_+\|preprotein-translocase-subunit-SecE	unknown	unknown	gnl\|CDD\|376355
NZ_CP013009.1\|WP_002287792.1\|470923_471889_-\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	unknown	unknown	gnl\|CDD\|275027
NZ_CP013009.1\|WP_002294583.1\|456031_457051_+\|L-lactate-oxidase	unknown	unknown	gnl\|CDD\|240088
NZ_CP013009.1\|WP_002287793.1\|471938_474098_-\|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha	unknown	unknown	gnl\|CDD\|180921
NZ_CP013009.1\|WP_002294580.1\|454348_454894_+\|transcription-termination/antitermination-protein-NusG	unknown	unknown	gnl\|CDD\|180161
NZ_CP013009.1\|WP_002294581.1\|454970_455858_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|283645
NZ_CP013009.1\|WP_002287788.1\|468673_469387_+\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NZ_CP013009.1\|WP_002287791.1\|469695_470835_+\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NZ_CP013009.1\|WP_002294587.1\|460611_461301_+\|50S-ribosomal-protein-L1	unknown	unknown	gnl\|CDD\|180071
NZ_CP013009.1\|WP_002295743.1\|458574_459483_-\|IS982-like-element-ISEfm1-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_CP013009.1\|WP_002291638.1\|460085_460508_+\|50S-ribosomal-protein-L11	unknown	unknown	gnl\|CDD\|234661
NZ_CP013009.1\|WP_002287787.1\|467718_468420_+\|glucosamine-6-phosphate-deaminase	unknown	unknown	gnl\|CDD\|238693
NZ_CP013009.1\|WP_002294584.1\|457141_458014_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	unknown	unknown	gnl\|CDD\|129801
NZ_CP013009.1\|WP_002291634.1\|461710_462214_+\|50S-ribosomal-protein-L10	unknown	unknown	gnl\|CDD\|234632
NZ_CP013009.1\|WP_002294588.1\|462266_462635_+\|50S-ribosomal-protein-L7/L12	unknown	unknown	gnl\|CDD\|234671

Protein	Function_ID	Function_description	E-value
NZ_CP013009.1\|WP_002295743.1\|464654_465563_+\|IS982-like-element-ISEfm1-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	2.39418e-18
NZ_CP013009.1\|WP_002294578.1\|453901_454054_+\|50S-ribosomal-protein-L33	gnl\|CDD\|234783	PRK00504, rpmG, 50S ribosomal protein L33; Validated.	3.12722e-17
NZ_CP013009.1\|WP_002290558.1\|465952_467485_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	5.56109e-170
NZ_CP013009.1\|WP_002296327.1\|462740_463430_+\|TVP38/TMEM64-family-protein	gnl\|CDD\|223475	COG0398, COG0398, Uncharacterized conserved protein [Function unknown].	2.9371e-19
NZ_CP013009.1\|WP_002294577.1\|453095_453740_-\|CBS-domain-containing-protein	gnl\|CDD\|341358	cd02205, CBS_pair_SF, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains superfamily. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	5.69774e-14
NZ_CP013009.1\|WP_002294579.1\|454077_454248_+\|preprotein-translocase-subunit-SecE	gnl\|CDD\|376355	pfam00584, SecE, SecE/Sec61-gamma subunits of protein translocation complex. SecE is part of the SecYEG complex in bacteria which translocates proteins from the cytoplasm. In eukaryotes the complex, made from Sec61-gamma and Sec61-alpha translocates protein from the cytoplasm to the ER. Archaea have a similar complex.	1.48e-13
NZ_CP013009.1\|WP_002287792.1\|470923_471889_-\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	gnl\|CDD\|275027	TIGR04171, ribonucleotide-diphosphate_reductase_subunit_beta, ribonucleoside-diphosphate reductase, class 1b, beta subunit. Members of this family are NrdF, the beta subunit of class 1b ribonucleotide reductase. This form uses a dimanganese moiety associated with a tyrosine radical to reduce the cellular requirement for iron. [Purines, pyrimidines, nucleosides, and nucleotides, 2'-Deoxyribonucleotide metabolism].	0
NZ_CP013009.1\|WP_002294583.1\|456031_457051_+\|L-lactate-oxidase	gnl\|CDD\|240088	cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-binding domain. LOX is a member of the family of FMN-containing alpha-hydroxyacid oxidases and catalyzes the oxidation of l-lactate using molecular oxygen to generate pyruvate and H2O2. This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO).	0
NZ_CP013009.1\|WP_002287793.1\|471938_474098_-\|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha	gnl\|CDD\|180921	PRK07306, PRK07306, ribonucleotide-diphosphate reductase subunit alpha; Validated.	0
NZ_CP013009.1\|WP_002294580.1\|454348_454894_+\|transcription-termination/antitermination-protein-NusG	gnl\|CDD\|180161	PRK05609, nusG, transcription antitermination protein NusG; Validated.	1.97252e-86
NZ_CP013009.1\|WP_002294581.1\|454970_455858_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|283645	pfam06028, DUF915, Alpha/beta hydrolase of unknown function (DUF915). This family consists of several bacterial proteins of unknown function. Members of this family have an alpha/beta hydrolase fold.	4.81944e-80
NZ_CP013009.1\|WP_002287788.1\|468673_469387_+\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	6.15701e-49
NZ_CP013009.1\|WP_002287791.1\|469695_470835_+\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	2.06838e-61
NZ_CP013009.1\|WP_002294587.1\|460611_461301_+\|50S-ribosomal-protein-L1	gnl\|CDD\|180071	PRK05424, rplA, 50S ribosomal protein L1; Validated.	1.66496e-146
NZ_CP013009.1\|WP_002295743.1\|458574_459483_-\|IS982-like-element-ISEfm1-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	2.39418e-18
NZ_CP013009.1\|WP_002291638.1\|460085_460508_+\|50S-ribosomal-protein-L11	gnl\|CDD\|234661	PRK00140, rplK, 50S ribosomal protein L11; Validated.	9.059e-96
NZ_CP013009.1\|WP_002287787.1\|467718_468420_+\|glucosamine-6-phosphate-deaminase	gnl\|CDD\|238693	cd01399, GlcN6P_deaminase, GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium. The reaction is an aldo-keto isomerization coupled with an amination or deamination. It is the last step of the metabolic pathway of N-acetyl-D-glucosamine-6-phosphate (GlcNAc6P). GlcN6P deaminase is a hexameric enzyme that is allosterically activated by GlcNAc6P.	8.8122e-119
NZ_CP013009.1\|WP_002294584.1\|457141_458014_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	gnl\|CDD\|129801	TIGR00718, Probable_L-serine_dehydratase_alpha_chain, L-serine dehydratase, iron-sulfur-dependent, alpha subunit. This enzyme is also called serine deaminase. L-serine dehydratase converts serine into pyruvate in the gluconeogenesis pathway from serine. This model describes the alpha chain of an iron-sulfur-dependent L-serine dehydratase, found in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of alpha chains from the homologous region of single chain forms such as found in Escherichia coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	2.63238e-103
NZ_CP013009.1\|WP_002291634.1\|461710_462214_+\|50S-ribosomal-protein-L10	gnl\|CDD\|234632	PRK00099, rplJ, 50S ribosomal protein L10; Reviewed.	3.03735e-67
NZ_CP013009.1\|WP_002294588.1\|462266_462635_+\|50S-ribosomal-protein-L7/L12	gnl\|CDD\|234671	PRK00157, rplL, 50S ribosomal protein L7/L12; Reviewed.	5.30333e-45

>NZ_CP013009.1|WP_002294587.1|460611_461301_+|50S-ribosomal-protein-L1
MAKKSKKMQDALKKVDSSKVYPVAEAVALAKETNIAKFDATVEVAYRLNVDPKKADQQIRGAVVLPNGTGKTQTVLVFAKGDKAKEAEAAGADFVGDDDMVQKIQNGWFDFDVVVATPDMMATVGRLGRVLGPKGLMPNPKTGTVTMDVTKAVNEVKAGKVTYRVDKAGNIHVPIGKVSFDDEKLVENFAAIHDVLLKAKPSAAKGQYMKNVTITTTFGPGIHVDQASF
>NZ_CP013009.1|WP_002291638.1|460085_460508_+|50S-ribosomal-protein-L11
MAKKVEKIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGLIIPVVISVYEDRSFTFVTKTPPAAVLLKKAAKIEKGSGEPNKNKVAKVSSDQVREIAELKMEDLNAANVEAAMRMVEGTARSMGITVE
>NZ_CP013009.1|WP_002295743.1|458574_459483_-|IS982-like-element-ISEfm1-family-transposase
MRSSKYTEHYTDTFITFKEIMRTVSNIYHNCVPDKIKNRRNTDQLKQRDTVIIACVIWGIINGYTSQRATYRAVCSVLFPNGDFPSRSRFTRLSSNLAYTIKIIRYFFIKKLTKGELVGIIDSFPSPLCKPVRNRQAKLLNQIAKVGYNSTKKSYFYGLKIHMIVTKTGFPITYSITNPGVHDVKVLETLSEEANLPNILGDKGYISHKIHEKLALKGITISVPPRKNMDKSEKLDHSLLGKQRKTVETVFSSLEKLGCQNFNSRSVKGLESRFESILLAYSVLLSRAQRRFEGTLRYSLGY
>NZ_CP013009.1|WP_002294584.1|457141_458014_-|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha
MFLSIEELVDQAKAYPSVAELMIAVEMEMSGRSRSHIIEIMEKNLSVMEQSINEGKEGVTSVTGITGGDAKKLDDYLNEADFLSGETILKAVRNAVAVNEVNAKMGLICATPTAGSAGVVPGVLMAVRDRLDLTHEQQLEFLFTAGAFGLVIANNASISGAEGGCQAEVGSASAMAAAALVCAKNGTPHQAAQAVAITLKNMMGLICDPVAGLVEVPCVKRNALGSSQAFISADMALAGIESVIPPDEVVAAMYQVGRQMPSIFKETAEGGLAVTPTAKRLAEEILNKRA
>NZ_CP013009.1|WP_002294583.1|456031_457051_+|L-lactate-oxidase
MEAGAFGYIRGGSEDEWTMKENTTSFNTKKIMPRILRGIDSADLHTSVFGIELDTPIIQAPSAAQGLAHEKGEADTAKGVAAAGSIFSISTYANTTIKDAADAAPGAPQFFQLYMSKDDRFNEFILNKAVEAGAKAIILTADSTLGGYREEDVINQFQFPLPMPNLAAYSEQSASGNGEGKGIAEIYAAAKQGLTPDDIKTIKEITHLPVIVKGIQSPEDAVIAISAGADGIWVSNHGGRQLDGGPASFEVLPKIAEVVNKRVPVIFDSGVRRGEHVFKALASGADLVAIGRPVIYGLNLGGAEGVTSVFEHLNKELSITMQLAGTKTIDEVKNTKLMD
>NZ_CP013009.1|WP_002294581.1|454970_455858_+|alpha/beta-fold-hydrolase
MTEPIKNLCKRATAAALVLISLFALSGCQTTKINTTEVSDKEKTAESSKVIEKTTIPTLFFHGYSGTENSFKGMLRRLEKNQQAVKELVLTVGTDGQIQATGDLSGKADNPMVQVLFEDNKNNEWNQAEWIKTCLLYLKENYGIDKVNIVGHSMGGVSALRYLGTYGQDTSLPQVQTLTAIGAPFNDFVDDSAQSLTDELAKGPAVVSNRYQDYQQMIGNIPITTRFFLIAGQLDETDLSDGTVPLNSALAVYALLKQRGNEIEEKVVTGENASHSMLHENQEVDQLVSRFIWKE
>NZ_CP013009.1|WP_002294580.1|454348_454894_+|transcription-termination/antitermination-protein-NusG
MESFEKNWYVLHTYSGYENKVKANIESRAQSMKMADFIFRVVVPEEKETEVKNGKEKEIVHKTFPGYVLVEMIMTDASWYVVRNTPGVTGFVGSHGAGSKPAPLLPEEVNHILRSIGMSLRQNDLEVEVGEVVKIIEGAFAGLEGQVTEVDGEKEKLKVNIDMFGRETSTELDFDQVDKID
>NZ_CP013009.1|WP_002294579.1|454077_454248_+|preprotein-translocase-subunit-SecE
MKFLKSVKDEIKQVTWPSRKQLRKDTLVVIETSIIFGLMFYVMDTAIQSLFGWILK
>NZ_CP013009.1|WP_002294578.1|453901_454054_+|50S-ribosomal-protein-L33
MAKKKAALACSVCGSRNYTKSVSEGKSGERLEINKFCKYCNQYTLHKETK
>NZ_CP013009.1|WP_002294577.1|453095_453740_-|CBS-domain-containing-protein
MLLKTLVYKKKDLTTVTETSTLEEALKILETSGYRCVPILDSSGNIFRGNIYKMHIYRHKANGGDMTLPVTHLLKNATKFIYLDTSFFKVFFTIKELPYIAVLDSENHFYGILTHSTLLNMLSQSWSVEQGSYVLTIASTGKQGDLAAIAKIISKHSSIASCITLDIEKDEYIRRTLITLPANTEAKVCETIVNHLEKKNYKVVEIENLQNQEA
>NZ_CP013009.1|WP_002291634.1|461710_462214_+|50S-ribosomal-protein-L10
MSEAIIAKKAAIVDEVSEKFTAAASVVVVDYRGLTVDEVTRLRKQLRDANVEMKVIKNSILSRAAKKAGLEGMDEVFTGPTAVAFSNEDVVAPAKIMDEFAKEAKALEIKGGIIEGKVSSLEEITALAKLPNREGLLSMLLSVLQAPVRNVAYAVKAVADKEDGDAA
>NZ_CP013009.1|WP_002294588.1|462266_462635_+|50S-ribosomal-protein-L7/L12
MALNIENIVAELKEATILELNDLVKAIEEEFGVSAAAPVAVAAAGGAAAAEEQTEFTVELTAAGDQKVKVIKAVREATGLGLKEAKAVVDGAPAPVKEGVSKEEAEELKAKLEEVGASVTVK
>NZ_CP013009.1|WP_002296327.1|462740_463430_+|TVP38/TMEM64-family-protein
MKKKIIRLMLISLGIILILVVGYRLYLEYQTDIQLFLNPRASKAELLAHIRSHGTFASILLIVLTAVMCAVPGIPTSVVGVIAGLSFGPLTGAIINILGNALGNITAIFLMHRLKFLDKKTETNHWVQAIRQMKHPKIGVMLGYMIPVIPSSMVNFAADAMKLPLQQIILSIVIGVIPSSVLYACGGEALFHGYNKTAVTLVASVTVLVGLVVFIYKDRKKKQGKQKHK
>NZ_CP013009.1|WP_002295743.1|464654_465563_+|IS982-like-element-ISEfm1-family-transposase
MRSSKYTEHYTDTFITFKEIMRTVSNIYHNCVPDKIKNRRNTDQLKQRDTVIIACVIWGIINGYTSQRATYRAVCSVLFPNGDFPSRSRFTRLSSNLAYTIKIIRYFFIKKLTKGELVGIIDSFPSPLCKPVRNRQAKLLNQIAKVGYNSTKKSYFYGLKIHMIVTKTGFPITYSITNPGVHDVKVLETLSEEANLPNILGDKGYISHKIHEKLALKGITISVPPRKNMDKSEKLDHSLLGKQRKTVETVFSSLEKLGCQNFNSRSVKGLESRFESILLAYSVLLSRAQRRFEGTLRYSLGY
>NZ_CP013009.1|WP_002290558.1|465952_467485_-|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MSILTLNNITQQFGDKILYEGVDLQLNAGEHLGLIGQNGAGKSTLIKIITGEILPDDGQIHWQKNIHKGYLDQYVEVDETLTIEEFLKTAYAKEYEKEEKIAFLYQTYSETFDDSLLEKAGKLQTELDQGVFYQIDTLVAEMSSGLGIDVLGLDSLLKNLSGGQRSKVILAKLLLENPDVLILDEPTNHLDDQHIQWLTQFLQDFDGAYIVISHDQEFLDQITTHIADIEFGKITKYTGHLKQALKQKEQNRESYLRQYHAQQKQIEKTEAYIRKYKAGSRSTMAKSRQKQLDKIERLTPPASASKAVFDFPFSPIVTTLAVETTDLVIGYDRPLLAPINLTIRFGENIAIRGFNGIGKSTLLKTLIGEIEKISGDFHFPDNTKINYFSQDLYWENPLETPLQYLSSQFPKATIKELRRQLAKAGLVNQLASEPLTTLSGGEQTKVKLAQLTMNQGNLLILDEPTNHIDQETKESLQDGIQKFPGTVIIVSHEQEFYQDLVQRVIEIEPK
>NZ_CP013009.1|WP_002287787.1|467718_468420_+|glucosamine-6-phosphate-deaminase
MEIIRVKNAEEGGKKAFEIIKEGMNKGAKVLGLATGSTPVTLYKEMTSSDLDFSEMTSVNLDEYVGLGGSDEQSYRHFMDVQLFDKKPFKETFVPDGKAEDLEAACKKYDQIIDAHPIDIQILGIGQNGHIGFNEPGASFDGTTSVVDLTESTINANKRFFDKAEDVPTKAVSMGIGSIMKSKEIVLMAFGESKADAIKGMIEGPVTNHLPASVLQNHDNVVVIIDEEAASKL
>NZ_CP013009.1|WP_002287788.1|468673_469387_+|MgtC/SapB-family-protein
MNDMVLTIPEIILRLGIAMLFGGAIGFERQYKNRPAGMRTHILVCMGACIIALIQVEIASGALRDALEYPQLAGTIRSDEARLIAQVVSGVGFLGAGTIIVTKQSVTGLTTAASLWAIAGLGIAIGMGYYSIAIISFIGIAIALTVVKRVIHVPTTKKLEIQFIHRKETKDFLTDYFEEKNIVIEDVNFDVKFVDDYRVYKNIYTIDLPKGLTYADVIEELSVHKNITKLHLVSIAQ
>NZ_CP013009.1|WP_002287791.1|469695_470835_+|AI-2E-family-transporter
MQSRFKQSKLFFWTVELVLTIIGVYFILQMPNIFSPILKMLSAIFLPLLVAGFIYYMFDPIVVFLEKHRIPRVFGFLLTFLVVIILVVLTVMNVVPQLMEQTIQLTQSLPMYADETSKWLNELAQREEFKNFNLEEQLASANLSLSNLFNIILVSLSASVSKIISFMMQFFILLFTVPFILLFMFKDGHKFIDALSHFFPKAIRKELRQTVKELNETLSAYISSTILDALIIGVMSFLAMRIFDQPYSLLLAVICGITNIIPYVGPFIGAVPAIIVGLFISPFQALYMALSILVIQQLDGNLIKPLLFGKSMNIHPLTIILVLIGAGSVAGILGMLICIPVYAVIKTIILNIRKIYLLRRMEHVSEKLDSPKVLEETSE
>NZ_CP013009.1|WP_002287792.1|470923_471889_-|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta
MSETYYEAINWNEIEDIIDKSTWEKLTEQFWLDTRIPLSNDLDDWRTLSQLEKDTVGHVFGGLTLLDTVQSESGMDQLRKDVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKKEIEEIFDWTNTNPYLQKKAERINEIYKHGTPLEKKIASVFLETFLFYSGFYTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEAEQETLKDWMYNLLYELYENEERYTEELYDPIGWTEEVKTFLRYNANKALMNLGMDPLFPDTANDVNPIVMNGISTGTSNHDFFSQVGNGYLLGHVEAMKDDDYLIGLE
>NZ_CP013009.1|WP_002287793.1|471938_474098_-|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha
MSLKNLQDVSYFKLNNEINRPVNGQIPLNKDKEALVAFFEENVKPNTMTFPSIMEKINYLIDQEYIEAEFIQLYSPSFIEKLYQFLDEQHFSFKSFMAAYKFYSQYALKTNDGSAYLETYEDRVAFNALYFANGDEELALALADEMIHQRYQPATPSFLNAGRKRRGELVSCFLTQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYEGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSAKKENADEKIRVKTLSLGVIVPDKFYELTRKNEDMYLFSPYSVEKEYGVPFSYVNITAEYDHLVANPNIRKQKIKARDLENEISKLQQESGYPYVINIDTANRENPIDGKIIMSNLCSEILQVQTPSVINGKQEYEVLGTDISCNLGSTNIVNLMQSPNFGQSVRTMTRALTFITDASDIDVVPPIQNGNKLNHTIGLGAMGLHTYLAKEQMEYGSEDSLDFTNIYFMLLNYWTLVESNNIARERKQVFHNFEKSAYADGTYFEKYVTGEFQPKSEKVKALFEGIFIPTAEDWNALKQAVMKDGLYHQNRLAVAPNGSISYINDTSASIHPITRMIEERQEKKIGKIYYPAPYLSNETIPYYTSAYDMDMRKVIDVYATAQQHVDQGMSLTLFMRSEIPEGIYEWKTTTKQTTRDLNILRHYAFHKGIKSIYYVRTFTDDAEEIGSNQCESCVI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

93783 : 105544

Streptococcus_phage(88.89%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297345.1\|93783_94695_-	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	2.2e-65	44.0
WP_002297346.1\|94713_95718_-	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	5.6e-118	63.5
WP_002297347.1\|95714_97838_-	hypothetical protein	A0A1S5SF30	Streptococcus_phage	1.2e-181	59.7
WP_010729283.1\|97842_100290_-	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	75.9
WP_002297349.1\|100276_100666_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	3.9e-43	68.3
WP_002297350.1\|100725_101229_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	9.2e-53	59.9
WP_033658092.1\|101241_101466_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	1.2e-23	83.8
WP_002286940.1\|101569_103480_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.1e-37	29.8
WP_002297352.1\|104225_104345_-	DUF3789 domain-containing protein	NA	NA	NA	NA
WP_002297353.1\|104359_105544_-	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	2.9e-142	61.6

DBSCAN-SWA_2

234421 : 291484

Enterococcus_phage(12.5%)

transposase,tRNA,integrase,holin,protease

attL 235041:235057|attR 298495:298511

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002303642.1\|234421_235360_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	3.1e-09	28.7
235041:235057	attL	NA	NA	NA	NA
WP_002305546.1\|235359_236718_+	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
WP_002287376.1\|236730_237471_+	Stp1/IreP family PP2C-type Ser/Thr phosphatase	NA	NA	NA	NA
WP_002287377.1\|237467_239537_+	Stk1 family PASTA domain-containing Ser/Thr kinase	A0A1V0SDC3	Indivirus	3.5e-21	30.3
WP_002287379.1\|239701_240601_+	ribosome small subunit-dependent GTPase A	NA	NA	NA	NA
WP_002287380.1\|240613_241264_+	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_002287382.1\|241264_241903_+	thiamine diphosphokinase	NA	NA	NA	NA
WP_002296044.1\|242057_242912_+	rod shape-determining protein MreC	NA	NA	NA	NA
WP_002287385.1\|242915_243425_+	rod shape-determining protein MreD	NA	NA	NA	NA
WP_002287386.1\|243679_245254_+	hypothetical protein	B5LJD6	Mycobacterium_phage	2.3e-17	50.5
WP_002287387.1\|245321_247121_-	M3 family oligoendopeptidase	NA	NA	NA	NA
WP_002287389.1\|247243_247750_+	membrane protein	NA	NA	NA	NA
WP_002287391.1\|247828_248551_+	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_002287397.1\|248628_250029_-	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_002287399.1\|250198_251173_-	L-lactate dehydrogenase	NA	NA	NA	NA
WP_002287401.1\|251525_252086_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_002287403.1\|252102_255624_+	transcription-repair coupling factor	NA	NA	NA	NA
WP_002287405.1\|255638_257234_+	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_002287407.1\|257244_257514_+	RNA-binding S4 domain-containing protein	NA	NA	NA	NA
WP_002287409.1\|257580_258006_+	septum formation initiator family protein	NA	NA	NA	NA
WP_002287412.1\|258051_258522_+	RNA-binding protein S1	NA	NA	NA	NA
WP_002287414.1\|258641_260087_+\|tRNA	tRNA lysidine(34) synthetase TilS	E3T4I1	Cafeteria_roenbergensis_virus	6.8e-08	24.5
WP_002287415.1\|260086_260632_+	hypoxanthine phosphoribosyltransferase	A0A1V0SEQ1	Hokovirus	4.1e-06	25.3
WP_002287418.1\|260721_262833_+\|protease	ATP-dependent zinc metalloprotease FtsH	C7U047	Ostreococcus_tauri_virus	9.1e-110	50.3
WP_002296053.1\|263049_263937_+	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_002290055.1\|263937_264942_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_002301217.1\|265052_266549_+\|tRNA	lysine--tRNA ligase	A0A2K9KZX5	Tupanvirus	6.7e-91	40.9
WP_002326809.1\|266658_267954_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	5.0e-10	21.4
WP_002289731.1\|276381_277575_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.3e-150	72.0
WP_002295566.1\|277704_279177_+	MFS transporter	NA	NA	NA	NA
WP_002295567.1\|279259_280048_+	esterase family protein	NA	NA	NA	NA
WP_002285876.1\|280114_280783_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_002285883.1\|280897_282610_+	ABC transporter ATP-binding protein	F2Y302	Organic_Lake_phycodnavirus	1.2e-14	25.4
WP_002301355.1\|282612_284385_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.2e-54	29.4
WP_033647077.1\|284466_285588_-\|integrase	site-specific integrase	C9E2L6	Enterococcus_phage	4.0e-64	38.5
WP_002304713.1\|285659_286592_-	DUF4041 domain-containing protein	M1NRY5	Streptococcus_phage	1.8e-57	53.8
WP_002301399.1\|286794_287754_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	2.2e-10	26.8
WP_002301818.1\|287886_288093_+\|holin	holin	NA	NA	NA	NA
WP_002303477.1\|288103_289123_+	N-acetylmuramoyl-L-alanine amidase	A0A1G5SA77	Enterococcus_phage	2.4e-60	66.1
WP_025479400.1\|289897_290200_-	hypothetical protein	NA	NA	NA	NA
WP_002296840.1\|290296_291484_+\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
298495:298511	attR	NA	NA	NA	NA

DBSCAN-SWA_3

433000 : 483562

Bacillus_virus(20.0%)

tRNA,bacteriocin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296623.1\|433000_434296_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
WP_002289850.1\|434385_435063_-	DsbA family protein	NA	NA	NA	NA
WP_002289849.1\|435180_435756_-	CYTH domain-containing protein	NA	NA	NA	NA
WP_002289848.1\|435886_436591_+	GTP pyrophosphokinase family protein	NA	NA	NA	NA
WP_002289847.1\|436568_437366_+	NAD kinase	NA	NA	NA	NA
WP_002294562.1\|437367_438267_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_002294561.1\|438284_439646_+	magnesium transporter	NA	NA	NA	NA
WP_002294560.1\|439707_440349_-	copper homeostasis protein CutC	NA	NA	NA	NA
WP_002294559.1\|440457_441324_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_002289592.1\|441544_442048_+\|tRNA	tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL	NA	NA	NA	NA
WP_002289593.1\|442096_442756_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_002289594.1\|442775_445364_+	ATP-dependent RecD-like DNA helicase	A0A218KCE8	Bacillus_phage	8.6e-62	29.2
WP_002289596.1\|445466_445694_+	hypothetical protein	NA	NA	NA	NA
WP_002289597.1\|445803_446433_-	response regulator transcription factor	NA	NA	NA	NA
WP_002289599.1\|446429_447509_-	GHKL domain-containing protein	NA	NA	NA	NA
WP_002324227.1\|447625_448558_+	ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	5.9e-21	33.2
WP_002294551.1\|448571_449717_+	ABC transporter permease	NA	NA	NA	NA
WP_002296167.1\|449703_450876_+	ABC transporter permease	NA	NA	NA	NA
WP_002294549.1\|450974_451940_-	diacylglycerol kinase	NA	NA	NA	NA
WP_002294548.1\|452536_453040_+	QueT transporter family protein	E7DN70	Pneumococcus_phage	3.4e-07	34.3
WP_002294577.1\|453095_453740_-	CBS domain-containing protein	NA	NA	NA	NA
WP_002294578.1\|453901_454054_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_002294579.1\|454077_454248_+	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_002294580.1\|454348_454894_+	transcription termination/antitermination protein NusG	NA	NA	NA	NA
WP_002294581.1\|454970_455858_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_002294583.1\|456031_457051_+	L-lactate oxidase	NA	NA	NA	NA
WP_002294584.1\|457141_458014_-	L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha	NA	NA	NA	NA
WP_002295743.1\|458574_459483_-\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002291638.1\|460085_460508_+	50S ribosomal protein L11	NA	NA	NA	NA
WP_002294587.1\|460611_461301_+	50S ribosomal protein L1	NA	NA	NA	NA
WP_002291634.1\|461710_462214_+	50S ribosomal protein L10	NA	NA	NA	NA
WP_002294588.1\|462266_462635_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_002296327.1\|462740_463430_+	TVP38/TMEM64 family protein	NA	NA	NA	NA
WP_002295743.1\|464654_465563_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002290558.1\|465952_467485_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	3.3e-45	28.0
WP_002287787.1\|467718_468420_+	glucosamine-6-phosphate deaminase	NA	NA	NA	NA
WP_002287788.1\|468673_469387_+	MgtC/SapB family protein	G3MA03	Bacillus_virus	6.5e-20	43.7
WP_002287791.1\|469695_470835_+	AI-2E family transporter	NA	NA	NA	NA
WP_002287792.1\|470923_471889_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	3.4e-128	70.4
WP_002287793.1\|471938_474098_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	3.8e-265	63.2
WP_002287795.1\|474256_474481_-	glutaredoxin-like protein NrdH	A0A0M7REK7	Lactobacillus_phage	1.7e-11	42.7
WP_002287797.1\|474881_475355_+	ferrous iron transport protein A	NA	NA	NA	NA
WP_002287799.1\|475351_477484_+	ferrous iron transport protein B	NA	NA	NA	NA
WP_002290587.1\|477485_477620_+	hypothetical protein	NA	NA	NA	NA
WP_002287801.1\|477713_478358_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002287805.1\|478544_479738_+	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-29	37.0
WP_002287807.1\|479730_481458_+	ABC transporter permease/substrate binding protein	NA	NA	NA	NA
WP_002304799.1\|481851_482049_+	enterocin	NA	NA	NA	NA
WP_002287810.1\|482050_482362_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_002321654.1\|482465_482612_+\|bacteriocin	EntF family bacteriocin induction factor	NA	NA	NA	NA
WP_002286097.1\|482608_483562_-\|transposase	IS30 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

727595 : 736067

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002294039.1\|727595_728240_+	dTMP kinase	M1PSC7	Streptococcus_phage	4.2e-58	52.6
WP_002292340.1\|728254_728584_+	hypothetical protein	NA	NA	NA	NA
WP_002288071.1\|728597_729536_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	3.3e-35	34.4
WP_002288073.1\|729571_730396_+	stage 0 sporulation family protein	NA	NA	NA	NA
WP_002288076.1\|730388_730736_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	5.1e-18	41.1
WP_002288078.1\|730804_731677_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	3.1e-88	60.4
WP_002294035.1\|731785_732907_+	DNA polymerase IV	NA	NA	NA	NA
WP_002288081.1\|732960_733563_-	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	1.7e-53	58.6
WP_002288083.1\|733877_736067_-	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	1.8e-286	66.6

DBSCAN-SWA_5

1143793 : 1152854

Gordonia_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288023.1\|1143793_1145089_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	4.5e-19	33.1
WP_002297115.1\|1145268_1145646_-	hypothetical protein	NA	NA	NA	NA
WP_002288021.1\|1145901_1146630_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	E3SPA9	Prochlorococcus_phage	4.6e-45	41.4
WP_002295474.1\|1146629_1146884_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_002288017.1\|1146885_1147557_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_002288015.1\|1147557_1149780_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.9e-150	41.3
WP_002288013.1\|1149764_1151204_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.3e-53	33.1
WP_060475435.1\|1151235_1152279_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SE90	Cyanophage	3.5e-62	43.7
WP_002288010.1\|1152275_1152854_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-26	37.4

DBSCAN-SWA_6

1441747 : 1496740

Enterococcus_phage(37.5%)

tail,portal,transposase,protease,terminase,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296628.1\|1441747_1442587_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_002330168.1\|1442805_1443660_+	rotamase	NA	NA	NA	NA
WP_002323639.1\|1444230_1444926_-	fructose-6-phosphate aldolase	E3SKN5	Synechococcus_phage	6.8e-22	31.0
WP_002319298.1\|1444909_1445308_-	PTS glucitol/sorbitol transporter subunit IIA	NA	NA	NA	NA
WP_060475223.1\|1446339_1446894_-	PTS glucitol/sorbitol transporter subunit IIC	NA	NA	NA	NA
WP_060475226.1\|1446881_1447373_-	transcriptional regulator	NA	NA	NA	NA
WP_060475228.1\|1449250_1450051_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	9.9e-09	25.8
WP_002289418.1\|1450274_1450490_+	DUF378 domain-containing protein	NA	NA	NA	NA
WP_002330164.1\|1450628_1451114_+	hypothetical protein	NA	NA	NA	NA
WP_002299276.1\|1451569_1451983_+	Hsp20/alpha crystallin family protein	A0A1B2LRT2	Wolbachia_phage	2.1e-07	31.5
WP_025481096.1\|1452119_1452380_+	hypothetical protein	NA	NA	NA	NA
WP_002323081.1\|1453277_1454069_+	membrane protein	NA	NA	NA	NA
WP_002323082.1\|1454240_1454633_+	VOC family protein	NA	NA	NA	NA
WP_086272838.1\|1454712_1455498_-	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_002323084.1\|1455481_1455637_-	hypothetical protein	NA	NA	NA	NA
WP_060475230.1\|1455637_1456321_-	type 1 glutamine amidotransferase domain-containing protein	NA	NA	NA	NA
WP_002324895.1\|1456298_1456652_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002293041.1\|1456930_1457128_-	cold-shock protein	Q9AZD3	Lactococcus_phage	3.9e-23	78.5
WP_002323043.1\|1457390_1457606_-	hypothetical protein	NA	NA	NA	NA
WP_002322938.1\|1458136_1458316_+	hypothetical protein	NA	NA	NA	NA
WP_002322940.1\|1458736_1459039_+	hypothetical protein	NA	NA	NA	NA
WP_025478623.1\|1460834_1461137_+	hypothetical protein	NA	NA	NA	NA
WP_002334523.1\|1462085_1462664_-	hypothetical protein	NA	NA	NA	NA
WP_002334522.1\|1462757_1463777_-	N-acetylmuramoyl-L-alanine amidase	A0A1G5SA77	Enterococcus_phage	3.7e-61	67.2
WP_002337187.1\|1463901_1465251_-	hypothetical protein	NA	NA	NA	NA
WP_002334520.1\|1465444_1465651_-	hypothetical protein	A0A0S2MYG0	Enterococcus_phage	1.5e-17	66.7
WP_060475232.1\|1465726_1467949_-	hypothetical protein	A0A0M4RT83	Enterococcus_phage	2.3e-63	41.1
WP_060475234.1\|1467972_1470264_-	hypothetical protein	A0A1D3SNL1	Enterococcus_phage	3.0e-90	30.0
WP_010729125.1\|1470273_1471011_-\|tail	phage tail protein	NA	NA	NA	NA
WP_060475236.1\|1471061_1474481_-\|tail	phage tail tape measure protein	A0A1D3SNL5	Enterococcus_phage	8.7e-78	41.5
WP_002305377.1\|1474497_1474680_-	hypothetical protein	NA	NA	NA	NA
WP_002286510.1\|1474682_1475045_-	hypothetical protein	NA	NA	NA	NA
WP_002318244.1\|1475066_1475672_-	hypothetical protein	Q8W5Z9	Listeria_phage	6.7e-34	41.2
WP_002319774.1\|1475683_1476088_-	hypothetical protein	R4IBU7	Listeria_phage	6.1e-07	29.5
WP_060475239.1\|1476080_1476482_-	hypothetical protein	A0A1B1P759	Bacillus_phage	3.9e-14	34.1
WP_060475241.1\|1476471_1476825_-	hypothetical protein	NA	NA	NA	NA
WP_060475243.1\|1476814_1477126_-	hypothetical protein	A0A1B1P751	Bacillus_phage	2.4e-11	43.5
WP_060475245.1\|1477122_1477998_-	hypothetical protein	D2IYX3	Enterococcus_phage	2.1e-129	74.2
WP_002325367.1\|1478007_1479168_-\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	3.6e-100	50.4
WP_002325366.1\|1479167_1479854_-\|protease	Clp protease ClpP	A0A2I6PDD0	Staphylococcus_phage	6.1e-31	40.2
WP_002325365.1\|1479816_1480995_-\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	5.4e-80	40.2
WP_002325364.1\|1481014_1482706_-\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	1.8e-148	49.4
WP_002325363.1\|1482683_1482998_-	hypothetical protein	A0A1S7FYW6	Listeria_phage	3.3e-08	37.9
WP_002296599.1\|1483100_1483382_-	hypothetical protein	NA	NA	NA	NA
WP_002305386.1\|1483386_1483731_-	HNH endonuclease	A0A1B1P757	Bacillus_phage	1.0e-26	58.1
WP_086956687.1\|1484063_1485225_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_060475247.1\|1485331_1485526_-	hypothetical protein	NA	NA	NA	NA
WP_002325361.1\|1485982_1486195_-	hypothetical protein	A0A182BQC3	Lactococcus_phage	2.3e-13	55.9
WP_025478012.1\|1486218_1486455_-	hypothetical protein	NA	NA	NA	NA
WP_002304479.1\|1486694_1487108_-	autolysin	C9E2P5	Enterococcus_phage	1.1e-56	81.0
WP_002325359.1\|1487183_1487480_-	hypothetical protein	NA	NA	NA	NA
WP_002325358.1\|1487476_1487680_-	hypothetical protein	NA	NA	NA	NA
WP_002325357.1\|1487894_1488254_-	hypothetical protein	NA	NA	NA	NA
WP_002325356.1\|1488254_1488488_-	DUF3850 domain-containing protein	C9E2N9	Enterococcus_phage	2.3e-22	71.2
WP_002311626.1\|1488484_1488847_-	hypothetical protein	NA	NA	NA	NA
WP_002311627.1\|1488843_1489053_-	hypothetical protein	NA	NA	NA	NA
WP_002311628.1\|1489172_1489550_+	hypothetical protein	NA	NA	NA	NA
WP_002325355.1\|1489571_1490033_-	class I SAM-dependent methyltransferase	D2IZK8	Enterococcus_phage	3.3e-73	78.3
WP_002311630.1\|1490033_1490420_-	hypothetical protein	A0A060ABA9	Staphylococcus_phage	2.1e-12	35.5
WP_002311632.1\|1490416_1490728_-	hypothetical protein	A0A0D3MVS9	Staphylococcus_phage	7.0e-27	57.0
WP_002326231.1\|1490727_1491018_-	hypothetical protein	D2IZR3	Enterococcus_phage	1.1e-13	43.4
WP_080375520.1\|1491011_1491323_-	hypothetical protein	NA	NA	NA	NA
WP_002296606.1\|1491319_1491481_-	antitoxin	NA	NA	NA	NA
WP_002334205.1\|1491495_1491855_-	DUF1064 domain-containing protein	A0A1P8BKR1	Lactococcus_phage	8.9e-18	46.6
WP_002334204.1\|1491847_1492738_-	DnaD domain protein	NA	NA	NA	NA
WP_002334203.1\|1492786_1493677_-	DNA recombination protein RecT	D2IYT9	Enterococcus_phage	3.7e-137	84.5
WP_002334202.1\|1493678_1494620_-	hypothetical protein	D2IZK1	Enterococcus_phage	5.6e-144	77.6
WP_002319163.1\|1494756_1494942_-	hypothetical protein	NA	NA	NA	NA
WP_060475437.1\|1494938_1495217_-	hypothetical protein	NA	NA	NA	NA
WP_002334201.1\|1495222_1495768_-	hypothetical protein	NA	NA	NA	NA
WP_002301566.1\|1495980_1496214_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002301565.1\|1496368_1496740_+	helix-turn-helix transcriptional regulator	O03970	Lactobacillus_phage	2.1e-22	45.2

DBSCAN-SWA_7

1663197 : 1761349

116

Enterococcus_phage(36.73%)

tail,portal,transposase,head,plate,tRNA,integrase,holin,protease,terminase,capsid

attL 1707739:1707760|attR 1744141:1744162

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002293887.1\|1663197_1664214_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	5.4e-60	41.4
WP_002293888.1\|1664210_1664675_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_002293890.1\|1664681_1665224_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_002302614.1\|1665207_1666032_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_002293893.1\|1666120_1667101_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	5.8e-19	28.9
WP_002293895.1\|1667124_1668609_-	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_002293897.1\|1668620_1669610_-	UDP-glucose 4-epimerase GalE	A0A1V0SG19	Hokovirus	1.6e-48	36.8
WP_002288457.1\|1669858_1670026_+	DUF3042 family protein	NA	NA	NA	NA
WP_060475262.1\|1670087_1671899_-	FAD/NAD(P)-binding protein	NA	NA	NA	NA
WP_002288459.1\|1671895_1672261_-	DUF488 family protein	NA	NA	NA	NA
WP_002293900.1\|1672423_1672819_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_002293901.1\|1672836_1673799_-	ROK family glucokinase	NA	NA	NA	NA
WP_002293902.1\|1673798_1674011_-	YqgQ family protein	NA	NA	NA	NA
WP_002289885.1\|1674031_1674730_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_002289886.1\|1674749_1675292_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_002293903.1\|1675423_1676428_-	iron ABC transporter permease	NA	NA	NA	NA
WP_002293904.1\|1676424_1677414_-	iron ABC transporter permease	NA	NA	NA	NA
WP_002293905.1\|1677410_1678217_-	ABC transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	1.0e-13	32.1
WP_002293906.1\|1678382_1679339_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002296121.1\|1679415_1679934_-	dihydrofolate reductase	G3MBI7	Bacillus_virus	7.1e-24	39.1
WP_002296119.1\|1680021_1680171_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_002293914.1\|1680400_1680847_+	DUF2188 domain-containing protein	NA	NA	NA	NA
WP_002293915.1\|1681040_1682936_-	asparagine synthase (glutamine-hydrolyzing)	F2Y2L7	Organic_Lake_phycodnavirus	6.0e-20	26.2
WP_002293918.1\|1683260_1684235_-	choloylglycine hydrolase family protein	A0A2K9L5Y5	Tupanvirus	1.3e-18	27.8
WP_002302607.1\|1684806_1685373_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_060475264.1\|1685628_1686960_+	DUF1576 domain-containing protein	NA	NA	NA	NA
WP_002293923.1\|1686925_1687279_+	hypothetical protein	NA	NA	NA	NA
WP_002306407.1\|1687370_1687790_-	cupin domain-containing protein	NA	NA	NA	NA
WP_002293927.1\|1687790_1688135_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_002287776.1\|1688483_1689080_+	TVP38/TMEM64 family protein	M1Q152	Streptococcus_phage	8.7e-34	41.7
WP_002293929.1\|1689203_1691003_+	glycerophosphoryl diester phosphodiesterase	I6XE30	Staphylococcus_phage	5.3e-10	26.5
WP_002293930.1\|1691280_1691493_-	hypothetical protein	NA	NA	NA	NA
WP_002288573.1\|1692371_1692758_+	YxeA family protein	NA	NA	NA	NA
WP_002293932.1\|1692800_1693013_+\|integrase	integrase	A0A0P0I3D2	Lactobacillus_phage	3.5e-06	62.5
WP_002288574.1\|1693117_1694464_-	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_002293933.1\|1694575_1695925_-	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
WP_002293934.1\|1696041_1697295_+	NAD(P)/FAD-dependent oxidoreductase	A0A2H4PQX1	Staphylococcus_phage	4.5e-24	55.3
WP_002288577.1\|1697365_1697851_-\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_002293935.1\|1697873_1698632_-	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	8.5e-26	36.9
WP_002293936.1\|1698647_1699826_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	7.8e-103	49.2
WP_002293938.1\|1700055_1702176_+	LTA synthase family protein	W6LM83	Streptococcus_phage	3.7e-220	58.3
WP_002297641.1\|1702398_1703124_+	hypothetical protein	NA	NA	NA	NA
WP_002288586.1\|1703113_1703623_+	hypothetical protein	NA	NA	NA	NA
WP_002293941.1\|1703692_1705141_-	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	2.3e-19	29.3
WP_002293942.1\|1705140_1705857_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.0e-33	35.7
WP_002293943.1\|1705837_1706188_-	SdpI family protein	NA	NA	NA	NA
WP_002293945.1\|1706331_1707105_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
1707739:1707760	attL	NA	NA	NA	NA
WP_002301594.1\|1707861_1708164_+	hypothetical protein	NA	NA	NA	NA
WP_002337238.1\|1708413_1708677_-	hypothetical protein	NA	NA	NA	NA
WP_060475266.1\|1709142_1709730_-	hypothetical protein	NA	NA	NA	NA
WP_060475268.1\|1709710_1710595_-	hypothetical protein	NA	NA	NA	NA
WP_060475270.1\|1710850_1711870_-	N-acetylmuramoyl-L-alanine amidase	A0A1G5SA77	Enterococcus_phage	2.9e-61	67.2
WP_060475272.1\|1711866_1712079_-\|holin	holin	C9E2L0	Enterococcus_phage	6.4e-24	85.9
WP_002312831.1\|1712092_1712335_-\|holin	holin	D2J075	Enterococcus_phage	2.0e-21	62.0
WP_080262858.1\|1712369_1712507_-	XkdX family protein	NA	NA	NA	NA
WP_060475274.1\|1712508_1712955_-	hypothetical protein	NA	NA	NA	NA
WP_060475276.1\|1712966_1715099_-\|plate	BppU family phage baseplate upper protein	A0A288TYH2	Enterococcus_phage	1.7e-116	59.2
WP_060475278.1\|1715098_1716148_-	hypothetical protein	A0A0B5D0C2	Listeria_phage	2.5e-20	26.7
WP_060475280.1\|1716147_1717167_-	hypothetical protein	Q9T1A5	Listeria_phage	8.5e-106	54.7
WP_060475282.1\|1717175_1718006_-\|tail	phage tail family protein	A0A059T6D8	Listeria_phage	1.3e-51	40.4
WP_060475284.1\|1718016_1722570_-	tape measure protein	A0A060ANI0	Enterococcus_phage	7.4e-226	49.6
WP_002290636.1\|1722569_1722761_-	hypothetical protein	NA	NA	NA	NA
WP_002335843.1\|1722784_1723096_-	hypothetical protein	A0A0M4R2F4	Enterococcus_phage	2.3e-14	46.7
WP_060475286.1\|1723220_1723781_-\|tail	phage tail protein	A0A060AI59	Enterococcus_phage	9.0e-41	47.3
WP_002329393.1\|1723796_1724168_-	hypothetical protein	A0A060ANH4	Enterococcus_phage	2.5e-23	46.2
WP_002290643.1\|1724164_1724560_-	hypothetical protein	A0A0M5M1E5	Enterococcus_phage	5.8e-18	41.7
WP_060475288.1\|1724556_1724892_-\|head	phage head closure protein	C0LZZ3	Enterococcus_phage	3.5e-16	38.7
WP_060475290.1\|1724869_1725154_-\|head,tail	phage gp6-like head-tail connector protein	A0A0M4S687	Enterococcus_phage	2.5e-15	46.8
WP_080375530.1\|1725165_1725423_-	hypothetical protein	A5GYM0	Lactococcus_phage	8.6e-15	61.8
WP_060475291.1\|1725419_1726553_-\|capsid	phage major capsid protein	Q9AZY5	Lactococcus_phage	1.2e-81	53.3
WP_060475294.1\|1727086_1728271_-\|portal	phage portal protein	V5US36	Enterococcus_phage	2.7e-79	43.7
WP_002333643.1\|1728444_1730169_-\|terminase	terminase large subunit	D7PQ39	Enterococcus_phage	1.3e-167	53.0
WP_060475295.1\|1730161_1730641_-\|terminase	phage terminase small subunit P27 family	A0A0M3UL59	Enterococcus_phage	9.1e-42	59.1
WP_021108997.1\|1730805_1731180_-	HNH endonuclease	A0A249XUN4	Enterococcus_phage	3.0e-32	55.8
WP_060475297.1\|1731182_1731701_-	hypothetical protein	NA	NA	NA	NA
WP_060475299.1\|1731700_1731928_-	hypothetical protein	NA	NA	NA	NA
WP_060475302.1\|1731993_1732923_-	hypothetical protein	NA	NA	NA	NA
WP_002332449.1\|1733086_1733353_-	hypothetical protein	NA	NA	NA	NA
WP_060475304.1\|1733628_1734015_-	hypothetical protein	O34053	Streptococcus_phage	5.4e-29	54.3
WP_002332450.1\|1734027_1734441_-	ArpU family phage transcriptional regulator	C9E2P5	Enterococcus_phage	5.6e-56	80.3
WP_060475306.1\|1734515_1734812_-	hypothetical protein	NA	NA	NA	NA
WP_060475308.1\|1734808_1734958_-	hypothetical protein	NA	NA	NA	NA
WP_002321420.1\|1734972_1735332_-	DUF1064 domain-containing protein	A0A1P8BKR1	Lactococcus_phage	1.1e-18	48.3
WP_060475310.1\|1735328_1736180_-	ATP-binding protein	A0A0P0I3L9	Lactobacillus_phage	4.7e-25	28.3
WP_060475312.1\|1736197_1737028_-	replication protein	C9E2N2	Enterococcus_phage	2.9e-51	43.5
WP_060475314.1\|1737030_1737717_-	hypothetical protein	C9E2N1	Enterococcus_phage	1.1e-88	69.5
WP_060475316.1\|1737722_1738394_-	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	5.5e-29	47.8
WP_002323906.1\|1738386_1738728_-	hypothetical protein	NA	NA	NA	NA
WP_002351655.1\|1738874_1739657_+	hypothetical protein	NA	NA	NA	NA
WP_060475318.1\|1739845_1740073_-	hypothetical protein	NA	NA	NA	NA
WP_060475321.1\|1740087_1740291_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_060475323.1\|1740305_1741058_-	phage antirepressor	B2ZYU5	Staphylococcus_phage	2.1e-69	57.0
WP_060475325.1\|1741058_1741304_-	helix-turn-helix transcriptional regulator	Q38329	Lactococcus_phage	2.9e-12	52.6
WP_060475327.1\|1741461_1742118_+	helix-turn-helix domain-containing protein	Q9G0C2	Lactococcus_phage	2.8e-49	45.9
WP_060475329.1\|1742211_1742883_+	DUF5067 domain-containing protein	NA	NA	NA	NA
WP_060475331.1\|1742992_1744135_+\|integrase	site-specific integrase	P97010	Streptococcus_pyogenes_phage	5.5e-69	42.8
WP_002323892.1\|1744650_1744965_-	hypothetical protein	NA	NA	NA	NA
1744141:1744162	attR	NA	NA	NA	NA
WP_002321266.1\|1745250_1745490_+	hypothetical protein	NA	NA	NA	NA
WP_002289617.1\|1745851_1746112_-	hypothetical protein	NA	NA	NA	NA
WP_002293950.1\|1746296_1746794_-	GAF domain-containing protein	NA	NA	NA	NA
WP_002289619.1\|1746923_1747634_-	acetolactate decarboxylase	NA	NA	NA	NA
WP_002293952.1\|1747646_1749311_-	acetolactate synthase AlsS	NA	NA	NA	NA
WP_002297646.1\|1749516_1750179_-	DUF624 domain-containing protein	NA	NA	NA	NA
WP_002293954.1\|1750188_1751058_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002293955.1\|1751068_1751965_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_021108906.1\|1752017_1753277_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002293957.1\|1753305_1753560_-	hypothetical protein	NA	NA	NA	NA
WP_002293958.1\|1753910_1754153_-	DUF2087 domain-containing protein	NA	NA	NA	NA
WP_002293960.1\|1754706_1754937_+	hypothetical protein	NA	NA	NA	NA
WP_033581966.1\|1754936_1755242_+	hypothetical protein	NA	NA	NA	NA
WP_002295271.1\|1755780_1756755_-	choloylglycine hydrolase family protein	M1HVK5	Paramecium_bursaria_Chlorella_virus	5.4e-25	31.8
WP_002295273.1\|1756917_1757175_+	hypothetical protein	NA	NA	NA	NA
WP_002337288.1\|1757368_1758277_-\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002290348.1\|1758424_1758775_-	hypothetical protein	NA	NA	NA	NA
WP_002333089.1\|1758767_1760093_-	Y-family DNA polymerase	M1Q231	Streptococcus_phage	1.0e-98	43.4
WP_010728675.1\|1760389_1761349_+\|transposase	IS30 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP013010

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP013009

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection