CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP012183	Pseudonocardia sp. EC080610-09 plasmid pBCI2-2, complete sequence	0 crisprs	NA	0	0	0
NZ_CP012181	Pseudonocardia sp. EC080610-09 chromosome, complete genome	9 crisprs	csa3,cas3,WYL,DEDDh,cas4,DinG	2	3	1
NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	0 crisprs	csa3,WYL	0	0	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP012181_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012181_3

1110140-1110283

Orphan

Consensus_repeat	Method
CAGCTCGCGCAACGGGTCCACGGC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP012181_3

>merge|NZ_CP012181|3|1110140-1110283|CRISPRCasFinder
CAGCTCGCGCAGCGGCTCGACCGCGGCACCGAGCTCACGCAGCGGCTCCACCGCGGACGCCAGCTCCCGCAGCGGCTCCACCGCCGAGGCCAGGTCCCGCAGCGACCCGACCGCCCCGCCGAGCTCGCGCAACGGCTCCACGGC

>NZ_CP012181|3|3|1110140-1110283|CRISPRCasFinder
CAGCTCGCGCAGCGGCTCGACCGC	GGCACCGAGCTCACGCAGCGGCTCCACCGCGGACGC
CAGCTCCCGCAGCGGCTCCACCGC	CGAGGCCAGGTCCCGCAGCGACCCGACCGCCCCGCC
GAGCTCGCGCAACGGCTCCACGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012181.1\|WP_060574400.1\|1103881_1104778_-\|NmrA/HSCARG-family-protein	unknown	unknown	gnl\|CDD\|187561
NZ_CP012181.1\|WP_060574402.1\|1105298_1106507_-\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|173847
NZ_CP012181.1\|WP_145984050.1\|1115738_1116191_+\|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224759
NZ_CP012181.1\|WP_060574398.1\|1102058_1103075_-\|lipase	unknown	unknown	gnl\|CDD\|224001
NZ_CP012181.1\|WP_060574399.1\|1103185_1103818_-\|dihydrofolate-reductase-family-protein	unknown	unknown	gnl\|CDD\|223340
NZ_CP012181.1\|WP_010230048.1\|1112908_1114162_-\|acetamidase/formamidase-family-protein	unknown	unknown	gnl\|CDD\|376984
NZ_CP012181.1\|WP_060633622.1\|1112142_1112778_-\|AmiS/UreI-family-transporter	unknown	unknown	gnl\|CDD\|367022
NZ_CP012181.1\|WP_060574408.1\|1114589_1115675_-\|substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|380581
NZ_CP012181.1\|WP_075302211.1\|1101095_1102013_-\|dihydropteroate-synthase	unknown	unknown	gnl\|CDD\|273657
NZ_CP012181.1\|WP_060574403.1\|1106538_1107069_-\|SCP2-sterol-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|376720
NZ_CP012181.1\|WP_010230043.1\|1111656_1112121_+\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|132914
NZ_CP012181.1\|WP_082399221.1\|1110741_1111464_-\|deoxyribose-phosphate-aldolase	unknown	unknown	gnl\|CDD\|234784
NZ_CP012181.1\|WP_060574404.1\|1107169_1107808_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP012181.1\|WP_029239192.1\|1108583_1109192_-\|DsbA-family-protein	unknown	unknown	gnl\|CDD\|376526
NZ_CP012181.1\|WP_060574410.1\|1116220_1116919_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_CP012181.1\|WP_060576381.1\|1117090_1119928_+\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223354
NZ_CP012181.1\|WP_010230050.1\|1114225_1114513_-\|zinc-ribbon-domain-containing-protein	unknown	unknown	gnl\|CDD\|197903
NZ_CP012181.1\|WP_060574411.1\|1119882_1120119_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012181.1\|WP_060574405.1\|1108140_1108515_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012181.1\|WP_060574401.1\|1104922_1105279_+\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133388

Protein	Function_ID	Function_description	E-value
NZ_CP012181.1\|WP_060574400.1\|1103881_1104778_-\|NmrA/HSCARG-family-protein	gnl\|CDD\|187561	cd05251, NmrA_like_SDR_a, NmrA (a transcriptional regulator) and HSCARG (an NADPH sensor) like proteins, atypical (a) SDRs. NmrA and HSCARG like proteins. NmrA is a negative transcriptional regulator of various fungi, involved in the post-translational modulation of the GATA-type transcription factor AreA. NmrA lacks the canonical GXXGXXG NAD-binding motif and has altered residues at the catalytic triad, including a Met instead of the critical Tyr residue. NmrA may bind nucleotides but appears to lack any dehydrogenase activity. HSCARG has been identified as a putative NADP-sensing molecule, and redistributes and restructures in response to NADPH/NADP ratios. Like NmrA, it lacks most of the active site residues of the SDR family, but has an NAD(P)-binding motif similar to the extended SDR family, GXXGXXG. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Atypical SDRs are distinct from classical SDRs. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.20012e-62
NZ_CP012181.1\|WP_060574402.1\|1105298_1106507_-\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|173847	cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases. Short chain acyl-CoA dehydrogenase (SCAD). SCAD is a mitochondrial beta-oxidation enzyme. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of SCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. This subgroup also contains the eukaryotic short/branched chain acyl-CoA dehydrogenase(SBCAD), the bacterial butyryl-CoA dehydorgenase(BCAD) and 2-methylbutyryl-CoA dehydrogenase, which is involved in isoleucine catabolism. These enzymes are homotetramers.	5.60423e-115
NZ_CP012181.1\|WP_145984050.1\|1115738_1116191_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224759	COG1846, MarR, Transcriptional regulators [Transcription].	1.3627e-09
NZ_CP012181.1\|WP_060574398.1\|1102058_1103075_-\|lipase	gnl\|CDD\|224001	COG1075, LipA, Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only].	1.2377e-05
NZ_CP012181.1\|WP_060574399.1\|1103185_1103818_-\|dihydrofolate-reductase-family-protein	gnl\|CDD\|223340	COG0262, FolA, Dihydrofolate reductase [Coenzyme metabolism].	7.20585e-11
NZ_CP012181.1\|WP_010230048.1\|1112908_1114162_-\|acetamidase/formamidase-family-protein	gnl\|CDD\|376984	pfam03069, FmdA_AmdA, Acetamidase/Formamidase family. This family includes amidohydrolases of formamide EC:3.5.1.49 and acetamide. Methylophilus methylotrophus FmdA forms a homotrimer suggesting all the members of this family also do.	4.24081e-162
NZ_CP012181.1\|WP_060633622.1\|1112142_1112778_-\|AmiS/UreI-family-transporter	gnl\|CDD\|367022	pfam02293, AmiS_UreI, AmiS/UreI family transporter. This family includes UreI and proton gated urea channel as well as putative amide transporters.	4.30556e-58
NZ_CP012181.1\|WP_060574408.1\|1114589_1115675_-\|substrate-binding-domain-containing-protein	gnl\|CDD\|380581	cd06358, PBP1_NHase, type 1 periplasmic-binding protein of the nitrile hydratase (NHase) system that selectively converts nitriles to corresponding amides. This group includes the type 1 periplasmic-binding protein of the nitrile hydratase (NHase) system that selectively converts nitriles to corresponding amides, which are subsequently converted by amidases to yield free carboxylic acids and ammonia. NHases from bacteria and fungi have been purified and characterized. In Rhodococcus sp., the nitrile hydratase operon consists of six genes encoding NHase regulator 2, NHase regulator 1, amidase, NHase alpha subunit, NHase beta subunit, and NHase activator. The operon produces a constitutive hydratase that has a broad substrate spectrum: aliphatic and aromatic nitriles, mononitriles and dinitriles, hydroxynitriles and amino-nitriles, and a constitutive amidase of equally low substrate specificity. NHases are metalloenzymes containing either cobalt or iron, and therefore can be classified into two subgroups: ferric NHases and cobalt NHases.	1.48995e-166
NZ_CP012181.1\|WP_075302211.1\|1101095_1102013_-\|dihydropteroate-synthase	gnl\|CDD\|273657	TIGR01496, Dihydropteroate_synthase, dihydropteroate synthase. This model represents dihydropteroate synthase, the enzyme that catalyzes the second to last step in folic acid biosynthesis. The gene is usually designated folP (folic acid biosynthsis) or sul (sulfanilamide resistance). This model represents one branch of the family of pterin-binding enzymes (pfam00809) and of a cluster of dihydropteroate synthase and related enzymes (COG0294). Other members of pfam00809 and COG0294 are represented by model TIGR00284. [Biosynthesis of cofactors, prosthetic groups, and carriers, Folic acid].	5.46316e-85
NZ_CP012181.1\|WP_060574403.1\|1106538_1107069_-\|SCP2-sterol-binding-domain-containing-protein	gnl\|CDD\|376720	pfam02036, SCP2, SCP-2 sterol transfer family. This domain is involved in binding sterols. It is found in the SCP2 protein, as well as the C-terminus of the enzyme estradiol 17 beta-dehydrogenase EC:1.1.1.62. The UNC-24 protein contains an SPFH domain pfam01145.	6.76742e-14
NZ_CP012181.1\|WP_010230043.1\|1111656_1112121_+\|STAS-domain-containing-protein	gnl\|CDD\|132914	cd07043, STAS_anti-anti-sigma_factors, Sulphate Transporter and Anti-Sigma factor antagonist) domain of anti-anti-sigma factors, key regulators of anti-sigma factors by phosphorylation. Anti-anti-sigma factors play an important role in the regulation of several sigma factors and their corresponding anti-sigma factors. Upon dephosphorylation they bind the anti-sigma factor and induce the release of the sigma factor from the anti-sigma factor. In a feedback mechanism the anti-anti-sigma factor can be inactivated via phosphorylation by the anti-sigma factor. Well studied examples from Bacillus subtilis are SpoIIAA (regulating sigmaF and sigmaC which play an important role in sporulation) and RsbV (regulating sigmaB involved in the general stress response). The STAS domain is also found in the C- terminal region of sulphate transporters and stressosomes.	1.77592e-15
NZ_CP012181.1\|WP_082399221.1\|1110741_1111464_-\|deoxyribose-phosphate-aldolase	gnl\|CDD\|234784	PRK00507, PRK00507, deoxyribose-phosphate aldolase; Provisional.	1.44852e-99
NZ_CP012181.1\|WP_060574404.1\|1107169_1107808_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.81713e-17
NZ_CP012181.1\|WP_029239192.1\|1108583_1109192_-\|DsbA-family-protein	gnl\|CDD\|376526	pfam01323, DSBA, DSBA-like thioredoxin domain. This family contains a diverse set of proteins with a thioredoxin-like structure pfam00085. This family also includes 2-hydroxychromene-2-carboxylate (HCCA) isomerase enzymes catalyze one step in prokaryotic polyaromatic hydrocarbon (PAH) catabolic pathways. This family also contains members with functions other than HCCA isomerisation, such as Kappa family GSTs, whose similarity to HCCA isomerases was not previously recognized. Some members have been annotated as dioxygenases, dehydrogenases, or putative glycerol-3-phosphate transfer proteins, but are most likely HCCA isomerase enzymes.	3.75941e-07
NZ_CP012181.1\|WP_060574410.1\|1116220_1116919_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	2.64281e-31
NZ_CP012181.1\|WP_010230050.1\|1114225_1114513_-\|zinc-ribbon-domain-containing-protein	gnl\|CDD\|197903	smart00834, CxxC_CXXC_SSSS, Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.	2.23076e-06
NZ_CP012181.1\|WP_060576381.1\|1117090_1119928_+\|FAD-binding-oxidoreductase	gnl\|CDD\|223354	COG0277, GlcD, FAD/FMN-containing dehydrogenases [Energy production and conversion].	1.88716e-70
NZ_CP012181.1\|WP_060574401.1\|1104922_1105279_+\|MerR-family-transcriptional-regulator	gnl\|CDD\|133388	cd01282, HTH_MerR-like_sg3, Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 3). Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	6.26879e-38

>NZ_CP012181.1|WP_029239192.1|1108583_1109192_-|DsbA-family-protein
MTTRVDLFVDPVCPFAWIAFRWLTEEVVPARDVDLRVRLMSLAVLNEGREGHTPEHEKGGDSAWRPVRAGTALRRERGEPGVREFVRAFGDRYHQERVRPRDAALRAALDDVGAAGLHRFADDPAHDDEVRAEHAAGQEPVGDDVGTPVLHVEGVAFFGPVLGAVPRGQESLDAFDGAVLLARNPMFYELKRTRSGGIDLAS
>NZ_CP012181.1|WP_060574405.1|1108140_1108515_+|hypothetical-protein
MRQTVRTLTATALAVPMTLGVAGMAFADDTSEQNQTSDATASSGQAAGTDQDNTSLAPVTQANPAVNATDVLGLGAVANEDSDTGTEQSIVQDNGIDSANEQDNAARTDQAQKTVVEQIVGLAG
>NZ_CP012181.1|WP_060574404.1|1107169_1107808_+|TetR/AcrR-family-transcriptional-regulator
MTSPPGSRRRRLPPEQREKQVLDAAVRVFSRSGFHDASMDAVAEQAGVSKPMVYTHGGGSKEELLRRCIRRESERLLGSVSDAAGGPAADAEERLRRGLRAFFTTVTTHRDGWAVLYRQARTGVFADEVHEARSRIVGRIAELLAAELAIPAGADPAAVAGPVAAALTGAAEGLADWAGTAGTPGAEDPDALAETLTTLIWPGLERIRDTLT
>NZ_CP012181.1|WP_060574403.1|1106538_1107069_-|SCP2-sterol-binding-domain-containing-protein
MAETVDINELGRSVDPKSLSDEELLSTLGTALRDGDPKDVDPSIFARLVKSASKQQLATVMSSDIRRPVLEAIFGRMSEFYSSKGAGGNRQVVHWHIKDGATVDSFKTVLHEGTCTVTHGTDEDPRTALTMPGTEFLKVATNNANPVTLFMMRKLKVEGDVGFATALQKMFQIPSA
>NZ_CP012181.1|WP_060574402.1|1105298_1106507_-|acyl-CoA-dehydrogenase-family-protein
MTSFELSEEHRELQEWVHGFAADVVRPAAAEWDEREETPWPILQEAAKIELYNFETLASFWGDETGLSMPLVNEELFWGDGGIGMAIFGTTLAVAGIFASGTPDQMVEFIPQCYGDASDPKVGAFCSSEPDAGSDVSAMRTRAVYDEARDEWTLTGQKAWATNGGIANIHVVQAVVDPDLGSKGQAAFVVPPGTPGLESTRKIKKMGLRASHTADVFLDEVKLPGSCLLGGKEKLDERLARAREGARSTGSAAMQTFELSRPTVGSQAVGIARAAYEYALEYAKDRVAFGRPIIENQSISFMLADMKTEIDAARLLVHRAAWMGRNGVPFTAGEGSMSKLKAGRVAVWSTERAIQILGGAGYSREHPVERMHRDSKIYDIFEGTEQIQQLVIARAISGKHLA
>NZ_CP012181.1|WP_060574401.1|1104922_1105279_+|MerR-family-transcriptional-regulator
MRIGEVAARAGVSVRSLRYYEEQGLLRSTRNPGGQRRYPDGAVDRVGLIQQLYASGLPSRAVREILPFADSGEVSPELLDLLVAERDRLDRRLAELQDVRDRLDRCIGEAHGQVPRDH
>NZ_CP012181.1|WP_060574400.1|1103881_1104778_-|NmrA/HSCARG-family-protein
MDRTVAVLGATGQQGGAVAAALLDDGWRVRAVVRDPSTDRARSLAAAGAETVRGDLDDPGSLRAAFAGAHGVFSVQPNSGQAGATVTDEDEVRFGTTVADVAEGCGVVHLVHSSTVAVGPTPTGVPHLDTKSRIEARVRELGIATTIVRPATFLELLVAPGAGLDRGRMSFLTTPDRVVQVIAVRDIGRIVAGVFGAADRYAGRTLDIAGDAVTGRVLAEHLTRAAGRPIGYSRLPDAVLEQDAVLGRLAALFEDGRLAGHADLDALRAEFPSLLRVDDWLAGPGAPLLAEALGPAVR
>NZ_CP012181.1|WP_060574399.1|1103185_1103818_-|dihydrofolate-reductase-family-protein
MSLVRVHNFAVSLDGFGTGEGRTREEPFGHAGQRLHQWMFAIRWWGAGGGSGVDDAFVQRFDDGIGAEIMGAGKYGFPGWHADPEWRGHWGPNPPFHTPVHVLTRHTRPSLEMEGGTTFHFLDATPAEALAAARESAGGKDVRIGGGATVVRDFVAAGLVDHLHVVVVPILLGRGVRLWDGLEGIERDYAVEATSSPAGVTHLTFTRTRH
>NZ_CP012181.1|WP_060574398.1|1102058_1103075_-|lipase
MIRTTTSARSVLLALAAAGACLLGAAGVAVASPGDDGTTGPELTAPGVGEDLTCFGDLSDDTAGAPVLLVPGTTLDPDVNFDWNYARAFAAEGRSYCWVELPRHATGDIQVAAEHVVDAVRTMHDESGDRIAVVGFSQGGMVPRWALKYWPDTRGMVSDMIGIDPSNHGTLDAYPVCAPGCVPAFHQQQTGSQFLGALNDGPETFAGIDYTVVYTVTDEVVVPNLPPAASSELRGGEGATANIPVQRICPAHVAEHLIMGSTDPVGYAVVADALEHDGPASADRIDRATCLQAVMPAVDPVALPVNEARLLGQVGTSIATEPRTVAEEPLRDYARDDA
>NZ_CP012181.1|WP_075302211.1|1101095_1102013_-|dihydropteroate-synthase
MGHEPGPTGPAVLRGGPVPSLTFRGRTWNRDRAMVMAIVNRTPDSFYDHGVTFAEQAARDRITAVVREGADVIDIGGVPASPGTEVTEQEEIDRVVPTVEWARREFPDVVISVDTFRAGPAEAVCAAGADLVNDNWAAADGGILDVAARYGAGYVSAHTDHVTPRTEPHRPRYADVLGTVVTQTVALAEKAVAAGVPAGGILIDPAIDFSKNTLHSLQVLRGIEEMVATGWPVLLAMSNKTVVGESLAVPLEERLTGTLAATAIAADRGVAMVRAHQARATRETCEMVATVRGERRPSRAVRLLA
>NZ_CP012181.1|WP_082399221.1|1110741_1111464_-|deoxyribose-phosphate-aldolase
MPAPTLTATEIAGMIDHAILRPELTRPDVDAQLDVAARYRIFSVCVRPSDVAHAAARLAGTGVAVGTVIGFPHGTTSTAAKVAESAQAVTDGAAELDMVVNVGRLRSGLLDDVEADVRAVVEAAGGRVVKVILETALLSDDEIEAGCRAAERAGAAFVKTSTGFAGGGATAEHVALMRRTVGPQVQVKASGGVRDLDTVLAFHAAGVTRFGTSGTATILDDAAARESGATGGARVDDTSY
>NZ_CP012181.1|WP_010230043.1|1111656_1112121_+|STAS-domain-containing-protein
MVDDEQHLPVPEPAEEIGPALRFERSHHPSGATVLHAIGAVDDETSPDLWVELGMWSEESSDLVLDLSGVDFLGTAGLTSLLEARDVIGGEGKRLRVACGTSRAARRALQVTGAMELFDVVDRMPEAPAASAGMLFAVPAPDVRLDGMPRRDDA
>NZ_CP012181.1|WP_060633622.1|1112142_1112778_-|AmiS/UreI-family-transporter
MASVGLLFVGAVLFINGVMLLGWVDAKSAAPMNFFVGGLQIITPTYLIFTANGDADVILAASGLYLFSFTYLYVALNLTLNLDGTGLGYFCLFVFISALVFSWLNFTRFADPGFGVIWLYWAFLWLLFFLLLGLKQEQLGRYTGAVCAIQGWVTGWLPALLLLTGAYDALTGTLAVVLAVFGVVVFGALFPLLGRRRSGGAVAASDPAVPA
>NZ_CP012181.1|WP_010230048.1|1112908_1114162_-|acetamidase/formamidase-family-protein
MPEVVFPLDSRKKFTDQQIVGHNRWHPDVPAQVRVRPGDSFRVDCREWFDGAIHNDDSADDILNAPLASVHVLSGPIHVEGVQPGDLLIVDILDVGPIPQEDSGPLAGQGWGYTGVFATRNGGGFLTEQFPDAYKVIWDFQGGVATSRHVPQVSFTGIVHPGLMGTAPSRELLGTWNAREQALIDTDPQRVPPLALPPNPDSAILGSLSGADLDRAAAEAARTAPPRENGGNQDIKNLTKGSRVFYPVFVDGAKLSMGDLHFSQGDGEITFCGAIEMGGFMDLHVDVIKGGMDKYGVSENAIFMPGRTDPQYSEWLAFSGTSVTLGGEQRYLDSHLSYQRACLHAIDYLQQFGYSDIQAYMILGAAPIEGRLSGVVDIPNSCSTVYIPTEIFGFDVRPGKDGPTRIDPGQGVPVSRA
>NZ_CP012181.1|WP_010230050.1|1114225_1114513_-|zinc-ribbon-domain-containing-protein
MATYTYRCADDGPVDVRRPIGTAPETVACPACGQPCPRVVTAPMLGLADRARTSVIDRAERSRTEPDVVTSLPGRGTRVRPSAVPDPRTRGLPRP
>NZ_CP012181.1|WP_060574408.1|1114589_1115675_-|substrate-binding-domain-containing-protein
MGAPRLSLPPERRRDAITMALVVPLQGPAGIFGPSCESCGTLAAEEINASGGVLGRELRLLPVDGGAAPADVAREVDALIRAGSVDAVTGWHISAVREAVAPAIDGRVPYAYTALYEGGERRPGVFLTGETPDLQLGPTLDWFAETVGVRRWTIVGDDYVWPRRSADEARRYLRRIGGTVCDEMYVPLGTTRFDTVLRRVDRSGCEAVLMLLIGNDAVEFNRAFAAAGMDRDILRFSSLIDENVLLASGADNTRGLMTSAGYFEDLATASGLDFAAAHARRFGPEAPVLNSLGESCYEGVLLLTSLMRRAGSADVGPMTAVSDGLSYESPRGTVEVRDRHLQQRVFLAAADGLTWDVIQQL
>NZ_CP012181.1|WP_145984050.1|1115738_1116191_+|winged-helix-turn-helix-transcriptional-regulator
MSHPDPAETLRLLSMAKREASHRMEEALRAVGADIDRWRVLSLLVARGGCPMNVVAEHALLLAPKCSKLVDRMVAANLVLRRPDDLDRRRVLIFASARGREALTRWDAAVDEVGAQLAELLGEDAAVLDAVLRRLASGARSDPAASRTAG
>NZ_CP012181.1|WP_060574410.1|1116220_1116919_-|GntR-family-transcriptional-regulator
MVARVTVTSVVDAIADDLRGSVLTGELAPGTSLTEAEVAGRYEVARATAKAAIERLVAESVLERSTHKTARVVRLGPDDVRDIYLSRAILEAEVLRRLARAGTPVPEEARSANAEIRRRWDAAGFDVVEPDMRFHTALVDAAGNARTSRMYRSLTSEVTLCMAQVQGRELLSPEIIIAEHERILDLVGAGEGDAAAALLDEHLARARELLAGALGGTPGPEAAQPGPLSPGR
>NZ_CP012181.1|WP_060576381.1|1117090_1119928_+|FAD-binding-oxidoreductase
MLAGLHGCVADPGQVRDGELARHVGAHDASHFHLLPTAVVAPRGGAEVGRLLALAHRHGVPLTFRSGGTSLSGQGVTDQLLVDTRRHFRDVEILDDGLRVRVQPGVTVRQLNARLARHGRRFGPDPASEAACTVGGVLANNASGMACGTVENSYRTLESVVAVLPSGTVVDTSGPDADERLRALEPDLHKGLLVLRDRVLANPSSVATIGRQFAMKNTMGYGLNALVDHAGPAEILTHLLVGSEGTLAFVASATFRTVPLRTRISSALLVFDDLFAANAALPELVATGAATLELMDATSLRVGQSFADCPPEVARIAVREQAALLVEYQELADDELAERVAAAGRTLAGLPTAEPVELSTDPAVRGPLWKLRKGLYSSVAGARPQGSTALLEDVVVPVPALAGTCRDLAVLFDRYAYRDSVVFGHAKDGNIHFMLTDRFETDEQLGRYRDFTEEMVDLVLGHGGSLKAEHGTGRVMAPYVRRQYGDELYDVMREIKRLFDPHGVLNPGVVLSDDPDLHLKHIKLSPVVDAEVDRCTSCGFCEPVCPSRDLTLTPRQRIAARRAIREAELTGDTALAGRLEAEQDYESVQTCAVDGMCQTACPVLINTGDLVKKLRRDDRSRVDSTAWTTAAKHWSTATRGGSAALTTLAKAPAPARAGVTAANRAARAVAGTDRVPLWSGELPGGGPRRRRPAPAAVPAAVYLPACVNTLFGPAGDGPGVQASVEALCAAAGITLLVPPGIDALCCGTPWSSKGLPDGYAAMRERVVPAVLAATRGGELPVVGDASSCTEGFHTMLADAGVRVVDAMRFVVDEVLPRLGEHPRVASVSVHPTCSSARLQLDPALLTLAAEVADDVHVPDSWGCCAFAGDRGMLHPELTASATAGEAAEVRERDAAAHVSCNRTCELGMTRATGRPYEHVLELLARQVGVSAQPAGPSGGSAPRSR
>NZ_CP012181.1|WP_060574411.1|1119882_1120119_-|hypothetical-protein
MAAEGTTDDPDDERARSEAELGAAVEDALEPELKRRRALFVQRYLGLDRGEGVGRAEAHWDDPPYRDLGADPPDGPAG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP012181_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012181_1

1109570-1109714

Orphan

Consensus_repeat	Method
CAGCTCGCGCAACGGGTCCACGGC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP012181_1

>merge|NZ_CP012181|1|1109570-1109714|CRISPRCasFinder
CAGCTCGCGCAGCGGTTCCACGGCGCCCGCGAGTGCGGCCAGGTCCTCCCGGGTGCGCGCCAGTTCGCGCAGCGGCGGTACCGCGCCGGCCAGCTCACCGAGGTCCGCACGGGCCCCGGCCAGCTCCTGCAGCGGTCCGACGGCC

>NZ_CP012181|1|1|1109570-1109714|CRISPRCasFinder
CAGCTCGCGCAGCGGTTCCACGGC	GCCCGCGAGTGCGGCCAGGTCCTCCCGGGTGCGCGC
CAGTTCGCGCAGCGGCGGTACCGC	GCCGGCCAGCTCACCGAGGTCCGCACGGGCCCCGGC
CAGCTCCTGCAGCGGTCCGACGGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012181.1\|WP_060574400.1\|1103881_1104778_-\|NmrA/HSCARG-family-protein	unknown	unknown	gnl\|CDD\|187561
NZ_CP012181.1\|WP_060574402.1\|1105298_1106507_-\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|173847
NZ_CP012181.1\|WP_145984050.1\|1115738_1116191_+\|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224759
NZ_CP012181.1\|WP_060574398.1\|1102058_1103075_-\|lipase	unknown	unknown	gnl\|CDD\|224001
NZ_CP012181.1\|WP_060574399.1\|1103185_1103818_-\|dihydrofolate-reductase-family-protein	unknown	unknown	gnl\|CDD\|223340
NZ_CP012181.1\|WP_010230048.1\|1112908_1114162_-\|acetamidase/formamidase-family-protein	unknown	unknown	gnl\|CDD\|376984
NZ_CP012181.1\|WP_060633622.1\|1112142_1112778_-\|AmiS/UreI-family-transporter	unknown	unknown	gnl\|CDD\|367022
NZ_CP012181.1\|WP_060574408.1\|1114589_1115675_-\|substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|380581
NZ_CP012181.1\|WP_075302211.1\|1101095_1102013_-\|dihydropteroate-synthase	unknown	unknown	gnl\|CDD\|273657
NZ_CP012181.1\|WP_060574403.1\|1106538_1107069_-\|SCP2-sterol-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|376720
NZ_CP012181.1\|WP_010230043.1\|1111656_1112121_+\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|132914
NZ_CP012181.1\|WP_082399221.1\|1110741_1111464_-\|deoxyribose-phosphate-aldolase	unknown	unknown	gnl\|CDD\|234784
NZ_CP012181.1\|WP_060574404.1\|1107169_1107808_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP012181.1\|WP_029239192.1\|1108583_1109192_-\|DsbA-family-protein	unknown	unknown	gnl\|CDD\|376526
NZ_CP012181.1\|WP_060574410.1\|1116220_1116919_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_CP012181.1\|WP_060576381.1\|1117090_1119928_+\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223354
NZ_CP012181.1\|WP_010230050.1\|1114225_1114513_-\|zinc-ribbon-domain-containing-protein	unknown	unknown	gnl\|CDD\|197903
NZ_CP012181.1\|WP_060574411.1\|1119882_1120119_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012181.1\|WP_060574405.1\|1108140_1108515_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012181.1\|WP_060574401.1\|1104922_1105279_+\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133388

Protein	Function_ID	Function_description	E-value
NZ_CP012181.1\|WP_060574400.1\|1103881_1104778_-\|NmrA/HSCARG-family-protein	gnl\|CDD\|187561	cd05251, NmrA_like_SDR_a, NmrA (a transcriptional regulator) and HSCARG (an NADPH sensor) like proteins, atypical (a) SDRs. NmrA and HSCARG like proteins. NmrA is a negative transcriptional regulator of various fungi, involved in the post-translational modulation of the GATA-type transcription factor AreA. NmrA lacks the canonical GXXGXXG NAD-binding motif and has altered residues at the catalytic triad, including a Met instead of the critical Tyr residue. NmrA may bind nucleotides but appears to lack any dehydrogenase activity. HSCARG has been identified as a putative NADP-sensing molecule, and redistributes and restructures in response to NADPH/NADP ratios. Like NmrA, it lacks most of the active site residues of the SDR family, but has an NAD(P)-binding motif similar to the extended SDR family, GXXGXXG. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Atypical SDRs are distinct from classical SDRs. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.20012e-62
NZ_CP012181.1\|WP_060574402.1\|1105298_1106507_-\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|173847	cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases. Short chain acyl-CoA dehydrogenase (SCAD). SCAD is a mitochondrial beta-oxidation enzyme. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of SCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. This subgroup also contains the eukaryotic short/branched chain acyl-CoA dehydrogenase(SBCAD), the bacterial butyryl-CoA dehydorgenase(BCAD) and 2-methylbutyryl-CoA dehydrogenase, which is involved in isoleucine catabolism. These enzymes are homotetramers.	5.60423e-115
NZ_CP012181.1\|WP_145984050.1\|1115738_1116191_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224759	COG1846, MarR, Transcriptional regulators [Transcription].	1.3627e-09
NZ_CP012181.1\|WP_060574398.1\|1102058_1103075_-\|lipase	gnl\|CDD\|224001	COG1075, LipA, Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only].	1.2377e-05
NZ_CP012181.1\|WP_060574399.1\|1103185_1103818_-\|dihydrofolate-reductase-family-protein	gnl\|CDD\|223340	COG0262, FolA, Dihydrofolate reductase [Coenzyme metabolism].	7.20585e-11
NZ_CP012181.1\|WP_010230048.1\|1112908_1114162_-\|acetamidase/formamidase-family-protein	gnl\|CDD\|376984	pfam03069, FmdA_AmdA, Acetamidase/Formamidase family. This family includes amidohydrolases of formamide EC:3.5.1.49 and acetamide. Methylophilus methylotrophus FmdA forms a homotrimer suggesting all the members of this family also do.	4.24081e-162
NZ_CP012181.1\|WP_060633622.1\|1112142_1112778_-\|AmiS/UreI-family-transporter	gnl\|CDD\|367022	pfam02293, AmiS_UreI, AmiS/UreI family transporter. This family includes UreI and proton gated urea channel as well as putative amide transporters.	4.30556e-58
NZ_CP012181.1\|WP_060574408.1\|1114589_1115675_-\|substrate-binding-domain-containing-protein	gnl\|CDD\|380581	cd06358, PBP1_NHase, type 1 periplasmic-binding protein of the nitrile hydratase (NHase) system that selectively converts nitriles to corresponding amides. This group includes the type 1 periplasmic-binding protein of the nitrile hydratase (NHase) system that selectively converts nitriles to corresponding amides, which are subsequently converted by amidases to yield free carboxylic acids and ammonia. NHases from bacteria and fungi have been purified and characterized. In Rhodococcus sp., the nitrile hydratase operon consists of six genes encoding NHase regulator 2, NHase regulator 1, amidase, NHase alpha subunit, NHase beta subunit, and NHase activator. The operon produces a constitutive hydratase that has a broad substrate spectrum: aliphatic and aromatic nitriles, mononitriles and dinitriles, hydroxynitriles and amino-nitriles, and a constitutive amidase of equally low substrate specificity. NHases are metalloenzymes containing either cobalt or iron, and therefore can be classified into two subgroups: ferric NHases and cobalt NHases.	1.48995e-166
NZ_CP012181.1\|WP_075302211.1\|1101095_1102013_-\|dihydropteroate-synthase	gnl\|CDD\|273657	TIGR01496, Dihydropteroate_synthase, dihydropteroate synthase. This model represents dihydropteroate synthase, the enzyme that catalyzes the second to last step in folic acid biosynthesis. The gene is usually designated folP (folic acid biosynthsis) or sul (sulfanilamide resistance). This model represents one branch of the family of pterin-binding enzymes (pfam00809) and of a cluster of dihydropteroate synthase and related enzymes (COG0294). Other members of pfam00809 and COG0294 are represented by model TIGR00284. [Biosynthesis of cofactors, prosthetic groups, and carriers, Folic acid].	5.46316e-85
NZ_CP012181.1\|WP_060574403.1\|1106538_1107069_-\|SCP2-sterol-binding-domain-containing-protein	gnl\|CDD\|376720	pfam02036, SCP2, SCP-2 sterol transfer family. This domain is involved in binding sterols. It is found in the SCP2 protein, as well as the C-terminus of the enzyme estradiol 17 beta-dehydrogenase EC:1.1.1.62. The UNC-24 protein contains an SPFH domain pfam01145.	6.76742e-14
NZ_CP012181.1\|WP_010230043.1\|1111656_1112121_+\|STAS-domain-containing-protein	gnl\|CDD\|132914	cd07043, STAS_anti-anti-sigma_factors, Sulphate Transporter and Anti-Sigma factor antagonist) domain of anti-anti-sigma factors, key regulators of anti-sigma factors by phosphorylation. Anti-anti-sigma factors play an important role in the regulation of several sigma factors and their corresponding anti-sigma factors. Upon dephosphorylation they bind the anti-sigma factor and induce the release of the sigma factor from the anti-sigma factor. In a feedback mechanism the anti-anti-sigma factor can be inactivated via phosphorylation by the anti-sigma factor. Well studied examples from Bacillus subtilis are SpoIIAA (regulating sigmaF and sigmaC which play an important role in sporulation) and RsbV (regulating sigmaB involved in the general stress response). The STAS domain is also found in the C- terminal region of sulphate transporters and stressosomes.	1.77592e-15
NZ_CP012181.1\|WP_082399221.1\|1110741_1111464_-\|deoxyribose-phosphate-aldolase	gnl\|CDD\|234784	PRK00507, PRK00507, deoxyribose-phosphate aldolase; Provisional.	1.44852e-99
NZ_CP012181.1\|WP_060574404.1\|1107169_1107808_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.81713e-17
NZ_CP012181.1\|WP_029239192.1\|1108583_1109192_-\|DsbA-family-protein	gnl\|CDD\|376526	pfam01323, DSBA, DSBA-like thioredoxin domain. This family contains a diverse set of proteins with a thioredoxin-like structure pfam00085. This family also includes 2-hydroxychromene-2-carboxylate (HCCA) isomerase enzymes catalyze one step in prokaryotic polyaromatic hydrocarbon (PAH) catabolic pathways. This family also contains members with functions other than HCCA isomerisation, such as Kappa family GSTs, whose similarity to HCCA isomerases was not previously recognized. Some members have been annotated as dioxygenases, dehydrogenases, or putative glycerol-3-phosphate transfer proteins, but are most likely HCCA isomerase enzymes.	3.75941e-07
NZ_CP012181.1\|WP_060574410.1\|1116220_1116919_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	2.64281e-31
NZ_CP012181.1\|WP_010230050.1\|1114225_1114513_-\|zinc-ribbon-domain-containing-protein	gnl\|CDD\|197903	smart00834, CxxC_CXXC_SSSS, Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.	2.23076e-06
NZ_CP012181.1\|WP_060576381.1\|1117090_1119928_+\|FAD-binding-oxidoreductase	gnl\|CDD\|223354	COG0277, GlcD, FAD/FMN-containing dehydrogenases [Energy production and conversion].	1.88716e-70
NZ_CP012181.1\|WP_060574401.1\|1104922_1105279_+\|MerR-family-transcriptional-regulator	gnl\|CDD\|133388	cd01282, HTH_MerR-like_sg3, Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 3). Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	6.26879e-38

>NZ_CP012181.1|WP_029239192.1|1108583_1109192_-|DsbA-family-protein
MTTRVDLFVDPVCPFAWIAFRWLTEEVVPARDVDLRVRLMSLAVLNEGREGHTPEHEKGGDSAWRPVRAGTALRRERGEPGVREFVRAFGDRYHQERVRPRDAALRAALDDVGAAGLHRFADDPAHDDEVRAEHAAGQEPVGDDVGTPVLHVEGVAFFGPVLGAVPRGQESLDAFDGAVLLARNPMFYELKRTRSGGIDLAS
>NZ_CP012181.1|WP_060574405.1|1108140_1108515_+|hypothetical-protein
MRQTVRTLTATALAVPMTLGVAGMAFADDTSEQNQTSDATASSGQAAGTDQDNTSLAPVTQANPAVNATDVLGLGAVANEDSDTGTEQSIVQDNGIDSANEQDNAARTDQAQKTVVEQIVGLAG
>NZ_CP012181.1|WP_060574404.1|1107169_1107808_+|TetR/AcrR-family-transcriptional-regulator
MTSPPGSRRRRLPPEQREKQVLDAAVRVFSRSGFHDASMDAVAEQAGVSKPMVYTHGGGSKEELLRRCIRRESERLLGSVSDAAGGPAADAEERLRRGLRAFFTTVTTHRDGWAVLYRQARTGVFADEVHEARSRIVGRIAELLAAELAIPAGADPAAVAGPVAAALTGAAEGLADWAGTAGTPGAEDPDALAETLTTLIWPGLERIRDTLT
>NZ_CP012181.1|WP_060574403.1|1106538_1107069_-|SCP2-sterol-binding-domain-containing-protein
MAETVDINELGRSVDPKSLSDEELLSTLGTALRDGDPKDVDPSIFARLVKSASKQQLATVMSSDIRRPVLEAIFGRMSEFYSSKGAGGNRQVVHWHIKDGATVDSFKTVLHEGTCTVTHGTDEDPRTALTMPGTEFLKVATNNANPVTLFMMRKLKVEGDVGFATALQKMFQIPSA
>NZ_CP012181.1|WP_060574402.1|1105298_1106507_-|acyl-CoA-dehydrogenase-family-protein
MTSFELSEEHRELQEWVHGFAADVVRPAAAEWDEREETPWPILQEAAKIELYNFETLASFWGDETGLSMPLVNEELFWGDGGIGMAIFGTTLAVAGIFASGTPDQMVEFIPQCYGDASDPKVGAFCSSEPDAGSDVSAMRTRAVYDEARDEWTLTGQKAWATNGGIANIHVVQAVVDPDLGSKGQAAFVVPPGTPGLESTRKIKKMGLRASHTADVFLDEVKLPGSCLLGGKEKLDERLARAREGARSTGSAAMQTFELSRPTVGSQAVGIARAAYEYALEYAKDRVAFGRPIIENQSISFMLADMKTEIDAARLLVHRAAWMGRNGVPFTAGEGSMSKLKAGRVAVWSTERAIQILGGAGYSREHPVERMHRDSKIYDIFEGTEQIQQLVIARAISGKHLA
>NZ_CP012181.1|WP_060574401.1|1104922_1105279_+|MerR-family-transcriptional-regulator
MRIGEVAARAGVSVRSLRYYEEQGLLRSTRNPGGQRRYPDGAVDRVGLIQQLYASGLPSRAVREILPFADSGEVSPELLDLLVAERDRLDRRLAELQDVRDRLDRCIGEAHGQVPRDH
>NZ_CP012181.1|WP_060574400.1|1103881_1104778_-|NmrA/HSCARG-family-protein
MDRTVAVLGATGQQGGAVAAALLDDGWRVRAVVRDPSTDRARSLAAAGAETVRGDLDDPGSLRAAFAGAHGVFSVQPNSGQAGATVTDEDEVRFGTTVADVAEGCGVVHLVHSSTVAVGPTPTGVPHLDTKSRIEARVRELGIATTIVRPATFLELLVAPGAGLDRGRMSFLTTPDRVVQVIAVRDIGRIVAGVFGAADRYAGRTLDIAGDAVTGRVLAEHLTRAAGRPIGYSRLPDAVLEQDAVLGRLAALFEDGRLAGHADLDALRAEFPSLLRVDDWLAGPGAPLLAEALGPAVR
>NZ_CP012181.1|WP_060574399.1|1103185_1103818_-|dihydrofolate-reductase-family-protein
MSLVRVHNFAVSLDGFGTGEGRTREEPFGHAGQRLHQWMFAIRWWGAGGGSGVDDAFVQRFDDGIGAEIMGAGKYGFPGWHADPEWRGHWGPNPPFHTPVHVLTRHTRPSLEMEGGTTFHFLDATPAEALAAARESAGGKDVRIGGGATVVRDFVAAGLVDHLHVVVVPILLGRGVRLWDGLEGIERDYAVEATSSPAGVTHLTFTRTRH
>NZ_CP012181.1|WP_060574398.1|1102058_1103075_-|lipase
MIRTTTSARSVLLALAAAGACLLGAAGVAVASPGDDGTTGPELTAPGVGEDLTCFGDLSDDTAGAPVLLVPGTTLDPDVNFDWNYARAFAAEGRSYCWVELPRHATGDIQVAAEHVVDAVRTMHDESGDRIAVVGFSQGGMVPRWALKYWPDTRGMVSDMIGIDPSNHGTLDAYPVCAPGCVPAFHQQQTGSQFLGALNDGPETFAGIDYTVVYTVTDEVVVPNLPPAASSELRGGEGATANIPVQRICPAHVAEHLIMGSTDPVGYAVVADALEHDGPASADRIDRATCLQAVMPAVDPVALPVNEARLLGQVGTSIATEPRTVAEEPLRDYARDDA
>NZ_CP012181.1|WP_075302211.1|1101095_1102013_-|dihydropteroate-synthase
MGHEPGPTGPAVLRGGPVPSLTFRGRTWNRDRAMVMAIVNRTPDSFYDHGVTFAEQAARDRITAVVREGADVIDIGGVPASPGTEVTEQEEIDRVVPTVEWARREFPDVVISVDTFRAGPAEAVCAAGADLVNDNWAAADGGILDVAARYGAGYVSAHTDHVTPRTEPHRPRYADVLGTVVTQTVALAEKAVAAGVPAGGILIDPAIDFSKNTLHSLQVLRGIEEMVATGWPVLLAMSNKTVVGESLAVPLEERLTGTLAATAIAADRGVAMVRAHQARATRETCEMVATVRGERRPSRAVRLLA
>NZ_CP012181.1|WP_082399221.1|1110741_1111464_-|deoxyribose-phosphate-aldolase
MPAPTLTATEIAGMIDHAILRPELTRPDVDAQLDVAARYRIFSVCVRPSDVAHAAARLAGTGVAVGTVIGFPHGTTSTAAKVAESAQAVTDGAAELDMVVNVGRLRSGLLDDVEADVRAVVEAAGGRVVKVILETALLSDDEIEAGCRAAERAGAAFVKTSTGFAGGGATAEHVALMRRTVGPQVQVKASGGVRDLDTVLAFHAAGVTRFGTSGTATILDDAAARESGATGGARVDDTSY
>NZ_CP012181.1|WP_010230043.1|1111656_1112121_+|STAS-domain-containing-protein
MVDDEQHLPVPEPAEEIGPALRFERSHHPSGATVLHAIGAVDDETSPDLWVELGMWSEESSDLVLDLSGVDFLGTAGLTSLLEARDVIGGEGKRLRVACGTSRAARRALQVTGAMELFDVVDRMPEAPAASAGMLFAVPAPDVRLDGMPRRDDA
>NZ_CP012181.1|WP_060633622.1|1112142_1112778_-|AmiS/UreI-family-transporter
MASVGLLFVGAVLFINGVMLLGWVDAKSAAPMNFFVGGLQIITPTYLIFTANGDADVILAASGLYLFSFTYLYVALNLTLNLDGTGLGYFCLFVFISALVFSWLNFTRFADPGFGVIWLYWAFLWLLFFLLLGLKQEQLGRYTGAVCAIQGWVTGWLPALLLLTGAYDALTGTLAVVLAVFGVVVFGALFPLLGRRRSGGAVAASDPAVPA
>NZ_CP012181.1|WP_010230048.1|1112908_1114162_-|acetamidase/formamidase-family-protein
MPEVVFPLDSRKKFTDQQIVGHNRWHPDVPAQVRVRPGDSFRVDCREWFDGAIHNDDSADDILNAPLASVHVLSGPIHVEGVQPGDLLIVDILDVGPIPQEDSGPLAGQGWGYTGVFATRNGGGFLTEQFPDAYKVIWDFQGGVATSRHVPQVSFTGIVHPGLMGTAPSRELLGTWNAREQALIDTDPQRVPPLALPPNPDSAILGSLSGADLDRAAAEAARTAPPRENGGNQDIKNLTKGSRVFYPVFVDGAKLSMGDLHFSQGDGEITFCGAIEMGGFMDLHVDVIKGGMDKYGVSENAIFMPGRTDPQYSEWLAFSGTSVTLGGEQRYLDSHLSYQRACLHAIDYLQQFGYSDIQAYMILGAAPIEGRLSGVVDIPNSCSTVYIPTEIFGFDVRPGKDGPTRIDPGQGVPVSRA
>NZ_CP012181.1|WP_010230050.1|1114225_1114513_-|zinc-ribbon-domain-containing-protein
MATYTYRCADDGPVDVRRPIGTAPETVACPACGQPCPRVVTAPMLGLADRARTSVIDRAERSRTEPDVVTSLPGRGTRVRPSAVPDPRTRGLPRP
>NZ_CP012181.1|WP_060574408.1|1114589_1115675_-|substrate-binding-domain-containing-protein
MGAPRLSLPPERRRDAITMALVVPLQGPAGIFGPSCESCGTLAAEEINASGGVLGRELRLLPVDGGAAPADVAREVDALIRAGSVDAVTGWHISAVREAVAPAIDGRVPYAYTALYEGGERRPGVFLTGETPDLQLGPTLDWFAETVGVRRWTIVGDDYVWPRRSADEARRYLRRIGGTVCDEMYVPLGTTRFDTVLRRVDRSGCEAVLMLLIGNDAVEFNRAFAAAGMDRDILRFSSLIDENVLLASGADNTRGLMTSAGYFEDLATASGLDFAAAHARRFGPEAPVLNSLGESCYEGVLLLTSLMRRAGSADVGPMTAVSDGLSYESPRGTVEVRDRHLQQRVFLAAADGLTWDVIQQL
>NZ_CP012181.1|WP_145984050.1|1115738_1116191_+|winged-helix-turn-helix-transcriptional-regulator
MSHPDPAETLRLLSMAKREASHRMEEALRAVGADIDRWRVLSLLVARGGCPMNVVAEHALLLAPKCSKLVDRMVAANLVLRRPDDLDRRRVLIFASARGREALTRWDAAVDEVGAQLAELLGEDAAVLDAVLRRLASGARSDPAASRTAG
>NZ_CP012181.1|WP_060574410.1|1116220_1116919_-|GntR-family-transcriptional-regulator
MVARVTVTSVVDAIADDLRGSVLTGELAPGTSLTEAEVAGRYEVARATAKAAIERLVAESVLERSTHKTARVVRLGPDDVRDIYLSRAILEAEVLRRLARAGTPVPEEARSANAEIRRRWDAAGFDVVEPDMRFHTALVDAAGNARTSRMYRSLTSEVTLCMAQVQGRELLSPEIIIAEHERILDLVGAGEGDAAAALLDEHLARARELLAGALGGTPGPEAAQPGPLSPGR
>NZ_CP012181.1|WP_060576381.1|1117090_1119928_+|FAD-binding-oxidoreductase
MLAGLHGCVADPGQVRDGELARHVGAHDASHFHLLPTAVVAPRGGAEVGRLLALAHRHGVPLTFRSGGTSLSGQGVTDQLLVDTRRHFRDVEILDDGLRVRVQPGVTVRQLNARLARHGRRFGPDPASEAACTVGGVLANNASGMACGTVENSYRTLESVVAVLPSGTVVDTSGPDADERLRALEPDLHKGLLVLRDRVLANPSSVATIGRQFAMKNTMGYGLNALVDHAGPAEILTHLLVGSEGTLAFVASATFRTVPLRTRISSALLVFDDLFAANAALPELVATGAATLELMDATSLRVGQSFADCPPEVARIAVREQAALLVEYQELADDELAERVAAAGRTLAGLPTAEPVELSTDPAVRGPLWKLRKGLYSSVAGARPQGSTALLEDVVVPVPALAGTCRDLAVLFDRYAYRDSVVFGHAKDGNIHFMLTDRFETDEQLGRYRDFTEEMVDLVLGHGGSLKAEHGTGRVMAPYVRRQYGDELYDVMREIKRLFDPHGVLNPGVVLSDDPDLHLKHIKLSPVVDAEVDRCTSCGFCEPVCPSRDLTLTPRQRIAARRAIREAELTGDTALAGRLEAEQDYESVQTCAVDGMCQTACPVLINTGDLVKKLRRDDRSRVDSTAWTTAAKHWSTATRGGSAALTTLAKAPAPARAGVTAANRAARAVAGTDRVPLWSGELPGGGPRRRRPAPAAVPAAVYLPACVNTLFGPAGDGPGVQASVEALCAAAGITLLVPPGIDALCCGTPWSSKGLPDGYAAMRERVVPAVLAATRGGELPVVGDASSCTEGFHTMLADAGVRVVDAMRFVVDEVLPRLGEHPRVASVSVHPTCSSARLQLDPALLTLAAEVADDVHVPDSWGCCAFAGDRGMLHPELTASATAGEAAEVRERDAAAHVSCNRTCELGMTRATGRPYEHVLELLARQVGVSAQPAGPSGGSAPRSR
>NZ_CP012181.1|WP_060574411.1|1119882_1120119_-|hypothetical-protein
MAAEGTTDDPDDERARSEAELGAAVEDALEPELKRRRALFVQRYLGLDRGEGVGRAEAHWDDPPYRDLGADPPDGPAG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP012181_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012181_2

1109900-1110044

Orphan

Consensus_repeat	Method
CAGCTCGCGCAACGGGTCCACGGC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP012181_2

>merge|NZ_CP012181|2|1109900-1110044|CRISPRCasFinder
CAGCTCCCGCAACGGGTCCACGGCCGTGCTCAGCTCCCGCAGCGGTCCGGTCGCCGTGCTCAGCTCCCGCAACGGGTCCACGGCGGTGCCCAGCTCCCGGAGCGGTTCGACGGCGCCTGCCAGCTCCCGCAGGGGCTCGACGGCG

>NZ_CP012181|2|2|1109900-1110044|CRISPRCasFinder
CAGCTCCCGCAACGGGTCCACGGC	CGTGCTCAGCTCCCGCAGCGGTCCGGTCGCCGTGCT
CAGCTCCCGCAACGGGTCCACGGC	GGTGCCCAGCTCCCGGAGCGGTTCGACGGCGCCTGC
CAGCTCCCGCAGGGGCTCGACGGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012181.1\|WP_060574400.1\|1103881_1104778_-\|NmrA/HSCARG-family-protein	unknown	unknown	gnl\|CDD\|187561
NZ_CP012181.1\|WP_060574402.1\|1105298_1106507_-\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|173847
NZ_CP012181.1\|WP_145984050.1\|1115738_1116191_+\|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224759
NZ_CP012181.1\|WP_060574398.1\|1102058_1103075_-\|lipase	unknown	unknown	gnl\|CDD\|224001
NZ_CP012181.1\|WP_060574399.1\|1103185_1103818_-\|dihydrofolate-reductase-family-protein	unknown	unknown	gnl\|CDD\|223340
NZ_CP012181.1\|WP_010230048.1\|1112908_1114162_-\|acetamidase/formamidase-family-protein	unknown	unknown	gnl\|CDD\|376984
NZ_CP012181.1\|WP_060633622.1\|1112142_1112778_-\|AmiS/UreI-family-transporter	unknown	unknown	gnl\|CDD\|367022
NZ_CP012181.1\|WP_060574408.1\|1114589_1115675_-\|substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|380581
NZ_CP012181.1\|WP_075302211.1\|1101095_1102013_-\|dihydropteroate-synthase	unknown	unknown	gnl\|CDD\|273657
NZ_CP012181.1\|WP_060574403.1\|1106538_1107069_-\|SCP2-sterol-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|376720
NZ_CP012181.1\|WP_010230043.1\|1111656_1112121_+\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|132914
NZ_CP012181.1\|WP_082399221.1\|1110741_1111464_-\|deoxyribose-phosphate-aldolase	unknown	unknown	gnl\|CDD\|234784
NZ_CP012181.1\|WP_060574404.1\|1107169_1107808_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP012181.1\|WP_029239192.1\|1108583_1109192_-\|DsbA-family-protein	unknown	unknown	gnl\|CDD\|376526
NZ_CP012181.1\|WP_060574410.1\|1116220_1116919_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_CP012181.1\|WP_060576381.1\|1117090_1119928_+\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223354
NZ_CP012181.1\|WP_010230050.1\|1114225_1114513_-\|zinc-ribbon-domain-containing-protein	unknown	unknown	gnl\|CDD\|197903
NZ_CP012181.1\|WP_060574411.1\|1119882_1120119_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012181.1\|WP_060574405.1\|1108140_1108515_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012181.1\|WP_060574401.1\|1104922_1105279_+\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133388

Protein	Function_ID	Function_description	E-value
NZ_CP012181.1\|WP_060574400.1\|1103881_1104778_-\|NmrA/HSCARG-family-protein	gnl\|CDD\|187561	cd05251, NmrA_like_SDR_a, NmrA (a transcriptional regulator) and HSCARG (an NADPH sensor) like proteins, atypical (a) SDRs. NmrA and HSCARG like proteins. NmrA is a negative transcriptional regulator of various fungi, involved in the post-translational modulation of the GATA-type transcription factor AreA. NmrA lacks the canonical GXXGXXG NAD-binding motif and has altered residues at the catalytic triad, including a Met instead of the critical Tyr residue. NmrA may bind nucleotides but appears to lack any dehydrogenase activity. HSCARG has been identified as a putative NADP-sensing molecule, and redistributes and restructures in response to NADPH/NADP ratios. Like NmrA, it lacks most of the active site residues of the SDR family, but has an NAD(P)-binding motif similar to the extended SDR family, GXXGXXG. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Atypical SDRs are distinct from classical SDRs. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.20012e-62
NZ_CP012181.1\|WP_060574402.1\|1105298_1106507_-\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|173847	cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases. Short chain acyl-CoA dehydrogenase (SCAD). SCAD is a mitochondrial beta-oxidation enzyme. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of SCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. This subgroup also contains the eukaryotic short/branched chain acyl-CoA dehydrogenase(SBCAD), the bacterial butyryl-CoA dehydorgenase(BCAD) and 2-methylbutyryl-CoA dehydrogenase, which is involved in isoleucine catabolism. These enzymes are homotetramers.	5.60423e-115
NZ_CP012181.1\|WP_145984050.1\|1115738_1116191_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224759	COG1846, MarR, Transcriptional regulators [Transcription].	1.3627e-09
NZ_CP012181.1\|WP_060574398.1\|1102058_1103075_-\|lipase	gnl\|CDD\|224001	COG1075, LipA, Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only].	1.2377e-05
NZ_CP012181.1\|WP_060574399.1\|1103185_1103818_-\|dihydrofolate-reductase-family-protein	gnl\|CDD\|223340	COG0262, FolA, Dihydrofolate reductase [Coenzyme metabolism].	7.20585e-11
NZ_CP012181.1\|WP_010230048.1\|1112908_1114162_-\|acetamidase/formamidase-family-protein	gnl\|CDD\|376984	pfam03069, FmdA_AmdA, Acetamidase/Formamidase family. This family includes amidohydrolases of formamide EC:3.5.1.49 and acetamide. Methylophilus methylotrophus FmdA forms a homotrimer suggesting all the members of this family also do.	4.24081e-162
NZ_CP012181.1\|WP_060633622.1\|1112142_1112778_-\|AmiS/UreI-family-transporter	gnl\|CDD\|367022	pfam02293, AmiS_UreI, AmiS/UreI family transporter. This family includes UreI and proton gated urea channel as well as putative amide transporters.	4.30556e-58
NZ_CP012181.1\|WP_060574408.1\|1114589_1115675_-\|substrate-binding-domain-containing-protein	gnl\|CDD\|380581	cd06358, PBP1_NHase, type 1 periplasmic-binding protein of the nitrile hydratase (NHase) system that selectively converts nitriles to corresponding amides. This group includes the type 1 periplasmic-binding protein of the nitrile hydratase (NHase) system that selectively converts nitriles to corresponding amides, which are subsequently converted by amidases to yield free carboxylic acids and ammonia. NHases from bacteria and fungi have been purified and characterized. In Rhodococcus sp., the nitrile hydratase operon consists of six genes encoding NHase regulator 2, NHase regulator 1, amidase, NHase alpha subunit, NHase beta subunit, and NHase activator. The operon produces a constitutive hydratase that has a broad substrate spectrum: aliphatic and aromatic nitriles, mononitriles and dinitriles, hydroxynitriles and amino-nitriles, and a constitutive amidase of equally low substrate specificity. NHases are metalloenzymes containing either cobalt or iron, and therefore can be classified into two subgroups: ferric NHases and cobalt NHases.	1.48995e-166
NZ_CP012181.1\|WP_075302211.1\|1101095_1102013_-\|dihydropteroate-synthase	gnl\|CDD\|273657	TIGR01496, Dihydropteroate_synthase, dihydropteroate synthase. This model represents dihydropteroate synthase, the enzyme that catalyzes the second to last step in folic acid biosynthesis. The gene is usually designated folP (folic acid biosynthsis) or sul (sulfanilamide resistance). This model represents one branch of the family of pterin-binding enzymes (pfam00809) and of a cluster of dihydropteroate synthase and related enzymes (COG0294). Other members of pfam00809 and COG0294 are represented by model TIGR00284. [Biosynthesis of cofactors, prosthetic groups, and carriers, Folic acid].	5.46316e-85
NZ_CP012181.1\|WP_060574403.1\|1106538_1107069_-\|SCP2-sterol-binding-domain-containing-protein	gnl\|CDD\|376720	pfam02036, SCP2, SCP-2 sterol transfer family. This domain is involved in binding sterols. It is found in the SCP2 protein, as well as the C-terminus of the enzyme estradiol 17 beta-dehydrogenase EC:1.1.1.62. The UNC-24 protein contains an SPFH domain pfam01145.	6.76742e-14
NZ_CP012181.1\|WP_010230043.1\|1111656_1112121_+\|STAS-domain-containing-protein	gnl\|CDD\|132914	cd07043, STAS_anti-anti-sigma_factors, Sulphate Transporter and Anti-Sigma factor antagonist) domain of anti-anti-sigma factors, key regulators of anti-sigma factors by phosphorylation. Anti-anti-sigma factors play an important role in the regulation of several sigma factors and their corresponding anti-sigma factors. Upon dephosphorylation they bind the anti-sigma factor and induce the release of the sigma factor from the anti-sigma factor. In a feedback mechanism the anti-anti-sigma factor can be inactivated via phosphorylation by the anti-sigma factor. Well studied examples from Bacillus subtilis are SpoIIAA (regulating sigmaF and sigmaC which play an important role in sporulation) and RsbV (regulating sigmaB involved in the general stress response). The STAS domain is also found in the C- terminal region of sulphate transporters and stressosomes.	1.77592e-15
NZ_CP012181.1\|WP_082399221.1\|1110741_1111464_-\|deoxyribose-phosphate-aldolase	gnl\|CDD\|234784	PRK00507, PRK00507, deoxyribose-phosphate aldolase; Provisional.	1.44852e-99
NZ_CP012181.1\|WP_060574404.1\|1107169_1107808_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.81713e-17
NZ_CP012181.1\|WP_029239192.1\|1108583_1109192_-\|DsbA-family-protein	gnl\|CDD\|376526	pfam01323, DSBA, DSBA-like thioredoxin domain. This family contains a diverse set of proteins with a thioredoxin-like structure pfam00085. This family also includes 2-hydroxychromene-2-carboxylate (HCCA) isomerase enzymes catalyze one step in prokaryotic polyaromatic hydrocarbon (PAH) catabolic pathways. This family also contains members with functions other than HCCA isomerisation, such as Kappa family GSTs, whose similarity to HCCA isomerases was not previously recognized. Some members have been annotated as dioxygenases, dehydrogenases, or putative glycerol-3-phosphate transfer proteins, but are most likely HCCA isomerase enzymes.	3.75941e-07
NZ_CP012181.1\|WP_060574410.1\|1116220_1116919_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	2.64281e-31
NZ_CP012181.1\|WP_010230050.1\|1114225_1114513_-\|zinc-ribbon-domain-containing-protein	gnl\|CDD\|197903	smart00834, CxxC_CXXC_SSSS, Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.	2.23076e-06
NZ_CP012181.1\|WP_060576381.1\|1117090_1119928_+\|FAD-binding-oxidoreductase	gnl\|CDD\|223354	COG0277, GlcD, FAD/FMN-containing dehydrogenases [Energy production and conversion].	1.88716e-70
NZ_CP012181.1\|WP_060574401.1\|1104922_1105279_+\|MerR-family-transcriptional-regulator	gnl\|CDD\|133388	cd01282, HTH_MerR-like_sg3, Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 3). Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	6.26879e-38

>NZ_CP012181.1|WP_029239192.1|1108583_1109192_-|DsbA-family-protein
MTTRVDLFVDPVCPFAWIAFRWLTEEVVPARDVDLRVRLMSLAVLNEGREGHTPEHEKGGDSAWRPVRAGTALRRERGEPGVREFVRAFGDRYHQERVRPRDAALRAALDDVGAAGLHRFADDPAHDDEVRAEHAAGQEPVGDDVGTPVLHVEGVAFFGPVLGAVPRGQESLDAFDGAVLLARNPMFYELKRTRSGGIDLAS
>NZ_CP012181.1|WP_060574405.1|1108140_1108515_+|hypothetical-protein
MRQTVRTLTATALAVPMTLGVAGMAFADDTSEQNQTSDATASSGQAAGTDQDNTSLAPVTQANPAVNATDVLGLGAVANEDSDTGTEQSIVQDNGIDSANEQDNAARTDQAQKTVVEQIVGLAG
>NZ_CP012181.1|WP_060574404.1|1107169_1107808_+|TetR/AcrR-family-transcriptional-regulator
MTSPPGSRRRRLPPEQREKQVLDAAVRVFSRSGFHDASMDAVAEQAGVSKPMVYTHGGGSKEELLRRCIRRESERLLGSVSDAAGGPAADAEERLRRGLRAFFTTVTTHRDGWAVLYRQARTGVFADEVHEARSRIVGRIAELLAAELAIPAGADPAAVAGPVAAALTGAAEGLADWAGTAGTPGAEDPDALAETLTTLIWPGLERIRDTLT
>NZ_CP012181.1|WP_060574403.1|1106538_1107069_-|SCP2-sterol-binding-domain-containing-protein
MAETVDINELGRSVDPKSLSDEELLSTLGTALRDGDPKDVDPSIFARLVKSASKQQLATVMSSDIRRPVLEAIFGRMSEFYSSKGAGGNRQVVHWHIKDGATVDSFKTVLHEGTCTVTHGTDEDPRTALTMPGTEFLKVATNNANPVTLFMMRKLKVEGDVGFATALQKMFQIPSA
>NZ_CP012181.1|WP_060574402.1|1105298_1106507_-|acyl-CoA-dehydrogenase-family-protein
MTSFELSEEHRELQEWVHGFAADVVRPAAAEWDEREETPWPILQEAAKIELYNFETLASFWGDETGLSMPLVNEELFWGDGGIGMAIFGTTLAVAGIFASGTPDQMVEFIPQCYGDASDPKVGAFCSSEPDAGSDVSAMRTRAVYDEARDEWTLTGQKAWATNGGIANIHVVQAVVDPDLGSKGQAAFVVPPGTPGLESTRKIKKMGLRASHTADVFLDEVKLPGSCLLGGKEKLDERLARAREGARSTGSAAMQTFELSRPTVGSQAVGIARAAYEYALEYAKDRVAFGRPIIENQSISFMLADMKTEIDAARLLVHRAAWMGRNGVPFTAGEGSMSKLKAGRVAVWSTERAIQILGGAGYSREHPVERMHRDSKIYDIFEGTEQIQQLVIARAISGKHLA
>NZ_CP012181.1|WP_060574401.1|1104922_1105279_+|MerR-family-transcriptional-regulator
MRIGEVAARAGVSVRSLRYYEEQGLLRSTRNPGGQRRYPDGAVDRVGLIQQLYASGLPSRAVREILPFADSGEVSPELLDLLVAERDRLDRRLAELQDVRDRLDRCIGEAHGQVPRDH
>NZ_CP012181.1|WP_060574400.1|1103881_1104778_-|NmrA/HSCARG-family-protein
MDRTVAVLGATGQQGGAVAAALLDDGWRVRAVVRDPSTDRARSLAAAGAETVRGDLDDPGSLRAAFAGAHGVFSVQPNSGQAGATVTDEDEVRFGTTVADVAEGCGVVHLVHSSTVAVGPTPTGVPHLDTKSRIEARVRELGIATTIVRPATFLELLVAPGAGLDRGRMSFLTTPDRVVQVIAVRDIGRIVAGVFGAADRYAGRTLDIAGDAVTGRVLAEHLTRAAGRPIGYSRLPDAVLEQDAVLGRLAALFEDGRLAGHADLDALRAEFPSLLRVDDWLAGPGAPLLAEALGPAVR
>NZ_CP012181.1|WP_060574399.1|1103185_1103818_-|dihydrofolate-reductase-family-protein
MSLVRVHNFAVSLDGFGTGEGRTREEPFGHAGQRLHQWMFAIRWWGAGGGSGVDDAFVQRFDDGIGAEIMGAGKYGFPGWHADPEWRGHWGPNPPFHTPVHVLTRHTRPSLEMEGGTTFHFLDATPAEALAAARESAGGKDVRIGGGATVVRDFVAAGLVDHLHVVVVPILLGRGVRLWDGLEGIERDYAVEATSSPAGVTHLTFTRTRH
>NZ_CP012181.1|WP_060574398.1|1102058_1103075_-|lipase
MIRTTTSARSVLLALAAAGACLLGAAGVAVASPGDDGTTGPELTAPGVGEDLTCFGDLSDDTAGAPVLLVPGTTLDPDVNFDWNYARAFAAEGRSYCWVELPRHATGDIQVAAEHVVDAVRTMHDESGDRIAVVGFSQGGMVPRWALKYWPDTRGMVSDMIGIDPSNHGTLDAYPVCAPGCVPAFHQQQTGSQFLGALNDGPETFAGIDYTVVYTVTDEVVVPNLPPAASSELRGGEGATANIPVQRICPAHVAEHLIMGSTDPVGYAVVADALEHDGPASADRIDRATCLQAVMPAVDPVALPVNEARLLGQVGTSIATEPRTVAEEPLRDYARDDA
>NZ_CP012181.1|WP_075302211.1|1101095_1102013_-|dihydropteroate-synthase
MGHEPGPTGPAVLRGGPVPSLTFRGRTWNRDRAMVMAIVNRTPDSFYDHGVTFAEQAARDRITAVVREGADVIDIGGVPASPGTEVTEQEEIDRVVPTVEWARREFPDVVISVDTFRAGPAEAVCAAGADLVNDNWAAADGGILDVAARYGAGYVSAHTDHVTPRTEPHRPRYADVLGTVVTQTVALAEKAVAAGVPAGGILIDPAIDFSKNTLHSLQVLRGIEEMVATGWPVLLAMSNKTVVGESLAVPLEERLTGTLAATAIAADRGVAMVRAHQARATRETCEMVATVRGERRPSRAVRLLA
>NZ_CP012181.1|WP_082399221.1|1110741_1111464_-|deoxyribose-phosphate-aldolase
MPAPTLTATEIAGMIDHAILRPELTRPDVDAQLDVAARYRIFSVCVRPSDVAHAAARLAGTGVAVGTVIGFPHGTTSTAAKVAESAQAVTDGAAELDMVVNVGRLRSGLLDDVEADVRAVVEAAGGRVVKVILETALLSDDEIEAGCRAAERAGAAFVKTSTGFAGGGATAEHVALMRRTVGPQVQVKASGGVRDLDTVLAFHAAGVTRFGTSGTATILDDAAARESGATGGARVDDTSY
>NZ_CP012181.1|WP_010230043.1|1111656_1112121_+|STAS-domain-containing-protein
MVDDEQHLPVPEPAEEIGPALRFERSHHPSGATVLHAIGAVDDETSPDLWVELGMWSEESSDLVLDLSGVDFLGTAGLTSLLEARDVIGGEGKRLRVACGTSRAARRALQVTGAMELFDVVDRMPEAPAASAGMLFAVPAPDVRLDGMPRRDDA
>NZ_CP012181.1|WP_060633622.1|1112142_1112778_-|AmiS/UreI-family-transporter
MASVGLLFVGAVLFINGVMLLGWVDAKSAAPMNFFVGGLQIITPTYLIFTANGDADVILAASGLYLFSFTYLYVALNLTLNLDGTGLGYFCLFVFISALVFSWLNFTRFADPGFGVIWLYWAFLWLLFFLLLGLKQEQLGRYTGAVCAIQGWVTGWLPALLLLTGAYDALTGTLAVVLAVFGVVVFGALFPLLGRRRSGGAVAASDPAVPA
>NZ_CP012181.1|WP_010230048.1|1112908_1114162_-|acetamidase/formamidase-family-protein
MPEVVFPLDSRKKFTDQQIVGHNRWHPDVPAQVRVRPGDSFRVDCREWFDGAIHNDDSADDILNAPLASVHVLSGPIHVEGVQPGDLLIVDILDVGPIPQEDSGPLAGQGWGYTGVFATRNGGGFLTEQFPDAYKVIWDFQGGVATSRHVPQVSFTGIVHPGLMGTAPSRELLGTWNAREQALIDTDPQRVPPLALPPNPDSAILGSLSGADLDRAAAEAARTAPPRENGGNQDIKNLTKGSRVFYPVFVDGAKLSMGDLHFSQGDGEITFCGAIEMGGFMDLHVDVIKGGMDKYGVSENAIFMPGRTDPQYSEWLAFSGTSVTLGGEQRYLDSHLSYQRACLHAIDYLQQFGYSDIQAYMILGAAPIEGRLSGVVDIPNSCSTVYIPTEIFGFDVRPGKDGPTRIDPGQGVPVSRA
>NZ_CP012181.1|WP_010230050.1|1114225_1114513_-|zinc-ribbon-domain-containing-protein
MATYTYRCADDGPVDVRRPIGTAPETVACPACGQPCPRVVTAPMLGLADRARTSVIDRAERSRTEPDVVTSLPGRGTRVRPSAVPDPRTRGLPRP
>NZ_CP012181.1|WP_060574408.1|1114589_1115675_-|substrate-binding-domain-containing-protein
MGAPRLSLPPERRRDAITMALVVPLQGPAGIFGPSCESCGTLAAEEINASGGVLGRELRLLPVDGGAAPADVAREVDALIRAGSVDAVTGWHISAVREAVAPAIDGRVPYAYTALYEGGERRPGVFLTGETPDLQLGPTLDWFAETVGVRRWTIVGDDYVWPRRSADEARRYLRRIGGTVCDEMYVPLGTTRFDTVLRRVDRSGCEAVLMLLIGNDAVEFNRAFAAAGMDRDILRFSSLIDENVLLASGADNTRGLMTSAGYFEDLATASGLDFAAAHARRFGPEAPVLNSLGESCYEGVLLLTSLMRRAGSADVGPMTAVSDGLSYESPRGTVEVRDRHLQQRVFLAAADGLTWDVIQQL
>NZ_CP012181.1|WP_145984050.1|1115738_1116191_+|winged-helix-turn-helix-transcriptional-regulator
MSHPDPAETLRLLSMAKREASHRMEEALRAVGADIDRWRVLSLLVARGGCPMNVVAEHALLLAPKCSKLVDRMVAANLVLRRPDDLDRRRVLIFASARGREALTRWDAAVDEVGAQLAELLGEDAAVLDAVLRRLASGARSDPAASRTAG
>NZ_CP012181.1|WP_060574410.1|1116220_1116919_-|GntR-family-transcriptional-regulator
MVARVTVTSVVDAIADDLRGSVLTGELAPGTSLTEAEVAGRYEVARATAKAAIERLVAESVLERSTHKTARVVRLGPDDVRDIYLSRAILEAEVLRRLARAGTPVPEEARSANAEIRRRWDAAGFDVVEPDMRFHTALVDAAGNARTSRMYRSLTSEVTLCMAQVQGRELLSPEIIIAEHERILDLVGAGEGDAAAALLDEHLARARELLAGALGGTPGPEAAQPGPLSPGR
>NZ_CP012181.1|WP_060576381.1|1117090_1119928_+|FAD-binding-oxidoreductase
MLAGLHGCVADPGQVRDGELARHVGAHDASHFHLLPTAVVAPRGGAEVGRLLALAHRHGVPLTFRSGGTSLSGQGVTDQLLVDTRRHFRDVEILDDGLRVRVQPGVTVRQLNARLARHGRRFGPDPASEAACTVGGVLANNASGMACGTVENSYRTLESVVAVLPSGTVVDTSGPDADERLRALEPDLHKGLLVLRDRVLANPSSVATIGRQFAMKNTMGYGLNALVDHAGPAEILTHLLVGSEGTLAFVASATFRTVPLRTRISSALLVFDDLFAANAALPELVATGAATLELMDATSLRVGQSFADCPPEVARIAVREQAALLVEYQELADDELAERVAAAGRTLAGLPTAEPVELSTDPAVRGPLWKLRKGLYSSVAGARPQGSTALLEDVVVPVPALAGTCRDLAVLFDRYAYRDSVVFGHAKDGNIHFMLTDRFETDEQLGRYRDFTEEMVDLVLGHGGSLKAEHGTGRVMAPYVRRQYGDELYDVMREIKRLFDPHGVLNPGVVLSDDPDLHLKHIKLSPVVDAEVDRCTSCGFCEPVCPSRDLTLTPRQRIAARRAIREAELTGDTALAGRLEAEQDYESVQTCAVDGMCQTACPVLINTGDLVKKLRRDDRSRVDSTAWTTAAKHWSTATRGGSAALTTLAKAPAPARAGVTAANRAARAVAGTDRVPLWSGELPGGGPRRRRPAPAAVPAAVYLPACVNTLFGPAGDGPGVQASVEALCAAAGITLLVPPGIDALCCGTPWSSKGLPDGYAAMRERVVPAVLAATRGGELPVVGDASSCTEGFHTMLADAGVRVVDAMRFVVDEVLPRLGEHPRVASVSVHPTCSSARLQLDPALLTLAAEVADDVHVPDSWGCCAFAGDRGMLHPELTASATAGEAAEVRERDAAAHVSCNRTCELGMTRATGRPYEHVLELLARQVGVSAQPAGPSGGSAPRSR
>NZ_CP012181.1|WP_060574411.1|1119882_1120119_-|hypothetical-protein
MAAEGTTDDPDDERARSEAELGAAVEDALEPELKRRRALFVQRYLGLDRGEGVGRAEAHWDDPPYRDLGADPPDGPAG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP012181_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012181_4

2065207-2065287

Orphan

Consensus_repeat	Method
GCCCGGCGCTGGGGAGCGGCCGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP012181_4

>merge|NZ_CP012181|4|2065207-2065287|CRISPRCasFinder
GCCCGGCGCTGGGGAGCGGCCGGTGCCGTGGAGGAATCCGGTACCGCCGTGCGGGGCCGCCCGGCGCTGGGGAGCGGCCGG

>NZ_CP012181|4|4|2065207-2065287|CRISPRCasFinder
GCCCGGCGCTGGGGAGCGGCCGG	TGCCGTGGAGGAATCCGGTACCGCCGTGCGGGGCC
GCCCGGCGCTGGGGAGCGGCCGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012181.1\|WP_010229368.1\|2076490_2079079_+\|bifunctional-FO-biosynthesis-protein-CofGH	unknown	unknown	gnl\|CDD\|236422
NZ_CP012181.1\|WP_060574876.1\|2075899_2076409_+\|YbaK/EbsC-family-protein	unknown	unknown	gnl\|CDD\|239825
NZ_CP012181.1\|WP_060574865.1\|2050906_2051920_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|224001
NZ_CP012181.1\|WP_050802337.1\|2049324_2050059_-\|peptidoglycan-DD-metalloendopeptidase-family-protein	unknown	unknown	gnl\|CDD\|366703
NZ_CP012181.1\|WP_010235746.1\|2053376_2054264_+\|succinate--CoA-ligase-subunit-alpha	unknown	unknown	gnl\|CDD\|180194
NZ_CP012181.1\|WP_145984063.1\|2054417_2055836_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236090
NZ_CP012181.1\|WP_060574872.1\|2070591_2070900_+\|DUF3017-domain-containing-protein	unknown	unknown	gnl\|CDD\|378602
NZ_CP012181.1\|WP_060574871.1\|2065376_2068733_+\|error-prone-DNA-polymerase	unknown	unknown	gnl\|CDD\|235553
NZ_CP012181.1\|WP_060574874.1\|2074182_2075028_+\|exodeoxyribonuclease-III	unknown	unknown	gnl\|CDD\|197336
NZ_CP012181.1\|WP_082398787.1\|2063354_2064881_-\|M28-family-peptidase	unknown	unknown	gnl\|CDD\|349873
NZ_CP012181.1\|WP_029239886.1\|2069705_2070557_+\|bifunctional-methylenetetrahydrofolate-dehydrogenase/methenyltetrahydrofolate-cyclohydrolase	unknown	unknown	gnl\|CDD\|237637
NZ_CP012181.1\|WP_060574868.1\|2056027_2057776_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237171
NZ_CP012181.1\|WP_060574875.1\|2075024_2075858_+\|protein-kinase	unknown	unknown	gnl\|CDD\|270916
NZ_CP012181.1\|WP_060574866.1\|2052195_2053371_+\|ADP-forming-succinate--CoA-ligase-subunit-beta	unknown	unknown	gnl\|CDD\|234813
NZ_CP012181.1\|WP_060574873.1\|2071326_2073558_-\|NADP-dependent-isocitrate-dehydrogenase	unknown	unknown	gnl\|CDD\|377178
NZ_CP012181.1\|WP_033200406.1\|2068814_2069474_-\|membrane-protein	unknown	unknown	gnl\|CDD\|366504
NZ_CP012181.1\|WP_174521758.1\|2060592_2061690_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012181.1\|WP_060576450.1\|2057966_2058581_+\|phosphoribosylglycinamide-formyltransferase	unknown	unknown	gnl\|CDD\|235544
NZ_CP012181.1\|WP_010225768.1\|2058577_2060140_+\|bifunctional-phosphoribosylaminoimidazolecarboxamide-formyltransferase/IMP-cyclohydrolase	unknown	unknown	gnl\|CDD\|234854
NZ_CP012181.1\|WP_010234099.1\|2073807_2074140_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP012181.1\|WP_010229368.1\|2076490_2079079_+\|bifunctional-FO-biosynthesis-protein-CofGH	gnl\|CDD\|236422	PRK09234, fbiC, FO synthase; Reviewed.	0
NZ_CP012181.1\|WP_060574876.1\|2075899_2076409_+\|YbaK/EbsC-family-protein	gnl\|CDD\|239825	cd04333, ProX_deacylase, This CD, composed mainly of bacterial single-domain proteins, includes the Thermus thermophilus (Tt) YbaK-like protein, a homolog of the trans-acting Escherichia coli YbaK Cys-tRNA(Pro) deacylase and the Agrobacterium tumefaciens ProX Ala-tRNA(Pro) deacylase and also the cis-acting prolyl-tRNA synthetase-editing domain (ProRS-INS). While ProX and ProRS-INS hydrolyze misacylated Ala-tRNA(Pro), the E. coli YbaK hydrolyzes misacylated Cys-tRNA(Pro). A few CD members are N-terminal, YbaK-ProX-like domains of an uncharacterized protein with a C-terminal, predicted Fe-S protein domain.	1.03592e-53
NZ_CP012181.1\|WP_033200406.1\|2068814_2069474_-\|membrane-protein	gnl\|CDD\|366504	pfam01184, Grp1_Fun34_YaaH, GPR1/FUN34/yaaH family. The Ady2 protein is required for acetate in Saccharomyces cerevisiae, and is probably an acetate transporter. A homolog in Yarrowia lipolytica (GPR1) has a role in acetic acid sensitivity.	1.15881e-09
NZ_CP012181.1\|WP_050802337.1\|2049324_2050059_-\|peptidoglycan-DD-metalloendopeptidase-family-protein	gnl\|CDD\|366703	pfam01551, Peptidase_M23, Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.	1.20364e-40
NZ_CP012181.1\|WP_010235746.1\|2053376_2054264_+\|succinate--CoA-ligase-subunit-alpha	gnl\|CDD\|180194	PRK05678, PRK05678, succinyl-CoA synthetase subunit alpha; Validated.	0
NZ_CP012181.1\|WP_145984063.1\|2054417_2055836_+\|hypothetical-protein	gnl\|CDD\|236090	PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated.	5.79004e-06
NZ_CP012181.1\|WP_060574872.1\|2070591_2070900_+\|DUF3017-domain-containing-protein	gnl\|CDD\|378602	pfam11222, DUF3017, Protein of unknown function (DUF3017). This bacterial family of proteins with unknown function appear to be restricted to Actinobacteria.	1.89692e-13
NZ_CP012181.1\|WP_060574871.1\|2065376_2068733_+\|error-prone-DNA-polymerase	gnl\|CDD\|235553	PRK05672, dnaE2, error-prone DNA polymerase; Validated.	0
NZ_CP012181.1\|WP_060574874.1\|2074182_2075028_+\|exodeoxyribonuclease-III	gnl\|CDD\|197336	cd10281, Nape_like_AP-endo, Neisseria meningitides Nape-like subfamily of the ExoIII family purinic/apyrimidinic (AP) endonucleases. This subfamily includes Neisseria meningitides Nape and related proteins. These are Escherichia coli exonuclease III (ExoIII)-like AP endonucleases and belong to the large EEP (exonuclease/endonuclease/phosphatase) superfamily that contains functionally diverse enzymes that share a common catalytic mechanism of cleaving phosphodiester bonds. AP endonucleases participate in the DNA base excision repair (BER) pathway. AP sites are one of the most common lesions in cellular DNA. During BER the damaged DNA is first recognized by DNA glycosylase. AP endonucleases then catalyze the hydrolytic cleavage of the phosphodiester bond 5' to the AP site, and this is followed by the coordinated actions of DNA polymerase, deoxyribose phosphatase, and DNA ligase. If left unrepaired, AP sites block DNA replication, and have both mutagenic and cytotoxic effects. AP endonucleases can carry out a variety of excision and incision reactions on DNA, including 3'-5' exonuclease, 3'-deoxyribose phosphodiesterase, 3'-phosphatase, and occasionally, nonspecific DNase activities. Different AP endonuclease enzymes catalyze the different reactions with different efficiences. Many organisms have two AP endonucleases, usually one is the dominant AP endonuclease, the other has weak AP endonuclease activity; for example, Neisseria meningitides Nape and NExo. Nape, found in this subfamily, is the dominant AP endonuclease. It exhibits strong AP endonuclease activity, and also exhibits 3'-5'exonuclease and 3'-deoxyribose phosphodiesterase activities.	5.52672e-110
NZ_CP012181.1\|WP_082398787.1\|2063354_2064881_-\|M28-family-peptidase	gnl\|CDD\|349873	cd03876, M28_SGAP_like, M28 Zn-peptidase Streptomyces griseus aminopeptidase and similar proteins. Peptidase family M28; Streptomyces griseus Aminopeptidase (SGAP, Leucine aminopeptidase (LAP), aminopeptidase S, Mername-AA022 peptidase) subfamily. SGAP is a di-zinc exopeptidase with high preference towards large hydrophobic amino-terminal residues, with Leu being the most efficiently cleaved. It can accommodate all except Pro and Glu residues in the P1' position. It is a monomeric (30 kDa), calcium-activated and calcium-stabilized enzyme; its activation by calcium correlates with substrate specificity and it has thermal stability only in the presence of calcium. Although SGAP contains a calcium binding site, it is not conserved in many members of this subfamily. SGAP is present in the extracellular fluid of S. griseus cultures.	5.05348e-108
NZ_CP012181.1\|WP_029239886.1\|2069705_2070557_+\|bifunctional-methylenetetrahydrofolate-dehydrogenase/methenyltetrahydrofolate-cyclohydrolase	gnl\|CDD\|237637	PRK14193, PRK14193, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional.	1.57247e-171
NZ_CP012181.1\|WP_060574868.1\|2056027_2057776_+\|hypothetical-protein	gnl\|CDD\|237171	PRK12678, PRK12678, transcription termination factor Rho; Provisional.	9.08062e-08
NZ_CP012181.1\|WP_060574875.1\|2075024_2075858_+\|protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	6.06145e-34
NZ_CP012181.1\|WP_060574866.1\|2052195_2053371_+\|ADP-forming-succinate--CoA-ligase-subunit-beta	gnl\|CDD\|234813	PRK00696, sucC, ADP-forming succinate--CoA ligase subunit beta.	0
NZ_CP012181.1\|WP_060574873.1\|2071326_2073558_-\|NADP-dependent-isocitrate-dehydrogenase	gnl\|CDD\|377178	pfam03971, IDH, Monomeric isocitrate dehydrogenase. NADP(+)-dependent isocitrate dehydrogenase (ICD) is an important enzyme of the intermediary metabolism, as it controls the carbon flux within the citric acid cycle and supplies the cell with 2-oxoglutarate EC:1.1.1.42 and NADPH for biosynthetic purposes.	0
NZ_CP012181.1\|WP_060576450.1\|2057966_2058581_+\|phosphoribosylglycinamide-formyltransferase	gnl\|CDD\|235544	PRK05647, purN, phosphoribosylglycinamide formyltransferase; Reviewed.	3.72396e-86
NZ_CP012181.1\|WP_010225768.1\|2058577_2060140_+\|bifunctional-phosphoribosylaminoimidazolecarboxamide-formyltransferase/IMP-cyclohydrolase	gnl\|CDD\|234854	PRK00881, purH, bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase; Provisional.	0
NZ_CP012181.1\|WP_060574865.1\|2050906_2051920_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|224001	COG1075, LipA, Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only].	5.78635e-16

>NZ_CP012181.1|WP_082398787.1|2063354_2064881_-|M28-family-peptidase
MRTATTGTTPGGSTRRRVAGRRLARVLGAGVAVAALAACANVPAGPGTAVLPPGAAGTDGATPQSDPGLPARLAGAVSGDAAYAHLEQLQKIADANDGNRAIGTPGYDASVDYVSRTLREAGYDVQTPSFDVRTFTAGDARLTVAGAPVPTEVLSFSPATPPGGLTAPLSVRPRAPQDPSPGCEAEDYAEMPAGAIAVVERGVCEFGQKSRLAGAAGAVAVIVTNTEDAALPATLGETPGVVPTAAVQRTAGAALRDGQQATLLLDTTIQQQTSRNVIAETSTGDPDRVVMAGAHLDSVPEGAGINDNGSGSAALLDVAQKLGAAPPAGQKVRFAWWGAEEIGLVGATRYVESLSQQDRAKVGLYLNFDMVASPNAAYLVYDGDDSDRLGGEAGPPGSGAAEQVLTESLVAAGVQGPEGTAFDGRSDYGPFIEAGIPAGGLFTGAEERKTPEQAQKWGGTPGQSYDACYHTPCDRLTNIDRVALDRNVTAMGNAIGRFAVDMTGVPAR
>NZ_CP012181.1|WP_174521758.1|2060592_2061690_+|hypothetical-protein
MIGSAPDGAGEPGGGPEPRYRPETGEPHPGPEEAAGPVIGAGVRSAGTDGEPVPAGRAGSGAGPRAGLAGSRDPGSGREPLHGARGPVGGPVSDRLARARQVLHRVETRADVERSRPVARPGCGATAADAGPARTTGTADPDDAVLLPVPGPLAGLLPAGGLRRGSTVAVGAGAGAGSLLFALLAAASAEGCWAGVVGRPGLGAAAAAEAGVRLDRLALVPDPGADLVGVTAALLDGLDLVVVAGPERAGLRAGDRQRLTARARQRGAVLLALGSWPGADLRLHCERPRWEGVGRGEGRLRYRRIEVRASGRGIGPAGRGAEVLLPGPGGAVLAAPEQVPAGSRPTPVAAPGQVLPGRPVVQVAG
>NZ_CP012181.1|WP_010225768.1|2058577_2060140_+|bifunctional-phosphoribosylaminoimidazolecarboxamide-formyltransferase/IMP-cyclohydrolase
MSERRPVRRALISVYDKAGLLDLATGLHAAGVEIVSTGSTAQRIADAGVPVTPVEEVTGFPECFDGRVKTLHPRVHAGLLADTRKDEHVVQLEQLNIAPFDLLVSNLYPFRETVASGASRDEAVEQIDIGGPAMVRASAKNHESVAVVVEPSRYEWVLEQVAAGGFVVADRRRLAADAFRHTAAYDVSVATWMGEQFPAGDGTEATPEWFGATWTRERALRYGENPHQAAALYADGGATGLAGAEQLHGKEMSYNNYVDADAAWRAAHDHGDRPTVAVIKHANPCGIAVGADVAEAHRKAHATDPVSAFGGVVAVNGEVSVAMAEQVAEIFTEVVVAPSYADGALEVLQRKKNVRLLRIPGEVARGGTELRPISGGVLVQQRDLVDAAGDDPAAWKLVTGDPASPELLADLAFAWRACRAVKSNAILLAHDGAAVGVGMGQVNRVDAAKLAVERAGDRVRGAVVASDAFFPFPDGLEVLLDAGVAAVVQPGGSVRDEQVVAACAKAGVPMYLTGTRHFAH
>NZ_CP012181.1|WP_060576450.1|2057966_2058581_+|phosphoribosylglycinamide-formyltransferase
MHAQEQAGPFRVVVLVSGAGTLLQALLDASPAGPSGYRVVAVGADRPGAAGLDRAREAALPTFVERVADHPDRDAWNAALAAAVVAHRPDVVVGAGFMKLVAPAFLDAIGCPMLNTHPALLPAFPGAHAVRDALAAGVRTTGATVHEVDAGLDTGPVLAQVEVPVLPTDDETVLHERIKTEERRLLVETVLRLAAAGRTHEVSQ
>NZ_CP012181.1|WP_060574868.1|2056027_2057776_+|hypothetical-protein
MSTPPRPARGRPASRSRPSGPGASRSRDDAAARDGRGGVAERERPRATTRRPAPDRRPGDGNGLDRLRILLASTMGAVLAGYTLLVPVAALIAGTGGVPVTADAALATAVPMWLAAHQIPIALDGRPLGVLPLLPTLVIVAVVAWFSRWAVRRLGGRVRHDAGAVVAAQAGAAAAVAVLAGALLPKEMAVTAPWASLLGAGLIGGAAAGAGVVHACGMPAAWKRVLAGWPGAALAGVRVAATSLLLTGALVLTGALLLTATAVSDAAARLGPGIGAGFGVLVLAVGYLPNALVGAVSWMLGAGVSVGVATSGPLLAEPGPLPAFPLTALLPVTTVPPAAPLVLLLPVLAGVLTGLACRRALADGAPMAERAVAPATAAVVVATGAGALATVAGGPLAGGPYDPVSFHPGAVLGAVLLLVGLPALLTCAGPELARHVPMGGPAGGRAGRAPGTGSRAVRRERSSTVADLVEGRRRSGASSRSGGSGGRDGRVRREGRRDPAGAVGDGAARVGDAPHDDPDHDHPDHDHPDHEGPGDPGTADHDGPADHADHDGPDHDDPGHDPGPDRDGPRRGSRGDDRDPTG
>NZ_CP012181.1|WP_145984063.1|2054417_2055836_+|hypothetical-protein
MSSNQPPSPGAGPDDAVTPPAGTVRLAVLGGAAAALLVLVTAFFGLPPAAAYALAMVVAGGIAGGLSLLPGTGRVLVAGTVLSGTGFLTLLFLFTASGSPVAAGAVGWVAVAFALLSVAGLFYGQLLLSGVLAAPAPRAARPAHAPSNEPPWATPGLPQQPGHGRPGQAGGYDAYGPGRGGHPGAHEGPGQYAQQPGHYGAQHGQYAAEPGQYGGQPGQYGGQPGQYGIQPGQFTQQPGQYGAQAGQPGAQPGAPAGQYGIPAADQYGGQPGQYGQQPGQYGEPGQYGQQPQGAGQAVPGSYAPSTAASGGAFSGVAYGERAADPGRGHGGGAVPAVPGQQAAGADAPGAPGQGGPAGPAEFGQQGPAEQPAQGAAQHTPDEVAGQHLPGEPAVGQTAHGVPGAGQNGPGGQAVDPNAPGVPAAGARGQSGTPEQQASGEQSPGHDPARQTPVTDDDATRAFRAGGGRPPSS
>NZ_CP012181.1|WP_010235746.1|2053376_2054264_+|succinate--CoA-ligase-subunit-alpha
MSIFLNENSKVIVQGITGGEGTKHATKMIASGTNIVGGVNARKAGTTHTVGDKDVTVYGTVEEAMKETGADVSVLFVPPKFAKDAVIEAIDAEIPLAVVITEGIPVHDSAYFWAHAVAKGNKTRIIGPNCPGIISPGKSNAGIIPANIAGPGKIGLVSKSGTLTYQMMFELREFGFSTAIGIGGDPVIGTTHIDALEAFEADPDTEAIVMIGEIGGDAEERAADFIKANVTKPVAGYVAGFTAPEGKTMGHAGAIVSGSAGTAQAKKEALEAAGVKVGKTPSETAALMKEILSAK
>NZ_CP012181.1|WP_060574866.1|2052195_2053371_+|ADP-forming-succinate--CoA-ligase-subunit-beta
MDLYEYQAKDLFAAHGVPVLPGKTVDNAADAAAAASELGTAVVVKAQVKTGGRGKAGGVKLAQSADEAKEKAEAILGLDIKGHTVHQVLVTEASDISEEYYFSFLLDRSNRTFLAMCSAEGGMEIEELAVERPEALARIAIDPIAGVDKAKADEIVAAGKIPAAVADEAANVIVKLWETFVAEDATLVEVNPLVRDPQDKVIALDGKVTLDENAAFRHEAHAELVDERTENPLEAKAKAKGLNYVKLDGGQVGVIGNGAGLVMSTLDVVAYAGEAHGGVKPANFLDIGGGASAQVMADGLDVILGDDEVKSVFVNVFGGITACDAVANGIVEALKILGDDATKPLVVRLDGNNVEEGRKILADANHPLVTVVGTMDDAAAKAAELANAAGA
>NZ_CP012181.1|WP_060574865.1|2050906_2051920_-|alpha/beta-fold-hydrolase
MATSLPGWRRLRAIASGATDLASDLGQATGYAVRTFTSPAGLRGLAVEWAWLSAHLALYPIGLAEETVRAHGHWRTDTLPPVKRSLVVADPAAAGTPILLIHGIMDNRSVFTVFAHALRRRGFGTVHAINYSLLTGDLRSAAHELRGHVERLREATGSDKVHIVGHSLGGVVARYYVQRMGGDDVVDTLVTLGSPHSGSNLARLAPTALCRQLRPGSEVLAELDAPAPGCRTRFLVAWSRMDEVVVPQRNARLQHPDLDVQELRLDDVGHLSLPIDRRTVHWVASTLARGEVERREHDAVRDRRLRGSLRPAGRHAVDAELDGTGGGVPGVPGAPAS
>NZ_CP012181.1|WP_050802337.1|2049324_2050059_-|peptidoglycan-DD-metalloendopeptidase-family-protein
MAGALGIPGLSGEQAVEDSYARLAASAMLPVSAEPRPADTTAPAVTSAIGGEQLASQASLPDLDDTTEVDVASLTKAARLGEQAATQERAISGAMSHGAPKAVVFDGEPLVMPTAGRFTSGFGARWGVQHYGIDLAAPIGTPIFALTDGVVEKAGPASGFGMWVVLKHPDGTSSVYGHINRSLVEVGQQVKAGDEIAEVGNRGQSTGPHLHLEIWESDGSKTNPLPWLTERGLDVTRLTGDRDA
>NZ_CP012181.1|WP_060574871.1|2065376_2068733_+|error-prone-DNA-polymerase
MGWQNPDVPWSELEGALSGRSVRDGSSLRGGPEADGGDAPAWSAHRGPYEPPAGLRAGAATVPYAELHCHSHFSFLDGASAPEELVERAAELGLEAIALTDHDGMYGVVRFAEAARALGIRTVFGAELSLGLSAPQNGVADPEGEHLLLLARGPDGYRALCRTISTAQMRGGEKGRPVYDLDEVVADTAGRVVVLTGCRKGAVRRALDRHGPGAAAAALERLAERFGRENVRVELTVHGEPCDTERNDALAALAAAAGVATVATTAAHYAAPDRAPLAATVAAVRARRSLDEIDPWLPAAGTAHLRSGREMTRRFEDRHPGAVARAAGLGRELAFELHLVAPDLPPFDVPEGETEASWLRALTERGRLQRYGSHDENPFAAYTVERELAIIEEKNFPGYFLIVHDIVDFCRREDIFCQGRGSAANSAVCYALGITNVDAVRHGLLFERFLSPDRDGYPDIDLDIESGRREEAIQYVYRRYGRLFAAQVANVITYRPRSAVRDTARALGFSPGQQDAWSKRVERWHALEASELGTGGEQTLQMPPLLLDLAGQLMGAPRHLGIHSGGMVICDRPVSEVVPVEWARMEDRTVVQWDKEDCAAAGLVKFDLLGLGMLTALHLMADLVERNDGTRIELHRIGESDPEVYAMLSRADSVGVFQVESRAQMATLPRLRPREFYDLVVEVALIRPGPIQGGSVHPYIRRRNRIDDWEHDHPLLKPALDKTLGIPLFQEQMIQIAVDVAGFSAAEADELRRAMGAKRSTEKMERLRGRFFDGMAANGITGELAETIFTKMLAFANFGFPESHSISFAALVYYSAWFKLYHPAAFCAALLNAQPMGFYSPQSLVADARRHGVRVRRPDVNEGRADAILQPDPDSTGGWAVRLGLSGIRTIGTDLAGAVDAVRASAGPFADLPDLARRVRLTGPQAEALATAGAFGCFGVERREALWAAGVVAGVRPEHLPGTAVGFDAPALPGMTDAELTVSDVWATGVSPDSHPVQHLRGKLDGLGAVRIDRLDDVGRRAGPDAPPRVLVGGLVTHRQRPATARGVTFVNLEDESGMLNVTCSEGLWARYRSVALGSAALLVRGRLERSPEGVLNLLADRLQRMPLAVPVQSRDFR
>NZ_CP012181.1|WP_033200406.1|2068814_2069474_-|membrane-protein
MSVESETAGAQTAAPPAAAAPAANPALMGLICFLPSGITLGLWFVGYLDTTALPGGMIPIVTFSAGLFLLLAAMSALRVGDSVTAAIFGVFSAFWTSFGVLLMALNNGWIIDAGTGGPLATDQIGSIQSAYLLSFTLVFILLTLATLRLPLMFTIGFVLVDITFVLAYLGVTAGNAGLFPIAGITTFGFCIVFAYILFDAFGQTLGGRAMAMGNPLVKS
>NZ_CP012181.1|WP_029239886.1|2069705_2070557_+|bifunctional-methylenetetrahydrofolate-dehydrogenase/methenyltetrahydrofolate-cyclohydrolase
MSATVMDGKATLAELLEDLRVRVEKLTAAGRTPGLGTVLVGDDPGSHAYVRGKHRDCAKVGITSLQRELPADASQAQVDDTIDELNADPSCTGFIVQLPLPAGLDSGAALERVDPLKDADGLHPVNLGRLVLGEPGPLPCTPRGIVALCRRFGVELDGARVVVVGRGVTVGRPLGLLLTRRSENATVTLCHTGTTDLTAHLREADVVVAAAGRAGLITADQVKPGAAVLDVGVTRTDLGLVGDVAPEVAEVAGLLAPMPGGVGPMTRGMLLTNVVEAAERAAG
>NZ_CP012181.1|WP_060574872.1|2070591_2070900_+|DUF3017-domain-containing-protein
MATTRSGFGLRARLRAYWPLLTVLAIALIGLQRVATEHWREGSAALGVAMLVAAVLRVVLPPDRVGLLAVRGRYVDALVYGGFGLAVLALALTITRGSLTVS
>NZ_CP012181.1|WP_060574873.1|2071326_2073558_-|NADP-dependent-isocitrate-dehydrogenase
MKLIYTYTDEAPALATHSFLPVIEAFAGQAGVDVETRDISLAARILAKFPDRLTDAQRVPDSLAELGELAKTPDANIIKLPNISASIPQLKAAIKELQGAGYDVPDYPEDPRTDDEKAARAAYDAVKGSAVNPVLREGNSDRRAPASVKNFARKHPHSMGAWNSDSKSHVATMSDGDFRHSEKSFTVAADGALRIEHVAADGTVTVLKDAVKVLAGEVIDGSVMRREALQAFLAEQVADAKAKGVLFSVHLKATMMKVSDPKIFGHAVRAYFADVFAAYGDDLASVGADPDDGLASVLSALEKLPADKREAIEKAITAAYETGPALAQVDSSRGITNLHVPSDVIIDASMPAAIRSSGQMWNADDATQDAKFVIPDSSYADLYDETVKHCIANGAFDPTTMGTVPNVGLMAQKAEEYGSHDKTFEIVSAGTVRVVDAASGEEKLSHEVAEGDIWRACQTKDAPIRNWVGLAVDRARATGSPAVFWLDSSRAHDAQLIAKVETYLGELDTDGLTIEILPVGEATRYTLERARKGEDTISVTGNVLRDYLTDLFPILELGTSAKMLSIVPLMNGGGLFETGAGGSAPKHVQQLQKENHLRWDSLGEFLALAVSLEMLASKSPDPLRAKLLGQALDDATGLLLENGKSPSRKVNELDNRGSHFYVAWYWAQALAEQTEDPELAAVFAPLAKALGEQEETILGELNGAQGDPVDLGGYYYVDRAKADSVMRPSATLNAAIDGFAGRS
>NZ_CP012181.1|WP_010234099.1|2073807_2074140_+|hypothetical-protein
MAKVKIPGLTRTTFLSGWPLVALIAVGLTAVALLYGGATDEFGSTCRVTVQAAEVTVRAAPAASAQPVDTLTRGEEVGAETIVDSGFRKLTGGDRWVPSNSVAATAGSVC
>NZ_CP012181.1|WP_060574874.1|2074182_2075028_+|exodeoxyribonuclease-III
MPPPVRALATANVNGVRAATGKGLLDWLAVTDVDAVCLQEVRARPEELPAALTDALAAAGWHLRLAPCETAKGRNGVAVLSRSEPEAVRIGFGDPATDLDGRYLEVDLPGDLTVASLYLPKGVAGTDKQDAKDAFLKTFGDHLRTAFARCAATGREMVVAGDWNIAPTEQDLRNWRNNQRNSGFLPHEREWFAGLLEHGWTDVVRALHPGTDGPYSWWTYRGRAFDNDVGWRIDHLLTTPGLAAAAHEAVVERAPSHDTRWSDHAPVVVRLGPGAPAGGTE
>NZ_CP012181.1|WP_060574875.1|2075024_2075858_+|protein-kinase
MIESRVVGGRYLLLDELDRRGFGPSRRAEDRITGRTVAVTEIVMPADGAARQRLLAEVRAAGRLRHPGVVGVLDLITDRAADGGMREYLVTEHPDARPLGRLVAGDDPPSLRAVAGIGREVLAALRDVHAGAGTHGGLDPDCVLITPDGRALVTDVGLSRAVGPRAAGADTGAFTAPERDGGTGDTPAADLWSLGAVLHHAGGREAAPGSPLAQAITGLTAADPAERLGPDDADALLGRAAGPRGSGGDLGRNRWILLVVAALLAVAVVAMLLWVVR
>NZ_CP012181.1|WP_060574876.1|2075899_2076409_+|YbaK/EbsC-family-protein
MSETTGAAEHPADHPRVASVKESLRRAGADPASIAGLALLPDAVTTAAAAAAALDVEVGQIANSLVFDAGGEPLLVLTSGRHRVDTDRVAALLGVAVGRADKEFVRTATGQVIGGVAPVGHPAPLRTLVDVALDDYDRVWAAGGVARSVFPTTFAELVAVTGGTAAEVA
>NZ_CP012181.1|WP_010229368.1|2076490_2079079_+|bifunctional-FO-biosynthesis-protein-CofGH
MADTPAAPVPAEAAPSDSALRRALRRVRDGSTLDVTEAAVLLAARGEHLDELLSHAGRVRDAGLVEEGRPGVVTYSRNVFIPLTRLCRDRCHYCTFATVPHRLDSMFLERDEVVEIARQGAAQGCKEALFTLGDRPEERWPQAREWLEARGYDSTLDYVRACAIAVLEETGLLPHLNPGVMSWEEITRLKPVAASMGMMLETTSQRLFEKGGPHFGSPDKEPAVRVRALADAGRVGVPFTTGILIGIGENRTERAESLFAIRSAARQHGHVQEVIVQNFRAKPDTAMANDPDADLDDLAATIAVSRLVLGPKVRLQAPPNLVGDEQALMLRAGIDDWGGVSPVTVDHVSPEMPWPAVDELARVTAEEGFELRERLTAYPKYVRAGSPWIDTRLHGHVAALATPDGLADPGAVVQGLPWQEPDGGFESTGRTDLHTAVDTEGRTDDRRSDFGSVYGDWDEVAAELESQRARAPERLAGDVKAGLELAASDPAALLDPANEAAAMAVLTGEGPALRELTRLADDVRRQVNGDDVTYVVNRNINFSNVCYVGCRFCAFAQRERDADAFRLSLDEIAQRAAEAARDGATEVCVQGGIDPQLPVSFYADLVRAVHEAVPGMHVHAFSPMEIVSAAAKAGVSIREWLSELKAAGLGSIPGTAAEILDDEVRWVLTKGKLPASQWIEVVSTAHELGIPSSSTMMYGHVDEPRHWLGHLRTLASVQDRTGGFTEFVPLPFVHHNAPIYLAGIARPGPTERDNRAVHAFARLALHGRIDHVQVSWVKLGDELAGQVLNGGADDMGGTLMEETISRMAGSENGSERSVEELTEIAHAAGRPVRQRTTTYRGEPSVLTPARPSGPRMLPLAPA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP012181_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012181_5

2316048-2316134

Orphan

Consensus_repeat	Method
GGGCGTCACGCACCCCGTCGCCGTGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP012181_5

>merge|NZ_CP012181|5|2316048-2316134|CRISPRCasFinder
CTGCCCGCCGCACCCCGTCCCCGCGCGCCGCACCCCGTGGCGGGCGTCACGCACCCCGTCGCCGTGCCGCGCACCCCGTCGCCGCGC

>NZ_CP012181|5|5|2316048-2316134|CRISPRCasFinder
CTGCCCGCCGCACCCCGTCCCCGCGC	GCCGCACCCCGTGGCGGGCGTCACGCACCCCGTCG
CCGTGCCGCGCACCCCGTCGCCGCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012181.1\|WP_060574970.1\|2311738_2312512_-\|enoyl-CoA-hydratase/isomerase-family-protein	unknown	unknown	gnl\|CDD\|181249
NZ_CP012181.1\|WP_010242595.1\|2310823_2311714_-\|transporter-substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|270223
NZ_CP012181.1\|WP_060576472.1\|2323051_2323558_-\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|239516
NZ_CP012181.1\|WP_060633658.1\|2305008_2307027_+\|protein-meaA	unknown	unknown	gnl\|CDD\|239653
NZ_CP012181.1\|WP_010228021.1\|2317942_2319373_-\|form-I-ribulose-bisphosphate-carboxylase-large-subunit	unknown	unknown	gnl\|CDD\|173977
NZ_CP012181.1\|WP_060574972.1\|2313379_2314612_+\|cytochrome-P450	unknown	unknown	gnl\|CDD\|225035
NZ_CP012181.1\|WP_060576469.1\|2315031_2315898_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176112
NZ_CP012181.1\|WP_060574974.1\|2323665_2324325_+\|endonuclease-NucS	unknown	unknown	gnl\|CDD\|235114
NZ_CP012181.1\|WP_010228028.1\|2321397_2322342_+\|phosphoribulokinase	unknown	unknown	gnl\|CDD\|180975
NZ_CP012181.1\|WP_010224404.1\|2304457_2304796_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012181.1\|WP_082398802.1\|2309717_2310788_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|179385
NZ_CP012181.1\|WP_010228019.1\|2317469_2317928_-\|ribulose-bisphosphate-carboxylase-small-subunit	unknown	unknown	gnl\|CDD\|177052
NZ_CP012181.1\|WP_060574973.1\|2322338_2323100_+\|HAD-IA-family-hydrolase	unknown	unknown	gnl\|CDD\|319830
NZ_CP012181.1\|WP_082538266.1\|2319397_2320630_-\|GAF-domain-containing-sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|226951
NZ_CP012181.1\|WP_082398804.1\|2316445_2317483_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|200217
NZ_CP012181.1\|WP_010242591.1\|2308964_2309702_-\|FHA-domain-containing-protein	unknown	unknown	gnl\|CDD\|238017
NZ_CP012181.1\|WP_060574969.1\|2307045_2308968_-\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270916
NZ_CP012181.1\|WP_060574975.1\|2324338_2324761_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012181.1\|WP_082398801.1\|2303598_2304450_+\|DUF1206-domain-containing-protein	unknown	unknown	gnl\|CDD\|377695
NZ_CP012181.1\|WP_010228026.1\|2320626_2321289_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107

Protein	Function_ID	Function_description	E-value
NZ_CP012181.1\|WP_060574970.1\|2311738_2312512_-\|enoyl-CoA-hydratase/isomerase-family-protein	gnl\|CDD\|181249	PRK08139, PRK08139, enoyl-CoA hydratase; Validated.	2.03552e-87
NZ_CP012181.1\|WP_010242595.1\|2310823_2311714_-\|transporter-substrate-binding-domain-containing-protein	gnl\|CDD\|270223	cd01002, PBP2_Ehub_like, Substrate binding domain of ectoine/hydroxyectoine specific ABC transport system; the type 2 periplasmic binding protein fold. This family represents the periplasmic substrate-binding component of ABC transport systems that involved in uptake of osmoprotectants (also termed compatible solutes) such as ectoine and hydroxyectoine. To counteract the efflux of water, bacteria and archaea accumulate the compatible solutes for a sustained adjustment to high osmolarity surroundings. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	3.39761e-69
NZ_CP012181.1\|WP_060576472.1\|2323051_2323558_-\|NUDIX-hydrolase	gnl\|CDD\|239516	cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate. Like other members of the Nudix hydrolase superfamily, it requires a divalent cation, such as Mg2+, for its activity. It also contains a highly conserved 23-residue Nudix motif (GX5EX7REUXEEXGU, where U = I, L or V) which functions as a metal binding site/catalytic site. In addition to the Nudix motif, there are additional conserved amino acid residues, distal from the signature sequence, that correlate with substrate specificity. In humans, there are four distinct ADPRase activities, three putative cytosolic enzymes (ADPRase-I, -II, and -Mn) and a single mitochondrial enzyme (ADPRase-m). Human ADPRase-II is also referred to as NUDT5. It lacks the N-terminal target sequence unique to mitochondrial ADPRase. The different cytosolic types are distinguished by their specificities for substrate and specific requirement for metal ions. NUDT5 forms a homodimer.	1.80236e-38
NZ_CP012181.1\|WP_060633658.1\|2305008_2307027_+\|protein-meaA	gnl\|CDD\|239653	cd03681, MM_CoA_mutase_MeaA, Coenzyme B12-dependent-methylmalonyl coenzyme A (CoA) mutase (MCM) family, MeaA-like subfamily; contains various methylmalonyl coenzyme A (CoA) mutase (MCM)-like proteins similar to the Streptomyces cinnamonensis MeaA, Methylobacterium extorquens MeaA and Streptomyces collinus B12-dependent mutase. Members of this subfamily contain an N-terminal MCM domain and a C-terminal coenzyme B12 binding domain. S. cinnamonensis MeaA is a putative B12-dependent mutase which provides methylmalonyl-CoA precursors for the biosynthesis of the monensin polyketide via an unknown pathway. S. collinus B12-dependent mutase may be involved in a pathway for acetate assimilation.	0
NZ_CP012181.1\|WP_010228021.1\|2317942_2319373_-\|form-I-ribulose-bisphosphate-carboxylase-large-subunit	gnl\|CDD\|173977	cd08212, RuBisCO_large_I, Ribulose bisphosphate carboxylase large chain, Form I. Ribulose bisphosphate carboxylase (Rubisco) plays an important role in the Calvin reductive pentose phosphate pathway. It catalyzes the primary CO2 fixation step. Rubisco is activated by carbamylation of an active site lysine, stabilized by a divalent cation, which then catalyzes the proton abstraction from the substrate ribulose 1,5 bisphosphate (RuBP) and leads to the formation of two molecules of 3-phosphoglycerate. Members of the Rubisco family can be divided into 4 subgroups, Form I-IV , which differ in their taxonomic distribution and subunit composition. Form I is the most abundant class, present in plants, algae, and bacteria, and forms large complexes composed of 8 large and 8 small subunits.	0
NZ_CP012181.1\|WP_060574972.1\|2313379_2314612_+\|cytochrome-P450	gnl\|CDD\|225035	COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism].	7.52338e-94
NZ_CP012181.1\|WP_060576469.1\|2315031_2315898_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176112	cd08420, PBP2_CysL_like, C-terminal substrate binding domain of LysR-type transcriptional regulator CysL, which activates the transcription of the cysJI operon encoding sulfite reductase, contains the type 2 periplasmic binding fold. CysL, also known as YwfK, is a regular of sulfur metabolism in Bacillus subtilis. Sulfur is required for the synthesis of proteins and essential cofactors in all living organism. Sulfur can be assimilated either from inorganic sources (sulfate and thiosulfate), or from organic sources (sulfate esters, sulfamates, and sulfonates). CysL activates the transcription of the cysJI operon encoding sulfite reductase, which reduces sulfite to sulfide. Both cysL mutant and cysJI mutant are unable to grow using sulfate or sulfite as the sulfur source. Like other LysR-type regulators, CysL also negatively regulates its own transcription. In Escherichia coli, three LysR-type activators are involved in the regulation of sulfur metabolism: CysB, Cbl and MetR. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.73289e-41
NZ_CP012181.1\|WP_060574974.1\|2323665_2324325_+\|endonuclease-NucS	gnl\|CDD\|235114	PRK03298, PRK03298, endonuclease NucS.	2.20877e-176
NZ_CP012181.1\|WP_010228028.1\|2321397_2322342_+\|phosphoribulokinase	gnl\|CDD\|180975	PRK07429, PRK07429, phosphoribulokinase; Provisional.	7.00396e-132
NZ_CP012181.1\|WP_082398802.1\|2309717_2310788_-\|hypothetical-protein	gnl\|CDD\|179385	PRK02224, PRK02224, DNA double-strand break repair Rad50 ATPase.	0.000122533
NZ_CP012181.1\|WP_010228019.1\|2317469_2317928_-\|ribulose-bisphosphate-carboxylase-small-subunit	gnl\|CDD\|177052	CHL00130, rbcS, ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit; Reviewed.	2.13961e-77
NZ_CP012181.1\|WP_060574973.1\|2322338_2323100_+\|HAD-IA-family-hydrolase	gnl\|CDD\|319830	cd07528, HAD_CbbY-like, subfamily of beta-phosphoglucomutase-like family, similar to Rhodobacter sphaeroides xylulose-1,5-bisphosphate phosphatase CbbY. This family includes Rhodobacter sphaeroides and Arabidopsis thaliana xylulose-1,5-bisphosphate phosphatase CbbY which convert xylulose-1,5-bisphosphate (a potent inhibitor of Ribulose-1,5-bisphosphate carboxylase/oxygenase, Rubisco), to the non-inhibitory compound xylulose-5-phosphate. It belongs to the beta-phosphoglucomutase-like family whose other members include Lactococcus lactis beta-PGM, a mutase which catalyzes the interconversion of beta-D-glucose 1-phosphate (G1P) and D-glucose 6-phosphate (G6P), Saccharomyces cerevisiae phosphatases GPP1 and GPP2 that dephosphorylate DL-glycerol-3-phosphate and DOG1 and DOG2 that dephosphorylate 2-deoxyglucose-6-phosphate, and Escherichia coli 6-phosphogluconate phosphatase YieH. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	4.72931e-54
NZ_CP012181.1\|WP_082538266.1\|2319397_2320630_-\|GAF-domain-containing-sensor-histidine-kinase	gnl\|CDD\|226951	COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms].	7.67255e-55
NZ_CP012181.1\|WP_082398804.1\|2316445_2317483_-\|AAA-family-ATPase	gnl\|CDD\|200217	TIGR02880, Protein_CbxX_chromosomal, probable Rubsico expression protein CbbX. Proteins in this family are now designated CbbX. Some previously were CfxQ (carbon fixation Q). Its gene is often found immmediately downstream of the Rubisco large and small chain genes, and it is suggested to be necessary for Rubisco expression. CbbX has been shown to be necessary for photoautotrophic growth. This protein belongs to the larger family of pfam00004, ATPase family Associated with various cellular Activities. Within that larger family, members of this family are most closely related to the stage V sporulation protein K, or SpoVK, in endospore-forming bacteria such as Bacillus subtilis.	5.86039e-147
NZ_CP012181.1\|WP_010242591.1\|2308964_2309702_-\|FHA-domain-containing-protein	gnl\|CDD\|238017	cd00060, FHA, Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins. Putative nuclear signalling domain. FHA domains may bind phosphothreonine, phosphoserine and sometimes phosphotyrosine. In eukaryotes, many FHA domain-containing proteins localize to the nucleus, where they participate in establishing or maintaining cell cycle checkpoints, DNA repair, or transcriptional regulation. Members of the FHA family include: Dun1, Rad53, Cds1, Mek1, KAPP(kinase-associated protein phosphatase),and Ki-67 (a human nuclear protein related to cell proliferation).	0.000176264
NZ_CP012181.1\|WP_060574969.1\|2307045_2308968_-\|serine/threonine-protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	1.32722e-86
NZ_CP012181.1\|WP_082398801.1\|2303598_2304450_+\|DUF1206-domain-containing-protein	gnl\|CDD\|377695	pfam06724, DUF1206, Domain of Unknown Function (DUF1206). This region consists of two a pair of transmembrane helices and occurs three times in each of the family member proteins.	2.8489e-10
NZ_CP012181.1\|WP_010228026.1\|2320626_2321289_-\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	8.7726e-56

>NZ_CP012181.1|WP_060576469.1|2315031_2315898_-|LysR-family-transcriptional-regulator
MRAFVALADQGSVRGAAARLVVTESTVSAAVRALAEEVGVPLVERDGRGVRLTPAGHRYAGYARRVLGLLEEGAAAARGEADPEHGRVRLAAVTTAGEHLLPDLLAGFRDRHPGVTLEVDVAPSDRVWPMLAHHEVDVAVAGRPPAAATGPGASGPPLVRAVRENTLVVVGAQAAEHDPARATWLLREPGSGTRATQEALLADLGVDPPRLLLGSHGATVAAARAGLGITLVSRDAVRRFLADGELTELAVPGTPLDRPWHVVTHPDATASTALLLAHVLATAPWHAR
>NZ_CP012181.1|WP_060574972.1|2313379_2314612_+|cytochrome-P450
MTASTEPRDLLSPDLTADPYAAYGRMREEAPAVTVTMMGTPPAVMVTRHDDVRTVLTDPRFVTDVELVGGAESMREAMFEKLGVPDDLAGYLLRNILTTDGAEHARLRKLVSRAFTVKRVQALRPRVEEITARLLDRIGDAGRVDLVETFGYPLPITVICELVGVPDGEREQWHEWGRVLASMDPQRVPAVLRAAVDHVHALVDARRAEPADDLISALVAAQDDDGDRLTDREMVTMIFALVMAGHETTAHLISNGALALLTHPDQLAVLRERPELWPQAVDELMRFRGPVQFTQFRYPTEDVELGGVAIPAGTPVIAGLLPANHDPRAYDRPDELDVGRDTGRGDGHLGFGRGAHYCLGAALARQEGEVALRMLFDRFPSLALDAPAAEILWVPRPGFSRVGELPVRVS
>NZ_CP012181.1|WP_060574970.1|2311738_2312512_-|enoyl-CoA-hydratase/isomerase-family-protein
MSDYEHLLVKQDGDTVRITMNRPQRRNSLTEGHLRELLDAFESAGRTDATGIVLAGEGKAFSSGHDFGDVADRDLAGVRELLRLCTTVMRTVQEVPQVVVARVHATAWAAGCQLVASCDLAVAAESASFALPGGKGGWFCHTPAVPVARTVGRKRLMELALTGDAIDAATAADWGLVNYAVPDDELDTRVDELLARATRGSRLSKAVGKQTLYAQLDRPEADAYAIATEVMASMSQSGGAREGMASFLGKRAPVWPD
>NZ_CP012181.1|WP_010242595.1|2310823_2311714_-|transporter-substrate-binding-domain-containing-protein
MSDPSLLSRRRLFGAAAALGGAALLAGCGRESGDALTRLRAGGDVVVGLSGERPFGFTDGSGRPTGESPEVARAVVGEIGGGGLVAVQLAFDQLVPALLDGRFDMIAVGLTVTPLRCQQVAFSRPDYIARTGLLVPTGNPLGVATLGGVRRSGATLGVLRSSAEQEYAYAARIPNEKIVTFDSQGALVRGIARQEAQVGALTRISLQDEVRRNAGIGLEVTGGFEPEVNGRPVVGAGAFAFRPADTGFREEFDRGLTALQESGRWLEAARPFGFTEENVPPRGLTIDDLCARTPES
>NZ_CP012181.1|WP_082398802.1|2309717_2310788_-|hypothetical-protein
MSLRIAGIPVPGPSDLLSGAASVVDRTGELAETVAGLPSRAGELLDEVGSLVGRIGTIATRAEALLDRVDGVVDRAEDLIGTVGSVAAEATDVVARVRPVADRADELVARVSTVADDADSLVERVTGVAENADGLVRKVTTVADDADGLVRRVTTVAENADGLVQKVTTVSEDASGLVRRVTTVSERADGLVEQVSAVAGNAEGLVARVDAVAGNADGLITTVTTVSDRAGDLITQVERVTGSATTVVDQASGISDRAGELVDLYAPLARRAAPLATKFLDELSEDEVHAAIRLVDQLPVLTEHLEDDILPILATLDRVGPDVHELLDVLKEVRQAIIGIPGFKLLSRRGGEKDDS
>NZ_CP012181.1|WP_010242591.1|2308964_2309702_-|FHA-domain-containing-protein
MQQRPSAEHTLFVQTLAGSATFGPKEGREVLFGRNRPLVHLTLGEDDPQVSREHGRLRFTGGRWWLSNSGRTGIRFPAGTELRPGGEPVPVPPGYTLVTVLGSPGREHALEVRVSGPDRVRPLPRHDDSTRVPRPWPLDGDERLAALALARRYLQNDPRPAPQSWRQVSDEMQQADPGGGWTHRRAEHTVRAIRERLSAAGVAGLLASEIEPPVGNRLNENLVAELIRTNTVTEPDLDELDREPG
>NZ_CP012181.1|WP_060574969.1|2307045_2308968_-|serine/threonine-protein-kinase
MTAPLVEGTVVAGRYEVRERLGAGGMGVVHRARDTALDRDVALKQVQTGAAAEDGAAAMRRLRREAQVAAQLHHGRIVTVFDVLELPAGPLLVMEYVPSAGLDALLTGTGPLAPGAAARIGAQVAEALAALHTAGIVHRDVKPGNVLVSDDGPVKLTDFGISLIPGRHSLTVGTLGTPAYFAPETARGDEPAAPADVYGLGATLRVAVDGEPPFGWADDSPLALIRRIADADPVPPPALDGPLGALLATMTAADPAARPTAAEAARRLWALADRDEPEPAAPADPGPTARRTTTPEVRPDDPTDPPGHATADGPVAARRRRLLFGGAAVVAVVAVVAAVALIPQERGADAPAPAPVALPASVPPLAAGDQRTADPCLADPAALAPFAPAVREPDYGNLAACSIVFVVGGDDAGGVDIRYRRATGSPPEGEQQRLGDAVLVRRPAEGTSCMRFLWLDDGTQVSISADHDAGRTRGLDPCAAAEAAAASAATRLAADGIPRRPVPPPGGSVLWTTDACGTLRPEDLTMLPAPARTDSYRDFAGWSCSWDAGDAGADLQLTVSFDRYDTPSATGQPLAGTAAFVRDDGPDACNGEVPVREFTGTNGRPMAELVRVKAEEGGRSTSQLCELAGRLADTAAARVR
>NZ_CP012181.1|WP_060633658.1|2305008_2307027_+|protein-meaA
MPYPTDRERDRPWVIRTYAGHSSAEKTNELYRRNLAKGQTGLSVAFDLPTQTGYDPDDELAKGEVGKVGVPVSHIGDMRALFDGIPVAEANTSMTINAPAMWLLSLYVAVAEEQAEQQGLDYSEVRAKLAGTTQNDIVKEYLSRGTYVFPPGPSLRLITDMVAWSVTEIPKWNPINICSYHLQEAGATPTQELAYALSTAIAVLDSVRDSGQVPPEKFGDVVGRISFFVNAGLRFVEEMCKMRALARLWDEITLERYGVENPKQRRLRYGVQVNSLGLTEAQPENNVQRIVLEMLAVTLSKDARARAVQLPAWNEALGLPRPWDQQWALRMQQVLAYETDLLEYEDIFDGSRVVEAKVSELVEGARAEIDRVQEMGGAVAAVESGYMKGELVSSLAAYRREMESGDRVVVGVNKFDTTEPSPLQAEGAGAIFTVDPETERSAIEAIGRWRSERDAAAVDESLRALRDAAKTEQNLMQVSIDCAKAGVTTGEWAGALREVLGEFRAPTGVSSASASGEGAGEIAEVRERVRATGDELGQRLRMLVGKPGLDGHSNGAEQVAVRARDVGFEVVYQGIRLTPSQIVAAAVQEGVHAVGLSVLSGSHLEVVPAVVQGLRDAGAGDIPVVVGGIIPPEDEKRLREGGIAAVFTPKNFRLTGMMDEIVTLVRDAQGLS
>NZ_CP012181.1|WP_010224404.1|2304457_2304796_-|hypothetical-protein
MEMDVVPRLGTIVGLVVVLVAIGLLLRWTFGHQKNVTLPTDDPDDPVATGLLTEVSRVPGKDAARILRDRLRAQGIRATITPGSDDRGGFALLVFPKDVPDARVVLSRGALD
>NZ_CP012181.1|WP_082398801.1|2303598_2304450_+|DUF1206-domain-containing-protein
MVSTPDAADVSRAGRRAASGARDVAHSTPVRIAARVGIAANGVLHLLIGWLAVQVALGSGAQADQNGALGAIAAEPLGRAFLWVLVVGFAAVVLWRAVSAVWGFGYVGDRSRRLVKRVVSAGQAVVYAVLAVAAAPTALSGRASSGGGGQATAGLLGLPGGQIVTALVGLGVLVGGGVMVWNGWQQRFLEDQDLAGADRRVRRLDARTGQIGFIAKGVAIGVLGILVGVAALTFDPARANGLDSALKALREQPYGVFLLVAVGLGIACYGVFCFFDARYHRVT
>NZ_CP012181.1|WP_082398804.1|2316445_2317483_-|AAA-family-ATPase
MPSTERAGARPGTGPAGAGAVSTRIAFGAAAPRPADPDPVSGSLSDDGGPELAPGDTVDLGEVRRAAGVDDVLDALDRELVGLAPVKQRLRELAALLVVDRVRARFGTATDRPTLHMCFTGNPGTGKTTVAQRMAGLLHGLGYLRRGHLVTATRDDLVGQYVGHTAPKTKEIVQKALGGVLFVDEAYYLHRPGNERDYGGEAIEILLQAMEDHRDDVAVILAGYADRMDTFFTANPGMQSRVAHHVDFPDFSVGELAEIGQRMVSDLDLELSGEARTTLHEYLTLRVEQPWFAGARSVRNALDRARMRQALRLSAGTGRIGLPELRTLTAADLRASRVFDGGLSR
>NZ_CP012181.1|WP_010228019.1|2317469_2317928_-|ribulose-bisphosphate-carboxylase-small-subunit
MRITQGTFSFLPDLTDDEITAQIGWALDHGWPCAVEFTDDPHPRNTYWEMWGMPMFDLADPAGVLAEIDACRREHPENYVRVNAYDASLGRQTVALSFLVQRPSEEPGFRLDRAEGGDRRIGYTVHPYATERPSGARYPVTGGHDGNGRAEH
>NZ_CP012181.1|WP_010228021.1|2317942_2319373_-|form-I-ribulose-bisphosphate-carboxylase-large-subunit
MSDRWSAGVIPYAEMGYWQPDYEPKDTDLLCAFRVTPQDGVPPEEAGAAVAGESSTATWTVVWTDRLTTYEHYQAKCYAVEPVPNTPGQWIAYIAYDLDLFEEGSIANLTSSIIGNVFGFKPLKALRLEDMRIPAHYVKTFPGPPHGIVTEREYLDKFGRPLLGATTKPKLGLSARNYGRVVYEALRGGLDFTKDDENINSQPFMRWRDRYLACMEAVNRAQAATGEVKGHYLNVTAATMEDMYERAEFARELGSVIVMVDLTVGYTAIQSLSTWARRNGVILHLHRAGHGTYTRQKNHGVSFRVIAKWMRLAGVDHIHAGTVVGKLEGDPNAVAGFYDVLRKGRYAADPVKGLYFDQDWVSMPATMPVASGGIHAGQMHQLLHHLGEDTVLQFGGGTIGHPMGIAAGAEANRVAVEAMIKARNEGADYLAQGPEILRAAARRNRPLETALATWGDVTFDYASTDTPDVVSTPTPA
>NZ_CP012181.1|WP_082538266.1|2319397_2320630_-|GAF-domain-containing-sensor-histidine-kinase
MTAAGRGLGLGDPERENAVLLGIIEATASGPGVEPLAAAVARMITEATATDVCFVHVLDDTDTALTLAGATPPFDARVGTVHLPLGHGVSGWVAAHRTPAVITDDKTSDPRYLPIPELRGQDYTSMVSVPMLSEPYGLAGVLNVHTVDRREFGDRDVRLLLAIGRLLAAALHQARMHRRLRAREQAHERFAEQTVAAQETERRRLARDIHDGISQRLVTLSFHLDAAGTLLGHGDTGGARTELACAAGLVGTTLDEARAAIGALRPPVLDDLGLAGALAALAREVPELDVRLDLDERRLPDHVEVALYRIAQEALQNVQKHAGAHRVVVRLAADDGGVRLDITDDGGGFATHGGPPGGYGMASMRERAELIGGTLRVRARPGSGTTVVVTAPGDTEPIDEESARNTRLSD
>NZ_CP012181.1|WP_010228026.1|2320626_2321289_-|response-regulator-transcription-factor
MTQATPLRLVVVDDHEMVVQGLKAMLAPFRGRVRVVGTAHDVTAAMDAALSLAPDIVLCDVRMAGDSGLDLCRRLHDRLPGQKVVLLSVYDDEQYLFQALRAGAAGYLLKRIGGEELVRQLELAATGVTVVDATMAGRAAASAARLERNEFWPGARLGLTHRESEVLALLVAGHSNRSVAAELVIGEETVKSHVRSVLRKLDVPDRTAAVAAALREGVFR
>NZ_CP012181.1|WP_010228028.1|2321397_2322342_+|phosphoribulokinase
MPDKSLRIRRAGPEEARRRPIMLAIAGDSAAGKTTLTRGLVEALGPDRCVSLCTDDYHRYDRAERRDLPFTALHPDCNFVEIMEQHLQLLATGEPVLKPVYDHSTGELARPEPVEPAEVVIVEGLLPLHSKLSRACFDVTVYLDPPEEIRRDWKVQRDCAKRGYTPDQVLAELDRREPESAEHIRPQRRHADLVVRFAPIESRDDPEGTPLSATVMLRPTIPHPDLSGVMQPGLTRAMHLKLERDPDGRPVESLHVHGYVPHEESVAVEKSIWAEMGDAGRDTPDCLGRVGDGRSEPLAIAQLLILFHLMELGR
>NZ_CP012181.1|WP_060574973.1|2322338_2323100_+|HAD-IA-family-hydrolase
MSAPEAVLFDVDGTLAETERDGHRPAFNRAFAEHDLGLHWTPAHYTRLLRVPGGRQRIAADLRTRGVPGVEADRVAAAVHRTKTALFAEHARSGSIPARPGVRTLVADLRRHGTRIGVVTTGRREWAEPLVRHLIGDVAGALDVAVYGDDVTALKPDPQAYRLALRRLGLPASCAVAVEDSAPGLQAALGAGLMTVVVRSEPTAGHDARGAALVRDSFDGDPPLDAVLLRELLTAAEDQALAARRSSCRRSSA
>NZ_CP012181.1|WP_060576472.1|2323051_2323558_-|NUDIX-hydrolase
MTVREDGIRLSDGTEGIYGVVDKPTYALVVPRDDDGRLHLVEQFRYPVGERRWEFPAGTAPDRADQDPAELAVRELAEETGLAASSMALLGTLDCAPGMSSQRGHVYLATGLTEGPPRREHQEQDMRAAWFTAVEFERMILDGRLTDAQTLAAYALLRLHDERRAASA
>NZ_CP012181.1|WP_060574974.1|2323665_2324325_+|endonuclease-NucS
MRLVIARCQVDYAGRLTAHLPMAPRLLLVKADGSVSVHADDRAYKPLNWMSPPCWLTEEPGVWTVKNKADESLVITIDEVLHDSSHELGVDPGLVKDGVEAHLQELLAAHPETFGDGWTLVRREYMTAVGPVDLLCRDGDGGHVAVEIKRRGEIDGVEQLTRYLELMNRDPLLAPVQGVFAAQQIKPQARTLATDRGIRCLTVDYDELRGMTSKDMRLF
>NZ_CP012181.1|WP_060574975.1|2324338_2324761_-|hypothetical-protein
MPIASILLAALVVTGCAAGRTEGAAPAATGVPTTASAPPTTTAAPDPTCTGSMERRTDGRTSTNFGGGAGGTLQTSDAGTFVSCGDGPRIRIRIDPGAALVASFEGRDVRIGERRSDAVGPYRVAVTSLTGNAVRFTVTP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP012181_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012181_6

4656620-4656748

Orphan

Consensus_repeat	Method
CGGTCGTCCCCGCGCCGGTCGTC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP012181_6

>merge|NZ_CP012181|6|4656620-4656748|CRISPRCasFinder
CGGCCGGCACCCGGCCGGTCGCGGCGATCGCCCGAGCGGTCGTCGCGGCGGCCACGCGGACGGTCGTCCCCGCGCCGGTCGTCCCCGCGCCGGTCGTCCCCGCGCCGGTCGTCCCCGCGCCGGTCGTCC

>NZ_CP012181|6|6|4656620-4656748|CRISPRCasFinder
CGGCCGGCACCCGGCCGGTCGCG	GCGATCGCCCGAGCGGTCGTCGCGGCGGCCACGCGGA
CGGTCGTCCCCGCGCCGGTCGTC	CCCGCGCCGGTCGTCCCCGCGC
CGGTCGTCCCCGCGCCGGTCGTCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012181.1\|WP_060572340.1\|4669643_4670564_-\|ornithine-carbamoyltransferase	unknown	unknown	gnl\|CDD\|234835
NZ_CP012181.1\|WP_060572330.1\|4648110_4649028_-\|copper-transporter	unknown	unknown	gnl\|CDD\|378653
NZ_CP012181.1\|WP_075294904.1\|4646310_4648086_-\|CTP-synthase	unknown	unknown	gnl\|CDD\|235437
NZ_CP012181.1\|WP_010225541.1\|4666382_4667606_-\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	unknown	unknown	gnl\|CDD\|372371
NZ_CP012181.1\|WP_060572338.1\|4667602_4669012_-\|argininosuccinate-lyase	unknown	unknown	gnl\|CDD\|179143
NZ_CP012181.1\|WP_029239252.1\|4672711_4673884_-\|bifunctional-glutamate-N-acetyltransferase/amino-acid-acetyltransferase-ArgJ	unknown	unknown	gnl\|CDD\|235441
NZ_CP012181.1\|WP_060572334.1\|4654483_4655503_-\|HAD-hydrolase-like-protein	unknown	unknown	gnl\|CDD\|319832
NZ_CP012181.1\|WP_060576169.1\|4665635_4666310_-\|DNA-3-methyladenine-glycosylase	unknown	unknown	gnl\|CDD\|376746
NZ_CP012181.1\|WP_060572332.1\|4653183_4654008_-\|TlyA-family-RNA-methyltransferase	unknown	unknown	gnl\|CDD\|224110
NZ_CP012181.1\|WP_168170482.1\|4664355_4665627_-\|tyrosine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235645
NZ_CP012181.1\|WP_060576168.1\|4650330_4652175_-\|DNA-repair-protein-RecN	unknown	unknown	gnl\|CDD\|223571
NZ_CP012181.1\|WP_010225551.1\|4671753_4672680_-\|acetylglutamate-kinase	unknown	unknown	gnl\|CDD\|234869
NZ_CP012181.1\|WP_060633749.1\|4657074_4658730_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236766
NZ_CP012181.1\|WP_060633750.1\|4670563_4671757_-\|acetylornithine-transaminase	unknown	unknown	gnl\|CDD\|235112
NZ_CP012181.1\|WP_060572326.1\|4644343_4645333_+\|DUF1707-domain-containing-protein	unknown	unknown	gnl\|CDD\|377959
NZ_CP012181.1\|WP_193408788.1\|4673880_4674915_-\|N-acetyl-gamma-glutamyl-phosphate-reductase	unknown	unknown	gnl\|CDD\|234761
NZ_CP012181.1\|WP_010226912.1\|4654010_4654217_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012181.1\|WP_029239821.1\|4649024_4650200_-\|thiamine-pyrophosphokinase	unknown	unknown	gnl\|CDD\|227162
NZ_CP012181.1\|WP_145982812.1\|4645348_4645921_-\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|239516
NZ_CP012181.1\|WP_010226916.1\|4652275_4653187_-\|NAD-kinase	unknown	unknown	gnl\|CDD\|235121

Protein	Function_ID	Function_description	E-value
NZ_CP012181.1\|WP_060572340.1\|4669643_4670564_-\|ornithine-carbamoyltransferase	gnl\|CDD\|234835	PRK00779, PRK00779, ornithine carbamoyltransferase; Provisional.	0
NZ_CP012181.1\|WP_060572330.1\|4648110_4649028_-\|copper-transporter	gnl\|CDD\|378653	pfam11382, MctB, Copper transport outer membrane protein, MctB. Outer membrane channel protein MctB in Mycobacterium tuberculosis is part of a Cu resistance mechanism that ensures low intracellular Cu levels in the bacterium. Human resisitance to bacteria, mediated via IFN-gamma-mediated activation of macrophages, may involve the use of reactive Cu(1) in the presence of hyrodgen peroxide, since acitivated Cu is toxic to bacteria. IFN-gamma stimulates the trafficking of the Cu transporter ATP7a to the vesicles that fuse with phagosomes and these phagosomes are found to have a high Cu content and an increaseed bactericidal activity against E.coli. Using MctB, Mycobacterium tuberculosis may limit the amount of excess Cu within it whole in the host.	1.1684e-50
NZ_CP012181.1\|WP_075294904.1\|4646310_4648086_-\|CTP-synthase	gnl\|CDD\|235437	PRK05380, pyrG, CTP synthetase; Validated.	0
NZ_CP012181.1\|WP_010225541.1\|4666382_4667606_-\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	gnl\|CDD\|372371	pfam12897, Aminotran_MocR, Alanine-glyoxylate amino-transferase. These proteins catalyze the reversible transfer of an amino group from the amino acid substrate to an acceptor alpha-keto acid. They require pyridoxal 5'-phosphate (PLP) as a cofactor to catalyze this reaction. Trans-amination reactions are of central importance in amino acid metabolism and in links to carbohydrate and fat metabolism. This class of aminotransferases acts as dimers in a head-to-tail configuration.	0
NZ_CP012181.1\|WP_060572338.1\|4667602_4669012_-\|argininosuccinate-lyase	gnl\|CDD\|179143	PRK00855, PRK00855, argininosuccinate lyase; Provisional.	0
NZ_CP012181.1\|WP_029239252.1\|4672711_4673884_-\|bifunctional-glutamate-N-acetyltransferase/amino-acid-acetyltransferase-ArgJ	gnl\|CDD\|235441	PRK05388, argJ, bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ.	0
NZ_CP012181.1\|WP_060572334.1\|4654483_4655503_-\|HAD-hydrolase-like-protein	gnl\|CDD\|319832	cd07530, HAD_Pase_UmpH-like, UmpH/NagD family phosphatase, similar to Escherichia coli UmpH UMP phosphatase/NagD nucleotide phosphatase and Mycobacterium tuberculosis Rv1692 glycerol 3-phosphate phosphatase. Escherichia coli UmpH/NagD is a ribonucleoside tri-, di-, and monophosphatase with a preference for purines, it shows peak activity with UMP and functions in UMP-degradation. It is also an effective phosphatase with AMP, GMP and CMP. Mycobacterium tuberculosis phosphatase, Rv1692 is a glycerol 3-phosphate phosphatase. Rv1692 is the final enzyme involved in glycerophospholipid recycling/catabolism. This subfamily belongs to the UmpH/NagD phosphatase family, and to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	1.05301e-90
NZ_CP012181.1\|WP_029239821.1\|4649024_4650200_-\|thiamine-pyrophosphokinase	gnl\|CDD\|227162	COG4825, COG4825, Uncharacterized membrane-anchored protein conserved in bacteria [Function unknown].	3.51748e-133
NZ_CP012181.1\|WP_060572332.1\|4653183_4654008_-\|TlyA-family-RNA-methyltransferase	gnl\|CDD\|224110	COG1189, COG1189, Predicted rRNA methylase [Translation, ribosomal structure and biogenesis].	4.36733e-104
NZ_CP012181.1\|WP_060576169.1\|4665635_4666310_-\|DNA-3-methyladenine-glycosylase	gnl\|CDD\|376746	pfam02245, Pur_DNA_glyco, Methylpurine-DNA glycosylase (MPG). Methylpurine-DNA glycosylase is a base excision-repair protein. It is responsible for the hydrolysis of the deoxyribose N-glycosidic bond, excising 3-methyladenine and 3-methylguanine from damaged DNA.	1.41929e-80
NZ_CP012181.1\|WP_168170482.1\|4664355_4665627_-\|tyrosine--tRNA-ligase	gnl\|CDD\|235645	PRK05912, PRK05912, tyrosyl-tRNA synthetase; Validated.	0
NZ_CP012181.1\|WP_060576168.1\|4650330_4652175_-\|DNA-repair-protein-RecN	gnl\|CDD\|223571	COG0497, RecN, ATPase involved in DNA repair [DNA replication, recombination, and repair].	9.55104e-180
NZ_CP012181.1\|WP_010225551.1\|4671753_4672680_-\|acetylglutamate-kinase	gnl\|CDD\|234869	PRK00942, PRK00942, acetylglutamate kinase; Provisional.	6.19669e-157
NZ_CP012181.1\|WP_060633749.1\|4657074_4658730_+\|hypothetical-protein	gnl\|CDD\|236766	PRK10811, rne, ribonuclease E; Reviewed.	2.67856e-07
NZ_CP012181.1\|WP_060633750.1\|4670563_4671757_-\|acetylornithine-transaminase	gnl\|CDD\|235112	PRK03244, argD, acetylornithine transaminase.	0
NZ_CP012181.1\|WP_193408788.1\|4673880_4674915_-\|N-acetyl-gamma-glutamyl-phosphate-reductase	gnl\|CDD\|234761	PRK00436, argC, N-acetyl-gamma-glutamyl-phosphate reductase; Validated.	4.83564e-170
NZ_CP012181.1\|WP_060572326.1\|4644343_4645333_+\|DUF1707-domain-containing-protein	gnl\|CDD\|377959	pfam08044, DUF1707, Domain of unknown function (DUF1707). This domain is found in a variety of Actinomycetales proteins. All of the proteins containing this domain are hypothetical and probably membrane bound or associated. Currently, it is unclear to the function of this domain.	2.58826e-14
NZ_CP012181.1\|WP_145982812.1\|4645348_4645921_-\|NUDIX-hydrolase	gnl\|CDD\|239516	cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate. Like other members of the Nudix hydrolase superfamily, it requires a divalent cation, such as Mg2+, for its activity. It also contains a highly conserved 23-residue Nudix motif (GX5EX7REUXEEXGU, where U = I, L or V) which functions as a metal binding site/catalytic site. In addition to the Nudix motif, there are additional conserved amino acid residues, distal from the signature sequence, that correlate with substrate specificity. In humans, there are four distinct ADPRase activities, three putative cytosolic enzymes (ADPRase-I, -II, and -Mn) and a single mitochondrial enzyme (ADPRase-m). Human ADPRase-II is also referred to as NUDT5. It lacks the N-terminal target sequence unique to mitochondrial ADPRase. The different cytosolic types are distinguished by their specificities for substrate and specific requirement for metal ions. NUDT5 forms a homodimer.	1.72671e-45
NZ_CP012181.1\|WP_010226916.1\|4652275_4653187_-\|NAD-kinase	gnl\|CDD\|235121	PRK03372, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional.	1.589e-154

>NZ_CP012181.1|WP_060572334.1|4654483_4655503_-|HAD-hydrolase-like-protein
MTDDLLSRHDVLLADLDGTLYRGPDVVPGAVEAVRSAELRGVPTVYVTNNASRSPSTVAGHLADLGFPARVADVRTSAQAGAAMLAERLPSGATVLVLGTPALADEVRERGLVPTGTGEGADAVVQGHSPDTGWRQLTEAVLAIRAGALWVATNVDLTLPTERGPLPGNGSMVQVVRNASGVEPAVAGKPGARLLCEGQGDADRPLVLGDRLDTDIEGANALGAPSLMVLTGVSGAADLLAAPPALRPTYIGADLAALTRHPDELVPGARDGWRAEIDGDALVLSGDGHGDEPVVDALRVLCAAAWEHGTHRVTASGDVAAGVLHELGLADRRADRRAD
>NZ_CP012181.1|WP_010226912.1|4654010_4654217_-|hypothetical-protein
MSVPTPGPRPGDPRPPEQRPVADLRADVDEAVAGLDSLAERPVSEHPEAFERVHSALGRALTAGSERG
>NZ_CP012181.1|WP_060572332.1|4653183_4654008_-|TlyA-family-RNA-methyltransferase
MAPTRSRLDAELVRRRLARSRGQAAELIAAGRVSVNGMPAGKAATVVDRDAPVVVRPDDDGEPEWASRGAKKLLGALDAFTGVDPAGLRCLDAGASTGGFTDVLLTRGAREVVAADVGYGQLVWRLQSDERVHVHDRTNVRALEPDAIGGPVDLTVADLSFISLRTVLPALTACTAPGGDLLPMVKPQFEVGKQRLGSGGVVRSPELRTETLREVAATAVDLGLVVLDATASPLPGPSGNVEYFLHLHRPGAGGATTAPDLEPLLTGAVAGGPA
>NZ_CP012181.1|WP_010226916.1|4652275_4653187_-|NAD-kinase
MREILLVLHTGRPANRKTALNVMNELARLGLRVRVLADEWAELGADPDVPEDFTPVQVPGSPECARGAEAVLVLGGDGTLLRAADLARPAGVPLLGVNLGHVGFLAEAEEDTLDEALEKLAAGDYEVEERTTLEAVVRSNGTVLGRTWALNEAVVEKNTRGRILEVVLEVDGRPVSSFGCDGVLCSTPTGSTAYAFSAGGPLIWPQVQALLVVPSNAHALFARPMVIAPDSAVAIEVSADGPSAVLDCDGRRTVSVPPGSRVELSRATEPVRMVRLAAQPFADRLVRKFDLPVRGWRGRGSNT
>NZ_CP012181.1|WP_060576168.1|4650330_4652175_-|DNA-repair-protein-RecN
MLSEMRIQGLGVIDDATLELDPGLTVLTGETGAGKTMAVTGLNLLGGGRAESSRVSAGARRAVVEGRFTASPGALALAEEVGAEADDDGTLIAARTVSADGGSRAHLGGRSVPNGVLGRLAEAQLAVHGQNDQLRLLRGSDQRALLDRFAGDPVATPLAAYRAVRAEWLEIVTELAERRDNARRLAQEADMLRHGLAEIDSVDPQPGEDRALVDQARRMVEADDLRSAAEGTRMALSGSDDGETPGAVGLAGQAKGLAEGSDDPALAGLGPRLAEAIAVLADAAAEVSVYLDGLDADPERLSQVLARQAELKSLTRKYAADTDGVLDWAATARDRLAGLDTSDEALADLARRRDELARDLAGHAAEVTAARTEAAGRLAEATTAELAGLAMKDAQLQVGVAPRPAGDGGPSLVVGGRECHAGSGGVDEVEIRLVPHAGASAQPLHKGASGGELSRVMLALEVALAGSDPVPTMVFDEVDAGVGGRAAVEIGRRLARLAARHQVIVVTHLPQVAAYADRHLVVHKASGEEGVTRSSVTRLSEEERTQELARMLAGMDDTDTGRAHAEELLAAATAHRQADRAAEQPADLAQARSRRAGATRGGSGTRRRKVAQAG
>NZ_CP012181.1|WP_029239821.1|4649024_4650200_-|thiamine-pyrophosphokinase
MKLSGLLHRTRPELPGLTGPARTDRRTEALLRRLRPGDIVVLDQVDLDRATADALVAARVAAVVNASPSISGRFPNLGPQVLVEAGVPLVDDCGTEIMRSVKDGAKVRLHEGVLYSGEQPLGEGREQTEDTVADALDEAKQGLTHQLEAFAANTTEFMRRERSLLLDGHGVPEIDIALDGRPVLVVAAGFEYAGVLKRLRAYIKEYRPVLVGVGAGADALVNAKYRPDLIVADPSEVSNQALTSGADVVVPAFPDGHAPGLHRVQDLGASAVTFPSMANPEDLALLLAHHRGASMIVTVGLSASMAEFLDRGRSGSNASTFLTRLQAGGSVVDGEMIAQMYRSRTSFAPLLLLIAAALVAVVVAVLVSGAGPAVLEWAGGLVETVRSWFPA
>NZ_CP012181.1|WP_060572330.1|4648110_4649028_-|copper-transporter
MISRRYHRIALVAVFVLALAAGVAVATVGLPQRIASTVASTTGTGEIDQLRTERDTLAAQQRASDEFTARTAPGLVREKLAGVPVTVVALGADPADTRAVAELITTAGGSVAGEVVLTPAVTDPARADQLRDLSARLLPAGAQLPASSDAGALAGGLLGSALLAPQGGAAPDPQQAGAVVAGLAGGGFAETPEGELSAGRLAVVVTGGAFGGVDAAGSAATAAGLADELDRRGAGAVLAGRDAGPSSAVGAVRADAGQGPGPSTVDGVGTSAGRVATVLALAERNAGRAGQYGSGAGSTGPVPTL
>NZ_CP012181.1|WP_075294904.1|4646310_4648086_-|CTP-synthase
MQTRATRHLFVTGGVASSLGKGLTASSLGQLLTARGLRVTMQKLDPYLNVDPGTMNPFQHGEVFVTEDGAETDLDVGHYERFLDRDLQGRANVTTGQVYSEVIAKERRGEYLGDTVQVIPHITNEIKDRVLAMAEPDAEGIAPDVVITEVGGTIGDIESLPFVEAARQVRHEVGRDNCFFLHVSLVPYLAPSGELKTKPTQHSVAALRNIGIQPDALVLRADREIPGAMKRKISLMCDVELDGVAACADAPSIYDIPKVLHGEGLDAYVVRRLGLPFRDVDWTVWGDLLERVHHPQETATIALVGKYVDLPDAYLSVTEALRAGGFAHHAKVAVRWVPSDSCETPAGAAEALDGVDAVLVPGGFGIRGIEGKLGAITHARTRGIPTLGLCLGLQCMVIEAARSIAGLDGASSSEFDPDTEHPVISTMATQRDVVAGERDMGGTMRLGAYPAVLQPGSVAAKAYGAREISERHRHRFEVNNAYRQQLADAGLVFGTSPDGTLVEFVELPASQHPFFVGTQAHPELKSRPTRPHPLFAAFVKAALRYRAEDRLPVRLPGRANGDDDAELVEGDEPAGSTGTNGSVPAESTPGS
>NZ_CP012181.1|WP_145982812.1|4645348_4645921_-|NUDIX-hydrolase
MALRSDRVVMPGGRVATREILEHPGAVAIVAVDEHRRVRMLHQYRHAVRRRLWELPAGLLDVAGEDPAVTADRELTEEAGLTASDWSVLLDVVPSPGFSDESVRIFLARDLVEKPRPDLGDDEEADLELRWIALEDAVGMVFSGEIVNAVSCAGLLAARSVLAGEFEPRPPGTAWTDRPERFARRRDGDD
>NZ_CP012181.1|WP_060572326.1|4644343_4645333_+|DUF1707-domain-containing-protein
MSTRPIGYAEQEDAVRALSRHYTGGRLDVDAFDDRVRRARAATTVADLAPLFGDLPEPHPDALRDTGGASGASTDGTPTDTGSPDRAGDGDTGTGGAEATARIRPPDPTLSAPAEPDPSGHPAAGPYPDSSPTTGQPHPGSPWSAYDDSPAHGGDAYGAPGGPAGPAGPGYGAPGYGPPGPDTPGYGAGYGAGFEGGWGAAGYQPGYGPGPGQAPGAPGWAPGPGGPAYPPHAGPPAYGPYGYDPAAPFGREAWSGRPYSDKQKIVAGLLQLFLPFGIGRFYSGHTGLAIAQLLVMIFTFGLGAIWSFIDGIVILAGSPTDPDGRPLRP
>NZ_CP012181.1|WP_060633749.1|4657074_4658730_+|hypothetical-protein
MATEVALGRPVGTAGPRRGCAVLDGTVVPVGGPCIAQVAVSTVAERTGATGVVAIAGRATTSLVPVVAATERTTTTIVTLVVAVTGRTAVPVVPVVPGAGRPAATIVPIAERTAATVVAAEGPTAPIVAVTGRTAGTPVVAVPGRTPTAVVPVVTVPERAATAVVPVAVRAPTAVVTVVTAADRPTTAVLAVTTGTRATVVTITSGTPAPVITITERTATAVVPASLGAARAVAVVTGPVRLPATVVVTAGAATVVAERPSTAAGGTAPVVPVAAVPATTIVPTATCVATGTAAPVVVTEASTASVVTAGGTPVAAAERVAPSPIVVRTTAAVVAIAIGPTPRTVTLARRTVVASTVGATAPVAGESAARATPAVTGRAVVPSPPVAVRTVVARSSVVALATAGTPVGPPRPRAPAVRTIAAPATRTVTVVSRPVPAAVVAARTVVAVPSPTAVPAGVAAPSPVVGTRPPGAGTRSTTGRALAPPTFVASPAVAGTIPVRHVVRVQTNTVASAVADRTGRTAPRTSRERTRTRKKGSPLGDSTVADSPFRG
>NZ_CP012181.1|WP_168170482.1|4664355_4665627_-|tyrosine--tRNA-ligase
MGTDILDELEWRGLIAQSTDRDALAKELAGDEPITLYAGFDPTAPSLHAGHLVPMLTLRRFQEAGHRPVILAGGATGMIGDPRDVGERTLNDEATVAEWTGLIRGQLERFVTFDDSPTGALAVNNLDWTGQQTVLEFLRDLGKHFPVNTMLARETVKRRLAGEGMSYTEFSYLLLQSQDYLHLYRELGCRLQIGGSDQWGNIVGGVDLIRRIEGASVHAMTLPLVTDSEGRKFGKSTGGGNIWLDPDRTSPYAWYQYFVNVADADVIGYLKLLTFLDREEIDVLATELADAPHLRSAQRRLATELTTMVHGEEQTRQVTTASQALFGRADLSELDAGTLAAALAEVPTADTGGSDTIVDLLVSTGLTDSRGAARRAVKEGGAYVNNVKVTDEEWVPRAEDALAGGWLVVRRGKRNLAGARLAG
>NZ_CP012181.1|WP_060576169.1|4665635_4666310_-|DNA-3-methyladenine-glycosylase
MDRSELAVDVLPAAERLLGCVLEADTPDGVVAVRLVEVEAYRGRDDPASHSFRGRTPRNAVMFGPPGHLYVYFVYGMHFCANVTCLSDGEPGAVLLRGAEVVTDPGIARLRRPTARTDADLARGPARLASLLGLGRDDNGVDVTDPASRVRLVAGDPVPSGSVRTGPRVGVAAAADLPWRYWVAGSTAVSTYRAGTRAGRRSRSDGGSPDGDPYPDAASRPRRR
>NZ_CP012181.1|WP_010225541.1|4666382_4667606_-|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme
MTDPAAAYEELKAAGLKLDLTRGKPSSEQLDLSNALLGLPGAGDHRAADGTDTRNYGGLKGLPELREIFAPSLQVPVDQLIAWNNSSLELMHDTLVHALLSPLPGATTRWADAGRVAFIAPVPGYDRHYGVCDRLGIDLVSVPMTPEGPDMDEVERLVADDPSIKGIWCVPKYSNPDGAVYSDDVVRRLASMPTAAPDFRIMWDNAYAVHHLTTDEIEIADMLALAAEAGHPDRPFVFGSTSKITLAGAGVAFLGASPANVEWWTALTGKKSIGPDKVNHLRQARFLKDEAGLRAHMAAHRELIAPKFAAVERLLSEAFSDVEGVSWTTPKGGYFVSLTVPDGLATEVVRLAKDAGVVLTPAGATHPGGKDPQDAVIRLAPTLPPQDEVEKAMAGVVTCVQLALSRR
>NZ_CP012181.1|WP_060572338.1|4667602_4669012_-|argininosuccinate-lyase
MSAALWGGRFASGPADALAALSKSTHFDWALAPYDIRGSKAHARVLHRAGLLSDEELSGMHKALDELAADVASGVFGPEPGDEDVHTALERGLIERAGPDLGGKLRAGRSRNDQVATQFRMWLRDATRRVADGVLDVVDALVGQAETHAGAAMPGRTHLQHAQPVLLGHQLGAHAQALLRDVDRLRDWDRRTAYSPYGSGALAGSSLGLDPEAVAAELGFTGSSANSIDGTASRDFAAEAAFVLAMIGVDLSRLSEEVILWATAEFGYVTLDDAFSTGSSIMPQKKNPDVAELARGKSGRLVGNLTGLMTTLKGLPLAYNRDLQEDKEPLFDSVAQLELLLPAIAGMVATLTFHTDRLAELAPAGFTLATDVAEWLVRQGVPFRVAHEAAGGCVRAAEARGVGLDDLTDGELAGVHPALTPSVREVLSVEGSIASRDARGGTAGDRVAEQLTDLRDEAAAAREFTGGTA
>NZ_CP012181.1|WP_060572340.1|4669643_4670564_-|ornithine-carbamoyltransferase
MLRHLLRDDDLSPAEQTELLDLADRLKADRFSERPLEGPKAVAVVFDKSSTRTRVSFEAGITQLGGTAVILDGTTSQLGRGETISDTSRVLSRYVDAIVWRTSGQERIEEMASVATVPVVNALTDRFHPCQILADLQTVRERLGRLAGVTLTYLGDGANNIAHSLLLGGATAGLHVRVSAPAGFTPDPEVVRDAKARAEQTGGSVTLVADPVAAVAGADVLVTDTWTSMGQEEDGLDRIAPFRSYQIGADLLARAAPGAIVLHCLPAHRGEEITDDVIDGPASAVWDEAENRLHAQKALLTWLLRA
>NZ_CP012181.1|WP_060633750.1|4670563_4671757_-|acetylornithine-transaminase
MTTHAQRWQAALMNNYGTPPLTLVRGEGAHVWDAEGRRYLDLYAGIAVNALGHAHPAVVEAVSTQVGTLGHTSNFFITEPALQLAERLQGLLGRVDARTLLCNSGTEANEAAFKIARRTGRPEIVACEGAFHGRTMGALALTGQPAKRAPFEPMPSGVTHIPFGDLAALDAAVTENTAAVFLEPILGEAGVIVPPEGYRAEARRITAERGALLVLDEVQTGIGRTGQWFAHQAHGVVPDVVTLAKGLGGGLPIGACIGIGAAAALLEPGQHGTTFGGNPVACAAALAVLDTVATDGLLEHVGRLGKEIRSGIEGLGHPVVGEVTGAGLHIGIGLISPVAAQAATAARDAGFLINNCTPERLRLAPALTLTDEEAHEFLTAFPAILDAAAAEREGQGS
>NZ_CP012181.1|WP_010225551.1|4671753_4672680_-|acetylglutamate-kinase
MAPSPETPARLKRAGEKAGVLAEALPWLQRFHGRIVVVKYGGNAMIDEELKQAFARDMVFLRLAGIHPVVVHGGGPQISAMLTRLGMPGEFRGGLRVTTPETMEIVRMVLFGQVGRELVGLINQHGPLAVGLSGEDAGLFTAEKRTALVGGDPVDIGLVGDVTEVNPDAVLDIIAAGRIPVVAGIAPDADGQVHNINADSAAAALAGALDAAKLVVLTDVEGLYANYPDPESIITSLTADQLEPMLPRLESGMAPKMEACLRAVRSGVGQAHVIDGRVPHSVLLEVFTHEGVGTMVLPDTPADGVTQE
>NZ_CP012181.1|WP_029239252.1|4672711_4673884_-|bifunctional-glutamate-N-acetyltransferase/amino-acid-acetyltransferase-ArgJ
MSVTAAQGFRAAGIAAGIKKSGRADLALVVNDGPRTEAAGVFTRNKVKAAPVLWSQQVLTTGALRAVVLNAGGANACTGPEGFQTAHATAEKAAEMLGCGAIEVAICSTGLIGEQLPRETVLAGVEKVSGELAATPEAGASVAGAIMTTDTVPKEAQVSDPAGWTVGGTTKGAGMIAPSMATMLSVITTDAVVEQPVLDAALREAVRYSFDRLDVDGSMSTNDTVLVLSSGASGVPADQAVFTAALTRVCRDLAAQMQADAEGVSKRITVRVSGAASEDDAVTVARTIARDALVKTAMFGSDPNWGRIAAAAGYADADIDPETLDITINGVLLCRGAVVAGDRADCDLSGKDVLIEVELGRSGGIEGNTAEIRTTDLSHAYVEENSAYSS
>NZ_CP012181.1|WP_193408788.1|4673880_4674915_-|N-acetyl-gamma-glutamyl-phosphate-reductase
MHVVRIAVAGASGYAGGELLRLLLAHPDVEIGALTAGGNAGSRLGEHQPHLAPLAERVLEESTAERLAGHDAVFLALPHGKSAELAAQLGEDTLLIDCGADHRLTDPAAWDRWYGGEHAGHWPYGLPELPGAREQLVGSNRVAVPGCYPTGTSLALFPALVAGLVAPEVVITAVTGTSGAGKSLKPHLLGAEVMGSLSAYGVGGAHRHTPEITQNLSAALGAPVSVSFTPVLAPLPRGILASCSAPLADPSTDTATVRQTYEKAYAGEPFVRLLPEGQWPTTALTLGSNVVALQMTVDPDAGRLIVVSAIDNLTKGTAGGAVQCMNLALGLPETTGLPTTGVAP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP012181_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012181_7

4657736-4657887

Orphan

Consensus_repeat	Method
CGGTCGTCCCCGCGCCGGTCGTC	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP012181_7

>merge|NZ_CP012181|7|4657736-4657887|CRISPRCasFinder
CGGTCGTCCCGGCCTCCCTCGGAGCGGCCCGAGCGGTCGCGGTCGTCACGGGGCCGGTACGACTGCCCGCCACGGTCGTCGTCACGGCCGGTGCCGCGACGGTCGTCGCCGAACGACCGTCCACCGCTGCGGGGGGCACCGCGCCGGTCGTC

>NZ_CP012181|7|7|4657736-4657887|CRISPRCasFinder
CGGTCGTCCCGGCCTCCCTCGGA	GCGGCCCGAGCGGTCG
CGGTCGTCACGGGGCCGGTACGA	CTGCCCGCCACGGTCGTCGTCA
CGGCCGGTGCCGCGACGGTCGTC	GCCGAACGACCGTCCACCGCTG
CGGGGGGCACCGCGCCGGTCGTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012181.1\|WP_060572340.1\|4669643_4670564_-\|ornithine-carbamoyltransferase	unknown	unknown	gnl\|CDD\|234835
NZ_CP012181.1\|WP_060572330.1\|4648110_4649028_-\|copper-transporter	unknown	unknown	gnl\|CDD\|378653
NZ_CP012181.1\|WP_075294904.1\|4646310_4648086_-\|CTP-synthase	unknown	unknown	gnl\|CDD\|235437
NZ_CP012181.1\|WP_010225541.1\|4666382_4667606_-\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	unknown	unknown	gnl\|CDD\|372371
NZ_CP012181.1\|WP_060572338.1\|4667602_4669012_-\|argininosuccinate-lyase	unknown	unknown	gnl\|CDD\|179143
NZ_CP012181.1\|WP_029239252.1\|4672711_4673884_-\|bifunctional-glutamate-N-acetyltransferase/amino-acid-acetyltransferase-ArgJ	unknown	unknown	gnl\|CDD\|235441
NZ_CP012181.1\|WP_060572334.1\|4654483_4655503_-\|HAD-hydrolase-like-protein	unknown	unknown	gnl\|CDD\|319832
NZ_CP012181.1\|WP_060572346.1\|4675017_4675830_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237030
NZ_CP012181.1\|WP_060576169.1\|4665635_4666310_-\|DNA-3-methyladenine-glycosylase	unknown	unknown	gnl\|CDD\|376746
NZ_CP012181.1\|WP_060572332.1\|4653183_4654008_-\|TlyA-family-RNA-methyltransferase	unknown	unknown	gnl\|CDD\|224110
NZ_CP012181.1\|WP_168170482.1\|4664355_4665627_-\|tyrosine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235645
NZ_CP012181.1\|WP_060576168.1\|4650330_4652175_-\|DNA-repair-protein-RecN	unknown	unknown	gnl\|CDD\|223571
NZ_CP012181.1\|WP_010225551.1\|4671753_4672680_-\|acetylglutamate-kinase	unknown	unknown	gnl\|CDD\|234869
NZ_CP012181.1\|WP_060633748.1\|4655499_4656909_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237171
NZ_CP012181.1\|WP_060633750.1\|4670563_4671757_-\|acetylornithine-transaminase	unknown	unknown	gnl\|CDD\|235112
NZ_CP012181.1\|WP_193408788.1\|4673880_4674915_-\|N-acetyl-gamma-glutamyl-phosphate-reductase	unknown	unknown	gnl\|CDD\|234761
NZ_CP012181.1\|WP_010226912.1\|4654010_4654217_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012181.1\|WP_029239821.1\|4649024_4650200_-\|thiamine-pyrophosphokinase	unknown	unknown	gnl\|CDD\|227162
NZ_CP012181.1\|WP_145982812.1\|4645348_4645921_-\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|239516
NZ_CP012181.1\|WP_010226916.1\|4652275_4653187_-\|NAD-kinase	unknown	unknown	gnl\|CDD\|235121

Protein	Function_ID	Function_description	E-value
NZ_CP012181.1\|WP_060572340.1\|4669643_4670564_-\|ornithine-carbamoyltransferase	gnl\|CDD\|234835	PRK00779, PRK00779, ornithine carbamoyltransferase; Provisional.	0
NZ_CP012181.1\|WP_060572330.1\|4648110_4649028_-\|copper-transporter	gnl\|CDD\|378653	pfam11382, MctB, Copper transport outer membrane protein, MctB. Outer membrane channel protein MctB in Mycobacterium tuberculosis is part of a Cu resistance mechanism that ensures low intracellular Cu levels in the bacterium. Human resisitance to bacteria, mediated via IFN-gamma-mediated activation of macrophages, may involve the use of reactive Cu(1) in the presence of hyrodgen peroxide, since acitivated Cu is toxic to bacteria. IFN-gamma stimulates the trafficking of the Cu transporter ATP7a to the vesicles that fuse with phagosomes and these phagosomes are found to have a high Cu content and an increaseed bactericidal activity against E.coli. Using MctB, Mycobacterium tuberculosis may limit the amount of excess Cu within it whole in the host.	1.1684e-50
NZ_CP012181.1\|WP_075294904.1\|4646310_4648086_-\|CTP-synthase	gnl\|CDD\|235437	PRK05380, pyrG, CTP synthetase; Validated.	0
NZ_CP012181.1\|WP_010225541.1\|4666382_4667606_-\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	gnl\|CDD\|372371	pfam12897, Aminotran_MocR, Alanine-glyoxylate amino-transferase. These proteins catalyze the reversible transfer of an amino group from the amino acid substrate to an acceptor alpha-keto acid. They require pyridoxal 5'-phosphate (PLP) as a cofactor to catalyze this reaction. Trans-amination reactions are of central importance in amino acid metabolism and in links to carbohydrate and fat metabolism. This class of aminotransferases acts as dimers in a head-to-tail configuration.	0
NZ_CP012181.1\|WP_060572338.1\|4667602_4669012_-\|argininosuccinate-lyase	gnl\|CDD\|179143	PRK00855, PRK00855, argininosuccinate lyase; Provisional.	0
NZ_CP012181.1\|WP_029239252.1\|4672711_4673884_-\|bifunctional-glutamate-N-acetyltransferase/amino-acid-acetyltransferase-ArgJ	gnl\|CDD\|235441	PRK05388, argJ, bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ.	0
NZ_CP012181.1\|WP_060572334.1\|4654483_4655503_-\|HAD-hydrolase-like-protein	gnl\|CDD\|319832	cd07530, HAD_Pase_UmpH-like, UmpH/NagD family phosphatase, similar to Escherichia coli UmpH UMP phosphatase/NagD nucleotide phosphatase and Mycobacterium tuberculosis Rv1692 glycerol 3-phosphate phosphatase. Escherichia coli UmpH/NagD is a ribonucleoside tri-, di-, and monophosphatase with a preference for purines, it shows peak activity with UMP and functions in UMP-degradation. It is also an effective phosphatase with AMP, GMP and CMP. Mycobacterium tuberculosis phosphatase, Rv1692 is a glycerol 3-phosphate phosphatase. Rv1692 is the final enzyme involved in glycerophospholipid recycling/catabolism. This subfamily belongs to the UmpH/NagD phosphatase family, and to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	1.05301e-90
NZ_CP012181.1\|WP_060572346.1\|4675017_4675830_+\|hypothetical-protein	gnl\|CDD\|237030	PRK12270, kgd, multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.	5.02966e-06
NZ_CP012181.1\|WP_060576169.1\|4665635_4666310_-\|DNA-3-methyladenine-glycosylase	gnl\|CDD\|376746	pfam02245, Pur_DNA_glyco, Methylpurine-DNA glycosylase (MPG). Methylpurine-DNA glycosylase is a base excision-repair protein. It is responsible for the hydrolysis of the deoxyribose N-glycosidic bond, excising 3-methyladenine and 3-methylguanine from damaged DNA.	1.41929e-80
NZ_CP012181.1\|WP_060572332.1\|4653183_4654008_-\|TlyA-family-RNA-methyltransferase	gnl\|CDD\|224110	COG1189, COG1189, Predicted rRNA methylase [Translation, ribosomal structure and biogenesis].	4.36733e-104
NZ_CP012181.1\|WP_168170482.1\|4664355_4665627_-\|tyrosine--tRNA-ligase	gnl\|CDD\|235645	PRK05912, PRK05912, tyrosyl-tRNA synthetase; Validated.	0
NZ_CP012181.1\|WP_060576168.1\|4650330_4652175_-\|DNA-repair-protein-RecN	gnl\|CDD\|223571	COG0497, RecN, ATPase involved in DNA repair [DNA replication, recombination, and repair].	9.55104e-180
NZ_CP012181.1\|WP_010225551.1\|4671753_4672680_-\|acetylglutamate-kinase	gnl\|CDD\|234869	PRK00942, PRK00942, acetylglutamate kinase; Provisional.	6.19669e-157
NZ_CP012181.1\|WP_060633748.1\|4655499_4656909_-\|hypothetical-protein	gnl\|CDD\|237171	PRK12678, PRK12678, transcription termination factor Rho; Provisional.	8.58287e-09
NZ_CP012181.1\|WP_060633750.1\|4670563_4671757_-\|acetylornithine-transaminase	gnl\|CDD\|235112	PRK03244, argD, acetylornithine transaminase.	0
NZ_CP012181.1\|WP_193408788.1\|4673880_4674915_-\|N-acetyl-gamma-glutamyl-phosphate-reductase	gnl\|CDD\|234761	PRK00436, argC, N-acetyl-gamma-glutamyl-phosphate reductase; Validated.	4.83564e-170
NZ_CP012181.1\|WP_029239821.1\|4649024_4650200_-\|thiamine-pyrophosphokinase	gnl\|CDD\|227162	COG4825, COG4825, Uncharacterized membrane-anchored protein conserved in bacteria [Function unknown].	3.51748e-133
NZ_CP012181.1\|WP_145982812.1\|4645348_4645921_-\|NUDIX-hydrolase	gnl\|CDD\|239516	cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate. Like other members of the Nudix hydrolase superfamily, it requires a divalent cation, such as Mg2+, for its activity. It also contains a highly conserved 23-residue Nudix motif (GX5EX7REUXEEXGU, where U = I, L or V) which functions as a metal binding site/catalytic site. In addition to the Nudix motif, there are additional conserved amino acid residues, distal from the signature sequence, that correlate with substrate specificity. In humans, there are four distinct ADPRase activities, three putative cytosolic enzymes (ADPRase-I, -II, and -Mn) and a single mitochondrial enzyme (ADPRase-m). Human ADPRase-II is also referred to as NUDT5. It lacks the N-terminal target sequence unique to mitochondrial ADPRase. The different cytosolic types are distinguished by their specificities for substrate and specific requirement for metal ions. NUDT5 forms a homodimer.	1.72671e-45
NZ_CP012181.1\|WP_010226916.1\|4652275_4653187_-\|NAD-kinase	gnl\|CDD\|235121	PRK03372, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional.	1.589e-154

>NZ_CP012181.1|WP_060633748.1|4655499_4656909_-|hypothetical-protein
MTDVRADDGADVSRGPEPGTRDDHVADDVPPARDRAERPARGPRDERRGDDRRGDDRRGDDRRGDDRRGDDRRGDDRPRGRRDDRSGDRRDRPGAGRDGRQERRRVIPESAERTFVAEPDLPASITPSDLDGSVRRDLRGLQKETAESVARHLVAAGVLVDEDPERALEHARYARRRASRIAVVREAAGIVAYHAGEWNEALGEFRAARRMGGGPGHVHVMADIERALGRPERAIDLARSPEARDLGAEERIELLIVAAGARRDLGEVDAAVVGLQVPELDAARRDPWSARLFYAYADNLLAAGRESESVQWFVHAHDADIDGQTDAAARIAELTGDELPGVDDDGMTIGWEDVPVDEVVEEPGAEDAGVEDATVPAPEAVSEPAAQVGDTAEVGDTADVGDTAEADDTAEVGVAAEAEDSPEAGDAPGIGDGPGIGDNPEGGDDHAVDGTSDADEHDRPSDGTEADRP
>NZ_CP012181.1|WP_060572334.1|4654483_4655503_-|HAD-hydrolase-like-protein
MTDDLLSRHDVLLADLDGTLYRGPDVVPGAVEAVRSAELRGVPTVYVTNNASRSPSTVAGHLADLGFPARVADVRTSAQAGAAMLAERLPSGATVLVLGTPALADEVRERGLVPTGTGEGADAVVQGHSPDTGWRQLTEAVLAIRAGALWVATNVDLTLPTERGPLPGNGSMVQVVRNASGVEPAVAGKPGARLLCEGQGDADRPLVLGDRLDTDIEGANALGAPSLMVLTGVSGAADLLAAPPALRPTYIGADLAALTRHPDELVPGARDGWRAEIDGDALVLSGDGHGDEPVVDALRVLCAAAWEHGTHRVTASGDVAAGVLHELGLADRRADRRAD
>NZ_CP012181.1|WP_010226912.1|4654010_4654217_-|hypothetical-protein
MSVPTPGPRPGDPRPPEQRPVADLRADVDEAVAGLDSLAERPVSEHPEAFERVHSALGRALTAGSERG
>NZ_CP012181.1|WP_060572332.1|4653183_4654008_-|TlyA-family-RNA-methyltransferase
MAPTRSRLDAELVRRRLARSRGQAAELIAAGRVSVNGMPAGKAATVVDRDAPVVVRPDDDGEPEWASRGAKKLLGALDAFTGVDPAGLRCLDAGASTGGFTDVLLTRGAREVVAADVGYGQLVWRLQSDERVHVHDRTNVRALEPDAIGGPVDLTVADLSFISLRTVLPALTACTAPGGDLLPMVKPQFEVGKQRLGSGGVVRSPELRTETLREVAATAVDLGLVVLDATASPLPGPSGNVEYFLHLHRPGAGGATTAPDLEPLLTGAVAGGPA
>NZ_CP012181.1|WP_010226916.1|4652275_4653187_-|NAD-kinase
MREILLVLHTGRPANRKTALNVMNELARLGLRVRVLADEWAELGADPDVPEDFTPVQVPGSPECARGAEAVLVLGGDGTLLRAADLARPAGVPLLGVNLGHVGFLAEAEEDTLDEALEKLAAGDYEVEERTTLEAVVRSNGTVLGRTWALNEAVVEKNTRGRILEVVLEVDGRPVSSFGCDGVLCSTPTGSTAYAFSAGGPLIWPQVQALLVVPSNAHALFARPMVIAPDSAVAIEVSADGPSAVLDCDGRRTVSVPPGSRVELSRATEPVRMVRLAAQPFADRLVRKFDLPVRGWRGRGSNT
>NZ_CP012181.1|WP_060576168.1|4650330_4652175_-|DNA-repair-protein-RecN
MLSEMRIQGLGVIDDATLELDPGLTVLTGETGAGKTMAVTGLNLLGGGRAESSRVSAGARRAVVEGRFTASPGALALAEEVGAEADDDGTLIAARTVSADGGSRAHLGGRSVPNGVLGRLAEAQLAVHGQNDQLRLLRGSDQRALLDRFAGDPVATPLAAYRAVRAEWLEIVTELAERRDNARRLAQEADMLRHGLAEIDSVDPQPGEDRALVDQARRMVEADDLRSAAEGTRMALSGSDDGETPGAVGLAGQAKGLAEGSDDPALAGLGPRLAEAIAVLADAAAEVSVYLDGLDADPERLSQVLARQAELKSLTRKYAADTDGVLDWAATARDRLAGLDTSDEALADLARRRDELARDLAGHAAEVTAARTEAAGRLAEATTAELAGLAMKDAQLQVGVAPRPAGDGGPSLVVGGRECHAGSGGVDEVEIRLVPHAGASAQPLHKGASGGELSRVMLALEVALAGSDPVPTMVFDEVDAGVGGRAAVEIGRRLARLAARHQVIVVTHLPQVAAYADRHLVVHKASGEEGVTRSSVTRLSEEERTQELARMLAGMDDTDTGRAHAEELLAAATAHRQADRAAEQPADLAQARSRRAGATRGGSGTRRRKVAQAG
>NZ_CP012181.1|WP_029239821.1|4649024_4650200_-|thiamine-pyrophosphokinase
MKLSGLLHRTRPELPGLTGPARTDRRTEALLRRLRPGDIVVLDQVDLDRATADALVAARVAAVVNASPSISGRFPNLGPQVLVEAGVPLVDDCGTEIMRSVKDGAKVRLHEGVLYSGEQPLGEGREQTEDTVADALDEAKQGLTHQLEAFAANTTEFMRRERSLLLDGHGVPEIDIALDGRPVLVVAAGFEYAGVLKRLRAYIKEYRPVLVGVGAGADALVNAKYRPDLIVADPSEVSNQALTSGADVVVPAFPDGHAPGLHRVQDLGASAVTFPSMANPEDLALLLAHHRGASMIVTVGLSASMAEFLDRGRSGSNASTFLTRLQAGGSVVDGEMIAQMYRSRTSFAPLLLLIAAALVAVVVAVLVSGAGPAVLEWAGGLVETVRSWFPA
>NZ_CP012181.1|WP_060572330.1|4648110_4649028_-|copper-transporter
MISRRYHRIALVAVFVLALAAGVAVATVGLPQRIASTVASTTGTGEIDQLRTERDTLAAQQRASDEFTARTAPGLVREKLAGVPVTVVALGADPADTRAVAELITTAGGSVAGEVVLTPAVTDPARADQLRDLSARLLPAGAQLPASSDAGALAGGLLGSALLAPQGGAAPDPQQAGAVVAGLAGGGFAETPEGELSAGRLAVVVTGGAFGGVDAAGSAATAAGLADELDRRGAGAVLAGRDAGPSSAVGAVRADAGQGPGPSTVDGVGTSAGRVATVLALAERNAGRAGQYGSGAGSTGPVPTL
>NZ_CP012181.1|WP_075294904.1|4646310_4648086_-|CTP-synthase
MQTRATRHLFVTGGVASSLGKGLTASSLGQLLTARGLRVTMQKLDPYLNVDPGTMNPFQHGEVFVTEDGAETDLDVGHYERFLDRDLQGRANVTTGQVYSEVIAKERRGEYLGDTVQVIPHITNEIKDRVLAMAEPDAEGIAPDVVITEVGGTIGDIESLPFVEAARQVRHEVGRDNCFFLHVSLVPYLAPSGELKTKPTQHSVAALRNIGIQPDALVLRADREIPGAMKRKISLMCDVELDGVAACADAPSIYDIPKVLHGEGLDAYVVRRLGLPFRDVDWTVWGDLLERVHHPQETATIALVGKYVDLPDAYLSVTEALRAGGFAHHAKVAVRWVPSDSCETPAGAAEALDGVDAVLVPGGFGIRGIEGKLGAITHARTRGIPTLGLCLGLQCMVIEAARSIAGLDGASSSEFDPDTEHPVISTMATQRDVVAGERDMGGTMRLGAYPAVLQPGSVAAKAYGAREISERHRHRFEVNNAYRQQLADAGLVFGTSPDGTLVEFVELPASQHPFFVGTQAHPELKSRPTRPHPLFAAFVKAALRYRAEDRLPVRLPGRANGDDDAELVEGDEPAGSTGTNGSVPAESTPGS
>NZ_CP012181.1|WP_145982812.1|4645348_4645921_-|NUDIX-hydrolase
MALRSDRVVMPGGRVATREILEHPGAVAIVAVDEHRRVRMLHQYRHAVRRRLWELPAGLLDVAGEDPAVTADRELTEEAGLTASDWSVLLDVVPSPGFSDESVRIFLARDLVEKPRPDLGDDEEADLELRWIALEDAVGMVFSGEIVNAVSCAGLLAARSVLAGEFEPRPPGTAWTDRPERFARRRDGDD
>NZ_CP012181.1|WP_168170482.1|4664355_4665627_-|tyrosine--tRNA-ligase
MGTDILDELEWRGLIAQSTDRDALAKELAGDEPITLYAGFDPTAPSLHAGHLVPMLTLRRFQEAGHRPVILAGGATGMIGDPRDVGERTLNDEATVAEWTGLIRGQLERFVTFDDSPTGALAVNNLDWTGQQTVLEFLRDLGKHFPVNTMLARETVKRRLAGEGMSYTEFSYLLLQSQDYLHLYRELGCRLQIGGSDQWGNIVGGVDLIRRIEGASVHAMTLPLVTDSEGRKFGKSTGGGNIWLDPDRTSPYAWYQYFVNVADADVIGYLKLLTFLDREEIDVLATELADAPHLRSAQRRLATELTTMVHGEEQTRQVTTASQALFGRADLSELDAGTLAAALAEVPTADTGGSDTIVDLLVSTGLTDSRGAARRAVKEGGAYVNNVKVTDEEWVPRAEDALAGGWLVVRRGKRNLAGARLAG
>NZ_CP012181.1|WP_060576169.1|4665635_4666310_-|DNA-3-methyladenine-glycosylase
MDRSELAVDVLPAAERLLGCVLEADTPDGVVAVRLVEVEAYRGRDDPASHSFRGRTPRNAVMFGPPGHLYVYFVYGMHFCANVTCLSDGEPGAVLLRGAEVVTDPGIARLRRPTARTDADLARGPARLASLLGLGRDDNGVDVTDPASRVRLVAGDPVPSGSVRTGPRVGVAAAADLPWRYWVAGSTAVSTYRAGTRAGRRSRSDGGSPDGDPYPDAASRPRRR
>NZ_CP012181.1|WP_010225541.1|4666382_4667606_-|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme
MTDPAAAYEELKAAGLKLDLTRGKPSSEQLDLSNALLGLPGAGDHRAADGTDTRNYGGLKGLPELREIFAPSLQVPVDQLIAWNNSSLELMHDTLVHALLSPLPGATTRWADAGRVAFIAPVPGYDRHYGVCDRLGIDLVSVPMTPEGPDMDEVERLVADDPSIKGIWCVPKYSNPDGAVYSDDVVRRLASMPTAAPDFRIMWDNAYAVHHLTTDEIEIADMLALAAEAGHPDRPFVFGSTSKITLAGAGVAFLGASPANVEWWTALTGKKSIGPDKVNHLRQARFLKDEAGLRAHMAAHRELIAPKFAAVERLLSEAFSDVEGVSWTTPKGGYFVSLTVPDGLATEVVRLAKDAGVVLTPAGATHPGGKDPQDAVIRLAPTLPPQDEVEKAMAGVVTCVQLALSRR
>NZ_CP012181.1|WP_060572338.1|4667602_4669012_-|argininosuccinate-lyase
MSAALWGGRFASGPADALAALSKSTHFDWALAPYDIRGSKAHARVLHRAGLLSDEELSGMHKALDELAADVASGVFGPEPGDEDVHTALERGLIERAGPDLGGKLRAGRSRNDQVATQFRMWLRDATRRVADGVLDVVDALVGQAETHAGAAMPGRTHLQHAQPVLLGHQLGAHAQALLRDVDRLRDWDRRTAYSPYGSGALAGSSLGLDPEAVAAELGFTGSSANSIDGTASRDFAAEAAFVLAMIGVDLSRLSEEVILWATAEFGYVTLDDAFSTGSSIMPQKKNPDVAELARGKSGRLVGNLTGLMTTLKGLPLAYNRDLQEDKEPLFDSVAQLELLLPAIAGMVATLTFHTDRLAELAPAGFTLATDVAEWLVRQGVPFRVAHEAAGGCVRAAEARGVGLDDLTDGELAGVHPALTPSVREVLSVEGSIASRDARGGTAGDRVAEQLTDLRDEAAAAREFTGGTA
>NZ_CP012181.1|WP_060572340.1|4669643_4670564_-|ornithine-carbamoyltransferase
MLRHLLRDDDLSPAEQTELLDLADRLKADRFSERPLEGPKAVAVVFDKSSTRTRVSFEAGITQLGGTAVILDGTTSQLGRGETISDTSRVLSRYVDAIVWRTSGQERIEEMASVATVPVVNALTDRFHPCQILADLQTVRERLGRLAGVTLTYLGDGANNIAHSLLLGGATAGLHVRVSAPAGFTPDPEVVRDAKARAEQTGGSVTLVADPVAAVAGADVLVTDTWTSMGQEEDGLDRIAPFRSYQIGADLLARAAPGAIVLHCLPAHRGEEITDDVIDGPASAVWDEAENRLHAQKALLTWLLRA
>NZ_CP012181.1|WP_060633750.1|4670563_4671757_-|acetylornithine-transaminase
MTTHAQRWQAALMNNYGTPPLTLVRGEGAHVWDAEGRRYLDLYAGIAVNALGHAHPAVVEAVSTQVGTLGHTSNFFITEPALQLAERLQGLLGRVDARTLLCNSGTEANEAAFKIARRTGRPEIVACEGAFHGRTMGALALTGQPAKRAPFEPMPSGVTHIPFGDLAALDAAVTENTAAVFLEPILGEAGVIVPPEGYRAEARRITAERGALLVLDEVQTGIGRTGQWFAHQAHGVVPDVVTLAKGLGGGLPIGACIGIGAAAALLEPGQHGTTFGGNPVACAAALAVLDTVATDGLLEHVGRLGKEIRSGIEGLGHPVVGEVTGAGLHIGIGLISPVAAQAATAARDAGFLINNCTPERLRLAPALTLTDEEAHEFLTAFPAILDAAAAEREGQGS
>NZ_CP012181.1|WP_010225551.1|4671753_4672680_-|acetylglutamate-kinase
MAPSPETPARLKRAGEKAGVLAEALPWLQRFHGRIVVVKYGGNAMIDEELKQAFARDMVFLRLAGIHPVVVHGGGPQISAMLTRLGMPGEFRGGLRVTTPETMEIVRMVLFGQVGRELVGLINQHGPLAVGLSGEDAGLFTAEKRTALVGGDPVDIGLVGDVTEVNPDAVLDIIAAGRIPVVAGIAPDADGQVHNINADSAAAALAGALDAAKLVVLTDVEGLYANYPDPESIITSLTADQLEPMLPRLESGMAPKMEACLRAVRSGVGQAHVIDGRVPHSVLLEVFTHEGVGTMVLPDTPADGVTQE
>NZ_CP012181.1|WP_029239252.1|4672711_4673884_-|bifunctional-glutamate-N-acetyltransferase/amino-acid-acetyltransferase-ArgJ
MSVTAAQGFRAAGIAAGIKKSGRADLALVVNDGPRTEAAGVFTRNKVKAAPVLWSQQVLTTGALRAVVLNAGGANACTGPEGFQTAHATAEKAAEMLGCGAIEVAICSTGLIGEQLPRETVLAGVEKVSGELAATPEAGASVAGAIMTTDTVPKEAQVSDPAGWTVGGTTKGAGMIAPSMATMLSVITTDAVVEQPVLDAALREAVRYSFDRLDVDGSMSTNDTVLVLSSGASGVPADQAVFTAALTRVCRDLAAQMQADAEGVSKRITVRVSGAASEDDAVTVARTIARDALVKTAMFGSDPNWGRIAAAAGYADADIDPETLDITINGVLLCRGAVVAGDRADCDLSGKDVLIEVELGRSGGIEGNTAEIRTTDLSHAYVEENSAYSS
>NZ_CP012181.1|WP_193408788.1|4673880_4674915_-|N-acetyl-gamma-glutamyl-phosphate-reductase
MHVVRIAVAGASGYAGGELLRLLLAHPDVEIGALTAGGNAGSRLGEHQPHLAPLAERVLEESTAERLAGHDAVFLALPHGKSAELAAQLGEDTLLIDCGADHRLTDPAAWDRWYGGEHAGHWPYGLPELPGAREQLVGSNRVAVPGCYPTGTSLALFPALVAGLVAPEVVITAVTGTSGAGKSLKPHLLGAEVMGSLSAYGVGGAHRHTPEITQNLSAALGAPVSVSFTPVLAPLPRGILASCSAPLADPSTDTATVRQTYEKAYAGEPFVRLLPEGQWPTTALTLGSNVVALQMTVDPDAGRLIVVSAIDNLTKGTAGGAVQCMNLALGLPETTGLPTTGVAP
>NZ_CP012181.1|WP_060572346.1|4675017_4675830_+|hypothetical-protein
MRTERSTGCLPARIVAAGLTGLAAVVLVGCATTVAGTPWPAGQGPARPAGVAAPVPGPTATRVPPSSFTEPASPVTGEPAPAPVPEPAPQTPPPAPVTGATRVVPPVAVGGDGEAGGRRPGRGAPVPRPATAPPALTSDVLADECLLDEAALTGLLGTGPAVDAADSEVRRSDGTTTRSCFAVGGSSSVAVNVYTTNRTTPARYVRDAAGARPLTGTGDGTQAALLGTVAGPTLQLGTARHLVTIAVAGRTPSDEQWRAAARSAAAALPR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP012181_8

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012181_8

5943931-5944035

Orphan

Consensus_repeat	Method
GCTCACCCGATCGCACGAGCGGGGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP012181_8

>merge|NZ_CP012181|8|5943931-5944035|CRISPRCasFinder
GCTCACCCGATCGCACGAGCGGGGCCGCATTCCGTGAGCGGCCCGGCGCGGCACCCAGACGCTCAGCGGTTCCGGCCGCGCTCACCCGATCGCATGAGCGGGGCC

>NZ_CP012181|8|8|5943931-5944035|CRISPRCasFinder
GCTCACCCGATCGCACGAGCGGGGCC	GCATTCCGTGAGCGGCCCGGCGCGGCACCCAGACGCTCAGCGGTTCCGGCCGC
GCTCACCCGATCGCATGAGCGGGGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012181.1\|WP_060573593.1\|5953392_5953803_-\|TIGR03618-family-F420-dependent-PPOX-class-oxidoreductase	unknown	unknown	gnl\|CDD\|274679
NZ_CP012181.1\|WP_060573585.1\|5938979_5940377_+\|GntP-family-permease	unknown	unknown	gnl\|CDD\|308194
NZ_CP012181.1\|WP_060573589.1\|5948786_5950286_+\|trypsin-like-peptidase-domain-containing-protein	unknown	unknown	gnl\|CDD\|273938
NZ_CP012181.1\|WP_060573579.1\|5935403_5936099_-\|response-regulator	unknown	unknown	gnl\|CDD\|226931
NZ_CP012181.1\|WP_010229352.1\|5942593_5943841_+\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|173852
NZ_CP012181.1\|WP_010229351.1\|5940989_5942159_+\|dimethyl-sulfone-monooxygenase-SfnG	unknown	unknown	gnl\|CDD\|274923
NZ_CP012181.1\|WP_060573586.1\|5940386_5940728_+\|HD-domain-containing-protein	unknown	unknown	gnl\|CDD\|272994
NZ_CP012181.1\|WP_060573592.1\|5952556_5953357_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293841
NZ_CP012181.1\|WP_010242245.1\|5946750_5947917_+\|thiolase-family-protein	unknown	unknown	gnl\|CDD\|238383
NZ_CP012181.1\|WP_060573595.1\|5955073_5956237_+\|citrate-synthase/methylcitrate-synthase	unknown	unknown	gnl\|CDD\|99862
NZ_CP012181.1\|WP_050802561.1\|5945119_5946430_-\|TMEM165/GDT1-family-protein	unknown	unknown	gnl\|CDD\|225030
NZ_CP012181.1\|WP_060573583.1\|5937803_5938811_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270234
NZ_CP012181.1\|WP_060573597.1\|5956354_5957806_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341047
NZ_CP012181.1\|WP_060573581.1\|5936095_5937736_-\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|225827
NZ_CP012181.1\|WP_060573588.1\|5944206_5945028_-\|NAD(P)H-binding-protein	unknown	unknown	gnl\|CDD\|187578
NZ_CP012181.1\|WP_060573577.1\|5934513_5935422_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|131480
NZ_CP012181.1\|WP_060576278.1\|5951876_5952503_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223659
NZ_CP012181.1\|WP_010236095.1\|5934065_5934377_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012181.1\|WP_060573591.1\|5950484_5951867_+\|sugar-porter-family-MFS-transporter	unknown	unknown	gnl\|CDD\|340917
NZ_CP012181.1\|WP_145982682.1\|5933385_5933829_+\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|377824

Protein	Function_ID	Function_description	E-value
NZ_CP012181.1\|WP_060573593.1\|5953392_5953803_-\|TIGR03618-family-F420-dependent-PPOX-class-oxidoreductase	gnl\|CDD\|274679	TIGR03618, Rv1155_F420, PPOX class probable F420-dependent enzyme. A Genome Properties metabolic reconstruction for F420 biosynthesis shows that slightly over 10 percent of all prokaryotes with fully sequenced genomes, including about two thirds of the Actinomyces, make F420. The Partial Phylogenetic Profiling algorithm identifies this members of this protein family as high-scoring proteins to the F420 biosynthesis profile. A member of this family, Rv1155, was crytallized after expression in Escherichia coli, which does not synthesize F420; the crystal structure shown to resemble FMN-binding proteins, but with a recognizable empty cleft corresponding to, yet differing profounding from, the FMN site of pyridoxine 5'-phosphate oxidase. We propose that this protein family consists of F420-binding enzymes. [Unknown function, Enzymes of unknown specificity].	5.46349e-18
NZ_CP012181.1\|WP_060573585.1\|5938979_5940377_+\|GntP-family-permease	gnl\|CDD\|308194	pfam02447, GntP_permease, GntP family permease. This is a family of integral membrane permeases that are involved in gluconate uptake. E. coli contains several members of this family including GntU, a low affinity transporter, and GntT, a high affinity transporter.	6.37677e-101
NZ_CP012181.1\|WP_060573589.1\|5948786_5950286_+\|trypsin-like-peptidase-domain-containing-protein	gnl\|CDD\|273938	TIGR02037, Probable_periplasmic_serine_protease_do/HhoA-like, periplasmic serine protease, Do/DeqQ family. This family consists of a set proteins various designated DegP, heat shock protein HtrA, and protease DO. The ortholog in Pseudomonas aeruginosa is designated MucD and is found in an operon that controls mucoid phenotype. This family also includes the DegQ (HhoA) paralog in E. coli which can rescue a DegP mutant, but not the smaller DegS paralog, which cannot. Members of this family are located in the periplasm and have separable functions as both protease and chaperone. Members have a trypsin domain and two copies of a PDZ domain. This protein protects bacteria from thermal and other stresses and may be important for the survival of bacterial pathogens.// The chaperone function is dominant at low temperatures, whereas the proteolytic activity is turned on at elevated temperatures. [Protein fate, Protein folding and stabilization, Protein fate, Degradation of proteins, peptides, and glycopeptides].	8.10741e-89
NZ_CP012181.1\|WP_060573579.1\|5935403_5936099_-\|response-regulator	gnl\|CDD\|226931	COG4565, CitB, Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms].	2.71416e-64
NZ_CP012181.1\|WP_010229352.1\|5942593_5943841_+\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|173852	cd01163, DszC, Dibenzothiophene (DBT) desulfurization enzyme C. DszC is a flavin reductase dependent enzyme, which catalyzes the first two steps of DBT desulfurization in mesophilic bacteria. DszC converts DBT to DBT-sulfoxide, which is then converted to DBT-sulfone. Bacteria with this enzyme are candidates for the removal of organic sulfur compounds from fossil fuels, which pollute the environment. An equivalent enzyme tdsC, is found in thermophilic bacteria. This alignment also contains a closely related uncharacterized subgroup.	1.7131e-132
NZ_CP012181.1\|WP_010229351.1\|5940989_5942159_+\|dimethyl-sulfone-monooxygenase-SfnG	gnl\|CDD\|274923	TIGR04021, LLM_DMSO2_sfnG, dimethyl sulfone monooxygenase SfnG. This family of FMNH2-dependent members of the luciferase-like monooxygenase (LLM) family includes SfnG, a monooxygenase that converts dimethylsulphone (DMSO2) to methanesulphonate. This step can be followed immediately by methanesulfonate sulfonatase (an alkanesulfonate monooxygenase - see TIGR03565) for the FMNH2-dependent conversion an inorganic form. [Central intermediary metabolism, Sulfur metabolism].	0
NZ_CP012181.1\|WP_060573586.1\|5940386_5940728_+\|HD-domain-containing-protein	gnl\|CDD\|272994	TIGR00277, Ribonuclease_Y, HDIG domain. This domain is found in a few known nucleotidyltransferes and in a large number of uncharacterized proteins. It contains four widely separated His residues, the second of which is part of an invariant dipeptide His-Asp in a region matched approximately by the motif HDIG. This model may annotate homologous domains in which one or more of the His residues is conserved but misaligned, and some probable false-positive hits.	0.000547664
NZ_CP012181.1\|WP_060573592.1\|5952556_5953357_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293841	cd16283, RomA-like_MBL-fold, Enterobacter cloacae RomA and related proteins; MBL-fold metallo hydrolase domain. Derepression of the romA-ramA locus results in a multidrug-resistance phenotype. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	1.24379e-36
NZ_CP012181.1\|WP_010242245.1\|5946750_5947917_+\|thiolase-family-protein	gnl\|CDD\|238383	cd00751, thiolase, Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine. They are found in prokaryotes and eukaryotes (cytosol, microbodies and mitochondria). There are 2 functional different classes: thiolase-I (3-ketoacyl-CoA thiolase) and thiolase-II (acetoacetyl-CoA thiolase). Thiolase-I can cleave longer fatty acid molecules and plays an important role in the beta-oxidative degradation of fatty acids. Thiolase-II has a high substrate specificity. Although it can cleave acetoacyl-CoA, its main function is the synthesis of acetoacyl-CoA from two molecules of acetyl-CoA, which gives it importance in several biosynthetic pathways.	5.10241e-170
NZ_CP012181.1\|WP_060573595.1\|5955073_5956237_+\|citrate-synthase/methylcitrate-synthase	gnl\|CDD\|99862	cd06109, BsCS-I_like, Bacillus subtilis (Bs) citrate synthase CS-I_like. CS catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). 2MCS catalyzes the condensation of propionyl-coenzyme A (PrCoA) and OAA to form 2-methylcitrate and coenzyme A (CoA) during propionate metabolism. The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the hydrolysis of citryl-CoA to produce citrate and CoA. This group contains proteins similar to BsCS-I, one of two CS isozymes in the gram-positive B. subtilis. The majority of CS activity in B. subtilis is provided by the other isozyme, BsCS-II (not included in this group). BsCS-I has a lower catalytic activity than BsCS-II, and has a Glu in place of a key catalytic Asp residue. This change is conserved in other members of this group. For E. coli CS (not included in this group), site directed mutagenesis of the key Asp residue to a Glu converts the enzyme into citryl-CoA lyase which cleaves citryl-CoA to AcCoA and OAA. A null mutation in the gene encoding BsCS-I (citA) had little effect on B. subtilis CS activity or on sporulation. However, disruption of the citA gene in a strain null for the gene encoding BsCS-II resulted in a sporulation deficiency, a characteristic of strains defective in the Krebs cycle. This group contains proteins which functions exclusively as either a CS or a 2MCS, as well as those with relaxed specificity which have dual functions as both a CS and a 2MCS. Many of the gram-negative species represented in this group have a second CS isozyme which is in another group.	5.12314e-130
NZ_CP012181.1\|WP_060573583.1\|5937803_5938811_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270234	cd07012, PBP2_Bug_TTT, Bug (Bordetella uptake gene) protein family of periplasmic solute-binding receptors; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) proteins present in a number of bacterial species, but mainly in proteobacteria. In eubacteria, at least three families of periplasmic binding-protein dependent transporters are known: the ATP-binding cassette (ABC) transporters, the tripartite ATP-independent periplasmic transporters, and the tripartite tricarboxylate transporters (TTT). Bug proteins are the PBP components of the TTT. Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	1.59843e-60
NZ_CP012181.1\|WP_060573597.1\|5956354_5957806_+\|MFS-transporter	gnl\|CDD\|341047	cd17504, MFS_MMR_MDR_like, Methylenomycin A resistance protein (also called MMR peptide)-like multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of putative multidrug resistance (MDR) transporters including Chlamydia trachomatis antiseptic resistance protein QacA_2, and Serratia sp. DD3 Bmr3. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.30645e-39
NZ_CP012181.1\|WP_060573581.1\|5936095_5937736_-\|sensor-histidine-kinase	gnl\|CDD\|225827	COG3290, CitA, Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms].	1.1406e-108
NZ_CP012181.1\|WP_060573588.1\|5944206_5945028_-\|NAD(P)H-binding-protein	gnl\|CDD\|187578	cd05269, TMR_SDR_a, triphenylmethane reductase (TMR)-like proteins, NMRa-like, atypical (a) SDRs. TMR is an atypical NADP-binding protein of the SDR family. It lacks the active site residues of the SDRs but has a glycine rich NAD(P)-binding motif that matches the extended SDRs. Proteins in this subgroup however, are more similar in length to the classical SDRs. TMR was identified as a reducer of triphenylmethane dyes, important environmental pollutants. This subgroup also includes Escherichia coli NADPH-dependent quinine oxidoreductase (QOR2), which catalyzes two-electron reduction of quinone; but is unlikely to play a major role in protecting against quinone cytotoxicity. Atypical SDRs are distinct from classical SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	3.00948e-40
NZ_CP012181.1\|WP_060573577.1\|5934513_5935422_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|131480	TIGR02427, b-ketoadipate_enol-lactone_hydrolase, 3-oxoadipate enol-lactonase. Members of this family are 3-oxoadipate enol-lactonase. Note that the substrate is known as 3-oxoadipate enol-lactone, 2-oxo-2,3-dihydrofuran-5-acetate, 4,5-Dihydro-5-oxofuran-2-acetate, and 5-oxo-4,5-dihydrofuran-2-acetate. The enzyme the catalyzes the fourth step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA. 4-hydroxybenzoate, 3-hydroxybenzoate, and vanillate all can be converted in one step to protocatechuate. This enzyme also acts in catechol degradation. In genomes that catabolize both catechol and protocatechuate, two forms of this enzyme may be found. All members of the seed alignment for this model were chosen from within protocatechuate degradation operons of at least three genes of the pathway, from genomes with the complete pathway through beta-ketoadipate. [Energy metabolism, Other].	8.29582e-23
NZ_CP012181.1\|WP_060576278.1\|5951876_5952503_-\|hypothetical-protein	gnl\|CDD\|223659	COG0586, DedA, Uncharacterized membrane-associated protein [Function unknown].	1.63979e-16
NZ_CP012181.1\|WP_050802561.1\|5945119_5946430_-\|TMEM165/GDT1-family-protein	gnl\|CDD\|225030	COG2119, COG2119, Predicted membrane protein [Function unknown].	1.0752e-41
NZ_CP012181.1\|WP_060573591.1\|5950484_5951867_+\|sugar-porter-family-MFS-transporter	gnl\|CDD\|340917	cd17359, MFS_XylE_like, D-xylose-proton symporter and similar transporters of the Major Facilitator Superfamily. This subfamily includes bacterial transporters such as D-xylose-proton symporter (XylE or XylT), arabinose-proton symporter (AraE), galactose-proton symporter (GalP), major myo-inositol transporter IolT, glucose transport protein, putative metabolite transport proteins YfiG, YncC, and YwtG, and similar proteins. The symporters XylE, AraE, and GalP facilitate the uptake of D-xylose, arabinose, and galactose, respectively, across the boundary membrane with the concomitant transport of protons into the cell. IolT is involved in polyol metabolism and myo-inositol degradation into acetyl-CoA. The XylE-like subfamily belongs to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.29967e-115
NZ_CP012181.1\|WP_145982682.1\|5933385_5933829_+\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|377824	pfam07366, SnoaL, SnoaL-like polyketide cyclase. This family includes SnoaL a polyketide cyclase involved in nogalamycin biosynthesis. This family was formerly known as DUF1486. The proteins in this family adopt a distorted alpha-beta barrel fold. Structural data together with site-directed mutagenesis experiments have shown that SnoaL has a different mechanism to that of the classical aldolase for catalyzing intramolecular aldol condensation.	5.62643e-05

>NZ_CP012181.1|WP_010229352.1|5942593_5943841_+|acyl-CoA-dehydrogenase-family-protein
MTTTENRSGTATVAEVVDWTAAPAPTDEAGWLRRAGEVRRILERDAAARDRAGATPYDEVALLKESGLVTLLGPVEHGGGGQEWPTAYRVIREVAAGDGSIGQLLGYHLLWFWAARLVGTPEQIEAVEADATRNRWFFGGAVNPRDSDLLIRDEGDEIVYNGRKSFSTGSTISDVTVLEGVLEGTDTHVFAIVPSEQDGIVFHDDWDNIGQRLTESGSVTITDVRVPWASAAGFTDKAFQPRVYNTLNVPTIQLVFVNFYLGIARGALETGARYTRTVTRPWLHGDAERAVDEPYQLDLYGDYRSKLWAVEALADAVAEEGLAIHRDAWNVTEEQRGEHEVRVAAVKARATDVALEITSGIFEGLGARATSAELAFDRFWRNVRTHTLHDPVAYKRREVGAHLLRDELPQPTWYT
>NZ_CP012181.1|WP_010229351.1|5940989_5942159_+|dimethyl-sulfone-monooxygenase-SfnG
MTDTTADNLDTTLNAQISEPLKFAYWVPNVSGGLVTSTIEQRTDWGFDYNVKLAQTAENNGFDYALSQIRYMASYGADHQHEATSFSLALGLATERLKVIAAVHPGLWQPAVLSKWIATADHLTKGRIAVNVVSGWLKDEFTSMGEPWLEHDERYRRTDEFIRVLREIWTAGDGGAEFAGDFYRVHGFDLKPKPVDVPGRPHPEIFQGGNSTAARRNGGRVSDWYFSNGKDYDGFTEQVEEVLGHAKTAPRLQPVRFGLNGFMIARDDEKEARDTLREIIEKANKPAVEGFRDAVQQAGNSTGDKRGMWADSSFSDLVQYNDGFKSQLIGTPEQIADRAIEYKRRGANLLLLGFLHFQEEVEYFGEKVLPIIREKEAELAAREPRPVTV
>NZ_CP012181.1|WP_060573586.1|5940386_5940728_+|HD-domain-containing-protein
MGFDAARALAETLLAHQRPELWVRAQRAAIRARELAEERGLDRDLLMTAAILHPVGHSPVVRRSGDPVRDAARFLGARGFDPRVVELVGGGADGPHAEALRTCADGQADPSGR
>NZ_CP012181.1|WP_060573585.1|5938979_5940377_+|GntP-family-permease
MENWTSPLGTGPLLGIALGAIVVLLVAIIRFKIHPLLALTVVSALTAFAARIPADAVLDVLVDGFGETLGEVALLVGLGAMFGRLAEVSGAAGALSDALVSRFGDRRAPFALGVASLLFGFPIFFDAAFMVMLPIIFTVARRVGGGVLVHTLPAAAALSTMHVFLPPHPGAVASTVLLGGDVGLVVLIGVLVAVPTWYLGAYFYSVWIGRRIVLPVPELLTGGPQTDDDETGPPPRPRVVVGLLLLPLVLIFANTLAATLADTGAVDPEAPWVVLPQFLGATPVALLITVLVATWVLATRRGRRAAFVEDLLDNALKPIAPVVFITGAGGMFGAVLIASGIGDALAGTLGATGLPVIVSVFLVAAILRIALGTATVTITTAAGLLGASVVEAGLGPVQTVAVVLALAAGSSIFPHVNDASFWLIGRLLGMDVPTTFKTWSVIKTLISLVGFALSCVVFVLASLAG
>NZ_CP012181.1|WP_060573583.1|5937803_5938811_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MTDTATGGPARPSRRAFCAGLAAGLVALATGAAAGCGGPEPVRGLRFLVPNAPGGGYDVTARSAAKALSDAGITGPAEVFSLPGAGGIAGLGRVVNEAGNDRLVLSMGLGLVGAARSTDATGLLTAATPLARLTRETEIVVVARDSPFRDLPQLLAAWRADPAGNAVGGGSSTGGPDHLATMLVAESAGVPPRRVGYVPHDGGGELLASLLADEVTFGVSGLGEFADQIASGALRILAITAGAPIPGVGAPTLREAGIDLEVTNWRGILAPPGLTPGQVGGLDDCFAAMVRTPQWQDVLRRNNWQDAYLPGPEFGTFLRSEDERVGRVLTGLGLG
>NZ_CP012181.1|WP_060573581.1|5936095_5937736_-|sensor-histidine-kinase
MGRRGGTRTPLARQFLVWQLVVVLVLLGAVAALAAVQSAESFRETQGRRMLSVAEDVASVPTVREALQRRQYDLLPSFARSAENLSGADEIEIVDAGLVVRTSPDPSRVRERFDPGASTAPAGRAWVGAPDGRTVVAQVPVIDDRGAVAGLVSAGIRAPSLWESLAGARTETVALLGLALGVGVAGSLLLARRVRRQTLGLEPGEIVELVQRREAMLLGIKEGVVGLDTADRITLLNPVARELLELPGARPGDPVADLGLDDRLREVLTGAAAGEDQLVLRDTRALVLNRMPVRLDGREVGAVVTLRDRTELTTLQHRLDASHTVTDTLRAQAHEFSNRLHTIAGLTELGEHEEVRRFVAGIVAASEGWRREVSSRVGDAATAALLVAKNSRAAERGVELTFDPDSRLEPTDPERDPDLSADLVTVLGNLIDNAVDATAGRSGERRVQIGLSGGGDDDGGEVWIEVRDSGPGVASELAEEVFRAGFSTKAAEIGGRGLGLALARQACLRRGGMIAVQDAAEGTGAVFVAVLPVAGKPATTGEEVQR
>NZ_CP012181.1|WP_060573579.1|5935403_5936099_-|response-regulator
MRVLVVDDDFMVAKVHSGYVERIEGCTVVGVAHRGAEALERAAELRPDLVLLDVYLPDMSGIEVLRGLRTGAADDPFVLVVTAADDPDTVAAALHGGALHYLVKPFDSAALAAQVHRARRLRRDLDRVRGQSDIDRLFGGTGGMPAGSAGGPERMPKGLTTPTADLVARTLREHTGAGDADLSATECAEATALSRVSARRYLEHFVTTGTATVRLRYGGTGRPERRYRWVG
>NZ_CP012181.1|WP_060573577.1|5934513_5935422_+|alpha/beta-fold-hydrolase
MEREVEIEPGVTLWVEDLPAHRETPAHPVLLVMGANASGIGWPDALVELLRERHRVVRYDHRDTGRSSHAFEDHPYGIADLAGDALTVLDACGIGRAHVVGMSMGGVLVQLLALDAPDRLASAALLCTAALGADLAGLPGPPRDVLRMWQEMHDPRDERSELAWRVEHWRRLSGGALPFEPAEFEELERRVMAHSGRVEAPTAHAQADPGGLDRGDELGSITVPTLVVEAPADPVNPPPHAAFLAERIAGRRAAPPVRLVSIEGMGHALPSAVLEPLAWELLEHAAEAEDEAAGAPGQPTQR
>NZ_CP012181.1|WP_010236095.1|5934065_5934377_+|hypothetical-protein
MALPTLTPEQRAEALKKAAAARTARKELRDKIASGEETIPGVLGRAKTDQIVGKTKVADLLKSVPGWGPAKVSKVMEEAGIDASRRAAGLGERQRQALIEKVG
>NZ_CP012181.1|WP_145982682.1|5933385_5933829_+|nuclear-transport-factor-2-family-protein
MTPAMQTLMRDVARLWDDAADGLYDRGDPAPATAVLGDGVVWTELPTGAGGTGPDAMGGHLAVVAASLPGGGTRTRLSRTLDVRRIADEVRFAFTHDHELPWLLPGVAPTGRRVEVHAVQLVRVRQGRIDELRTLWDVAGLRTTLGF
>NZ_CP012181.1|WP_060573588.1|5944206_5945028_-|NAD(P)H-binding-protein
MTILVTGATGNIGRLVVDHLIARTGEPVRALTVDPVRAALPDGVEAVRGSVRRPAALDGAFDAVRAMYLAPYEPTAAEVLAAAADAGVEHVVALTGEPDSWWGTVTKAVEAAGPAWTHLWPADFVENYEMWLPQIRATGVVREPWPALASTPTAMTDIAEVAAVALTAPGYTGRALTLTGPEPVSRRDAVAAIAEATGVGIGFEQVTPDEAVAALEPSAGRDAAEMVVHTILGFLHDAEPAPNGVVEEVTGRPATTVAAWAHSHADRLRAAIT
>NZ_CP012181.1|WP_050802561.1|5945119_5946430_-|TMEM165/GDT1-family-protein
MDGFLAAFAVSFGVIFVAELGDKSQLMALTFATRFKAIPVLVGITIATSVTHLVSVAVGYGLGASIPTGWIALVASVAFVAFGAWTLRGDSLTDDEEQKAKRAGGSAVVAASVAFFLAELGDKTMLATITLATQYSWFGVWLGSTLGMVAADALAIVVGRKLGQKLPERVISVGAAIMFFVFGAWLFAEAVPQVWGDDAWARLADAMGHQGFGWAALALGLVAVGTGLVVRGRAHRARGERRLDVARAPGSPAWWARTLFVVAAVLGFGAPLLVALDVLEPISVLSRPAVAVVGAGLLLLGFAVVAVAMLQLGTVWRRSATEAGAAAAGDPDAARRPVLATGGLYRRVRNPALTGLIVGCAGMLFMAPTLLGVLAGVLILVAVQIQARAVYEPGLGSALGPEYDAYRLRTGRFLPRVRRTGADGDATAGDDHTRVG
>NZ_CP012181.1|WP_010242245.1|5946750_5947917_+|thiolase-family-protein
MPEAVVCEAVRTPIGKRKGSLSEVHPVDLSAAVLTALAERTGIDPGVVDDVVWGCVNQVGDQAAQIGRYALLAAGWPETVPGVTINRACGSSQSAFDFAAGMVLAGQYDVVVAGGVESMTRVPLGAGRELGRPYGPLVRDRYREDLTSGEFPNDDFNQGVGAERIARDWGLSRTRLDEYAARSHELAAAAIDSGAFDGQLVDVPGAPGFAADEGLRRGTTAETLAALKPVFSGTGVIHAGNSSQISDGASAVLVTTPERAAELGLTPIVRYHSGAVSGADPLRMLTGPIPATQKVLKRSGLAIGDIGAFEVNEAFAPVPLAWQAELGADDARLNPLGGAIAVGHPLGASGTILLTRLVHHMRDRGIRYGLQTMCEGGGTANATVVELV
>NZ_CP012181.1|WP_060573589.1|5948786_5950286_+|trypsin-like-peptidase-domain-containing-protein
MTEYGPGTGGRADGETSTGGGATDPTRPDPRAAGDGPGHADGRSAQEATDVTDTDHRRQQEQAPPPWASASNPTIPAHGAGSPPTSVYPPFPAQAPAPKPPRRFGAGLVTVAVAAGLVGGGVGFGGAYAVLGGDTGSSTATLSSSAAPGTPAQAADGSIAGAAAAITPSTVDIQVRTAQGTAEGSGVILTADGEVLTNNHVVSGAGDGGQITVSTADGTQHRATVVGTSPSYDLAVIRLEGASNLKAATLGQSSGVQVGEQVVATGSPQGLSGTVTAGIVSALNRTVSASGDGGTPVVYNGLQTDAPINQGNSGGPLVNLAGQVVGINSAIATSGQNAGSIGLGFAIPVDTAKRVAQELMSDGVATKPQLGVQGSVSASGSETAGTGGAQVAAVEPGSPAANAGVAAGDVVTKVDEYPVSSFADLIARVGNFTPGQQVTLTIGSGADARQVPVTLGSAQDTEAATARQGALTTPEGSGQGGGSAPSAPFGINPFGGGGN
>NZ_CP012181.1|WP_060573591.1|5950484_5951867_+|sugar-porter-family-MFS-transporter
MTTHGDTGDTGHRTRQGRGIGLATTVAAAGGLLFGYDTGVISGALLFIAPEFGLGEAGQQLLVSGLLVGALVGALAGGAITDALGRRRTLVGVAAVFLLGAVLSGLAPGTGVLLGARVLLGLAIGVSSVCVPLYIAEIAPKESRGRLVSMNQFLITVGILLSYLVNSLFAEAESWRWPLLLAGVPALAMLVGLAGAQESPRWLVLRGRVDEARAALAGRTPEQADAEIAEIRAAARDEARWTWSDLRRPQLRPALTLGIGVAAVNQLVGVNAVIYYAPTILSGVFGSDTGALLATVGIGVVNTVVTAVALARIDSWGRRPLLLGGLAVVVAALVALVVLFLLPSQDGIVGVLVVVALCVYIAAFAASLGIAIWLVNSEVFPTAVRGKAAGLGATTHWGIDLVIASTTLTLITTLGESGLFAIFAVIGVAGFVFLHRLMPETKGRSLEEIDAALQERAGRT
>NZ_CP012181.1|WP_060576278.1|5951876_5952503_-|hypothetical-protein
MSPDAGRVAYLVVGGGVLFGSILPVVPTGAIVGAAAATAMTSPALSLPVVLVLAFAAALAGDLVTYAVARRGSVPVLDAVAGGRFGGARTGERVARVRAAFADRGWLLVLVGRVAPAGRVPTLIAAAASGMAWSVLLPAVAAGAVLWTLLYGVLGVLTGNLTDSPLVAAGLAVGLVAVVGAVTALVGRLRSRRRERRAHSPGEPAHDR
>NZ_CP012181.1|WP_060573592.1|5952556_5953357_-|MBL-fold-metallo-hydrolase
MDLPETTFLGHSTLRLRLGGRTVLTDPVLTSAVGPLRRMAPAVDPAGLDGVDLVLISHLHADHLHLGSLALLPRDTEVVVPAGAAAWLRRRGVARVSELAVGQRRTFGGLHVTGTPADHSGHRWGPRLTHGPQADAMGHLLEGDGLRVYAAGDTGLFPGLGDVAAQGPIDLAALPVWGWGPSLGPGHLDPAGAAEAVRRLAPRAALPVHWGTLAVTGLCSVPGRTGGRMRELLVRPPHDFAAAVAAAGPPARTLVVPPGAAVGAAV
>NZ_CP012181.1|WP_060573593.1|5953392_5953803_-|TIGR03618-family-F420-dependent-PPOX-class-oxidoreductase
MTRRRSLSDGVSDRFRELWSERRPCVLVTPRRDGTPHAVPVGVTVDVEDGIARVLSSGGSQKARNVAAAGPDGARVTVTAVDGRTWSTLEGVAVVDPTPEGVHAAERRYAAEYKEPRVNPQRVVLRIVVDRVLGNA
>NZ_CP012181.1|WP_060573595.1|5955073_5956237_+|citrate-synthase/methylcitrate-synthase
MTTTERAAVPEVPPGLRGVAVTTTTLGDVRGDEGFYHYRQYSAVELARTRTFVCAWFLAARGRLPDPDERAAFAARIAQRRALPAALSALLPGIAAACGDDLLAGLRAALSVLGPLHGMRPVWDAGPERGADDALTVCAATPTILAALHRLRSGLDPVPPRPDLEPAADWLWMLTGAEPDPGHARAVDAYLVSTLDHGFNASTFTARVVASTGADVASAVTAATGAFSGPLHGGAPDRALEGLDAIDRDAGGSPERWVADRLAAGERIMGFGHAVYRGPDPRTALLREVAERLGGPLPARAADVERRVAATLAELRPDRPLHANVEFYAGVVMAGCGIPRSMFTPTFATSRVVGWCAHVLEQAEQRRLIRPSATYVGPPPPEPVPPR
>NZ_CP012181.1|WP_060573597.1|5956354_5957806_+|MFS-transporter
MFRARRSAGASPGAPAQEARHRPAVAITVLASCGLLVSLVQTMVVPLLPRFPELLSVSPSTASWLITANLVAGAVSAPVLGRLGDMYGKRRMLLVALGLVGAGSLLGAVAPGIGLLLVARVLQGAAFGVIALGMSLMRDVLPADRVGSGVGLMSSSLGFGGAIGLPITGVVAQFTSWRWLFAGAAVIAVFQILVVRRLVPESNLRSGGRFDTVGALGVGAALVCLLLAVSKGNDWGWASPLVLGLFAASVVLALVTGRYELRVPGPLVDLRVSARPAVLLTNLASVLVGFAMFAGFVLATQILQAPVATGYGFGLSLVVAGLVLLPMGGSMVVFSSASARLSRVRGPRTTLVLGTLLLGAGNLGFALIPGTVWLLMLVSTVAAVGAALAYSAIPLTIMQAVPESETAAANSLNTLARQLGTSSCTAVVAAVTTALVLDGGTLPAASAYTISFAAAGVAALVATVLVALTPAPSVAREPVTTAS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP012181_9

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012181_9

6111623-6111781

Orphan

Consensus_repeat	Method
GGCCTTCTTCTCGGCCTTGGC	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP012181_9

>merge|NZ_CP012181|9|6111623-6111781|PILER-CR
GGCCTTCTTCTCCGCCTTGTCCGCCTTCTCGCGCTTCGCGACCTTCTCGAGCCGGGCGGCCTTGGCCTGCTTCGCGGCCTTCTTCTCGGCCTTGGCGGCGTCCTTCTGGGCCTTGCGCTGCTCGTCGGCCTCGGCCTTGGCCTTCTTCTCGGCCTTCGC

>NZ_CP012181|9|1|6111623-6111781|PILER-CR
GGCCTTCTTCTCCGCCTTGTC	CGCCTTCTCGCGCTTCGCGACCTTCTCGAGCCGGGCGGCCTTGGCCTGCTTCGC
GGCCTTCTTCTCGGCCTTGGC	GGCGTCCTTCTGGGCCTTGCGCTGCTCGTCGGCCTCGGCCTT
GGCCTTCTTCTCGGCCTTCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012181.1\|WP_060573760.1\|6115192_6116353_+\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|173847
NZ_CP012181.1\|WP_010224644.1\|6119712_6120474_-\|3-hydroxyacyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|187629
NZ_CP012181.1\|WP_060573755.1\|6108686_6109538_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|184199
NZ_CP012181.1\|WP_060573753.1\|6103589_6104756_-\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|226951
NZ_CP012181.1\|WP_060573762.1\|6118532_6119684_-\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|173849
NZ_CP012181.1\|WP_082399110.1\|6112414_6113248_-\|SigB/SigF/SigG-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|274373
NZ_CP012181.1\|WP_060573761.1\|6118173_6118590_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012181.1\|WP_010224581.1\|6110265_6110568_-\|energy-coupling-factor-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|179494
NZ_CP012181.1\|WP_010224582.1\|6110564_6111272_-\|energy-coupling-factor-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|181384
NZ_CP012181.1\|WP_010228973.1\|6104791_6105595_-\|RNA-methyltransferase	unknown	unknown	gnl\|CDD\|349977
NZ_CP012181.1\|WP_060573758.1\|6113429_6113846_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|379279
NZ_CP012181.1\|WP_010224586.1\|6113876_6114020_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012181.1\|WP_010232861.1\|6106899_6107715_+\|crotonase/enoyl-CoA-hydratase-family-protein	unknown	unknown	gnl\|CDD\|235714
NZ_CP012181.1\|WP_010224589.1\|6116349_6117198_+\|CoA-ester-lyase	unknown	unknown	gnl\|CDD\|225184
NZ_CP012181.1\|WP_060573759.1\|6114261_6115146_+\|MaoC-family-dehydratase-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|226300
NZ_CP012181.1\|WP_082538355.1\|6107872_6108682_-\|SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|252734
NZ_CP012181.1\|WP_060573756.1\|6109534_6110266_-\|cobalt-ECF-transporter-T-component-CbiQ	unknown	unknown	gnl\|CDD\|274139
NZ_CP012181.1\|WP_139323790.1\|6105648_6106824_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340883
NZ_CP012181.1\|WP_060573751.1\|6102928_6103606_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NZ_CP012181.1\|WP_050802195.1\|6117307_6118159_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176125

Protein	Function_ID	Function_description	E-value
NZ_CP012181.1\|WP_060573760.1\|6115192_6116353_+\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|173847	cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases. Short chain acyl-CoA dehydrogenase (SCAD). SCAD is a mitochondrial beta-oxidation enzyme. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of SCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. This subgroup also contains the eukaryotic short/branched chain acyl-CoA dehydrogenase(SBCAD), the bacterial butyryl-CoA dehydorgenase(BCAD) and 2-methylbutyryl-CoA dehydrogenase, which is involved in isoleucine catabolism. These enzymes are homotetramers.	1.82839e-138
NZ_CP012181.1\|WP_010224644.1\|6119712_6120474_-\|3-hydroxyacyl-CoA-dehydrogenase	gnl\|CDD\|187629	cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydrogenase type 10 (HSD10)-like, classical (c) SDRs. HSD10, also known as amyloid-peptide-binding alcohol dehydrogenase (ABAD), was previously identified as a L-3-hydroxyacyl-CoA dehydrogenase, HADH2. In fatty acid metabolism, HADH2 catalyzes the third step of beta-oxidation, the conversion of a hydroxyl to a keto group in the NAD-dependent oxidation of L-3-hydroxyacyl CoA. In addition to alcohol dehydrogenase and HADH2 activites, HSD10 has steroid dehydrogenase activity. Although the mechanism is unclear, HSD10 is implicated in the formation of amyloid beta-petide in the brain (which is linked to the development of Alzheimer's disease). Although HSD10 is normally concentrated in the mitochondria, in the presence of amyloid beta-peptide it translocates into the plasma membrane, where it's action may generate cytotoxic aldehydes and may lower estrogen levels through its use of 17-beta-estradiol as a substrate. HSD10 is a member of the SRD family, but differs from other SDRs by the presence of two insertions of unknown function. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	2.15864e-138
NZ_CP012181.1\|WP_060573755.1\|6108686_6109538_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|184199	PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional.	1.68394e-87
NZ_CP012181.1\|WP_060573753.1\|6103589_6104756_-\|sensor-histidine-kinase	gnl\|CDD\|226951	COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms].	3.47748e-35
NZ_CP012181.1\|WP_060573762.1\|6118532_6119684_-\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|173849	cd01160, LCAD, Long chain acyl-CoA dehydrogenase. LCAD is an acyl-CoA dehydrogenases (ACAD), which is found in the mitochondria of eukaryotes and in some prokaryotes. It catalyzes the alpha, beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of LCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. LCAD acts as a homodimer.	1.96207e-161
NZ_CP012181.1\|WP_082399110.1\|6112414_6113248_-\|SigB/SigF/SigG-family-RNA-polymerase-sigma-factor	gnl\|CDD\|274373	TIGR02980, SigBFG, RNA polymerase sigma-70 factor, sigma-B/F/G subfamily. This group of similar sigma-70 factors includes clades found in Bacilli (including the sporulation factors SigF:TIGR02885 and SigG:TIGR02850 as well as SigB:TIGR02941), and the high GC gram positive bacteria (Actinobacteria) where a variable number of them are found depending on the lineage.	1.71465e-101
NZ_CP012181.1\|WP_010224581.1\|6110265_6110568_-\|energy-coupling-factor-ABC-transporter-substrate-binding-protein	gnl\|CDD\|179494	PRK02898, PRK02898, energy-coupling factor ABC transporter substrate-binding protein.	1.09794e-38
NZ_CP012181.1\|WP_010224582.1\|6110564_6111272_-\|energy-coupling-factor-ABC-transporter-permease	gnl\|CDD\|181384	PRK08319, PRK08319, energy-coupling factor ABC transporter permease.	1.76475e-118
NZ_CP012181.1\|WP_010228973.1\|6104791_6105595_-\|RNA-methyltransferase	gnl\|CDD\|349977	cd18104, SpoU-like_RNA-MTase, SAM-dependent RNA methylase related to SpoU-TrmH. RNA 2'-O ribose methyltransferase catalyzes the methyltransfer from S-adenosyl-L-methionine (AdoMet) to the 2'-OH group of ribose in tRNA or rRNA. It is part of the SpoU family of MTases, a subfamily of the SPOUT methyltransferase superfamily. The SPOUT methyltransferase superfamily is a large class of S-adenosyl-L-methionine (AdoMet or SAM)-dependent RNA MTases which are structurally characterized by a deep trefoil knot.	1.86883e-62
NZ_CP012181.1\|WP_060573758.1\|6113429_6113846_+\|ATP-binding-protein	gnl\|CDD\|379279	pfam13581, HATPase_c_2, Histidine kinase-like ATPase domain.	3.68225e-23
NZ_CP012181.1\|WP_010232861.1\|6106899_6107715_+\|crotonase/enoyl-CoA-hydratase-family-protein	gnl\|CDD\|235714	PRK06142, PRK06142, crotonase/enoyl-CoA hydratase family protein.	3.17268e-119
NZ_CP012181.1\|WP_010224589.1\|6116349_6117198_+\|CoA-ester-lyase	gnl\|CDD\|225184	COG2301, CitE, Citrate lyase beta subunit [Carbohydrate transport and metabolism].	6.5255e-64
NZ_CP012181.1\|WP_060573759.1\|6114261_6115146_+\|MaoC-family-dehydratase-N-terminal-domain-containing-protein	gnl\|CDD\|226300	COG3777, COG3777, Uncharacterized conserved protein [Function unknown].	2.38495e-53
NZ_CP012181.1\|WP_082538355.1\|6107872_6108682_-\|SAM-dependent-methyltransferase	gnl\|CDD\|252734	pfam04672, Methyltransf_19, S-adenosyl methyltransferase. This family contains a SAM (S-adenosyl methyltransferase) domain, with a central beta sheet with 3 alpha-helices on both sides. Crystal packing analysis of the structure Structure 3giw suggests that a monomer is the solution state oligomeric form. An unidentified ligand (UNL, cyan) was found at the putative active site surrounded by the residues His57, His170, Phe171, Tyr216 and Met22. The UNL is likely to be a phenylalanine or phenylalanine-like molecule. (details derived from TOPSAN).	1.05504e-62
NZ_CP012181.1\|WP_060573756.1\|6109534_6110266_-\|cobalt-ECF-transporter-T-component-CbiQ	gnl\|CDD\|274139	TIGR02454, Uncharacterized_protein_MJ1089, cobalt ECF transporter T component CbiQ. This model represents the CbiQ component of the cobalt-specific ECF-type. CbiQ is now recognized as the T component of energy-coupling factor (ECF)-type transporters. The S component confers specificity (CbiM-N for cobalt systems), which CbiO is the ABC-family ATPase. In general, proteins found by this model reside next to the other putative subunits of the complex, identified as CbiN, CbiO, or CbiM. Note that the designation of cobalt transporter has been spread excessively among ECF system transporters with many other specificities. [Transport and binding proteins, Cations and iron carrying compounds].	8.32786e-31
NZ_CP012181.1\|WP_139323790.1\|6105648_6106824_-\|MFS-transporter	gnl\|CDD\|340883	cd17325, MFS_MdtG_SLC18_like, bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters. This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.71718e-23
NZ_CP012181.1\|WP_060573751.1\|6102928_6103606_-\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	5.72478e-68
NZ_CP012181.1\|WP_050802195.1\|6117307_6118159_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176125	cd08434, PBP2_GltC_like, The substrate binding domain of LysR-type transcriptional regulator GltC, which activates gltA expression of glutamate synthase operon, contains type 2 periplasmic binding fold. GltC, a member of the LysR family of bacterial transcriptional factors, activates the expression of gltA gene of glutamate synthase operon and is essential for cell growth in the absence of glutamate. Glutamate synthase is a heterodimeric protein that encoded by gltA and gltB, whose expression is subject to nutritional regulation. GltC also negatively auto-regulates its own expression. This substrate-binding domain has strong homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.26139e-75

>NZ_CP012181.1|WP_010224582.1|6110564_6111272_-|energy-coupling-factor-ABC-transporter-permease
MHIAEGYLPPLHAAAWTVVAAPFVVHGARAVVVRVREDPDTKLLLAAAGAFTFVLSALKIPSVTGSSSHPTGTGLGAVLFRPPVMALLGTVVLFFQAVLLAHGGLTTLGANAFSMAIAGPWIAYGAYVLVRRLGGGLGPAVFAAAFLGDLGTYTITSAQLALAFPDPTSGFGGAFVTFASIFSLTQIPLAVAEGLLTVLVVRLLVRITPDELRRLGVLRPKDTAGDGAASKEASA
>NZ_CP012181.1|WP_010224581.1|6110265_6110568_-|energy-coupling-factor-ABC-transporter-substrate-binding-protein
MSRSTLVNVLLVVAVVALFAIPVLFVPGEYSGADGQAGEAIEASGYEPWFSPVWEPPSGEIESGIFALQAAAGAGVLGYCLGVARTRSRQRGADSAPTET
>NZ_CP012181.1|WP_060573756.1|6109534_6110266_-|cobalt-ECF-transporter-T-component-CbiQ
MLLIDEIAHANRWRGRHPGEKAFLALGLLVLAVALPPWPGALLTGTAAVALLLAGARVRPGTALRLLRLPLGFVLVGALPLLVTLGGDPWLALAPGGPARAAELVGRSMAAVGCLILFAATTPLADTLPRLRFVPPAVLEITLLIYRMLFLLLDSLNAVREAQSLRVGFRTRRATFRSLAGQGSAVFVRAFDRARRLEAGLASRGYDGSLRVRVTSRPVSPRFVAASAALLVAVGATALAVRA
>NZ_CP012181.1|WP_060573755.1|6108686_6109538_-|ATP-binding-cassette-domain-containing-protein
MTAPVLEARGVAFAYRDGPPVLDGADLAVRTGRRLAVLGPNGGGKTTLFRLLLGLLEPARGEVLLDGAPLDRSRRGLARLRESAQLVLQDPDDQLFAADVAQDVSFGPLNLGLPDAEVDARVGEALAAVGMAELADRPTHRLSFGQRKRVAIAGALAVRPRILVLDEPTAGLDPAGVEELVAVLGRLHDEGTAVVLSTHDVDLAHRWADDVAVVHDGRVRRGPSAEILGDTGLLAAARLGPAWAPAVARLLAAAGHPGPAPRTAAELHDVLTALALREEIARG
>NZ_CP012181.1|WP_082538355.1|6107872_6108682_-|SAM-dependent-methyltransferase
MIDPDRAGGPDLSLPNPARVYDYMLGGAHNFDADRAFAERLLEALPGARDAAVANRAFLGRAVRACLDRGCRQFLDLGSGIPTAEPLHEIVRRHDPAARVAYVDSEPVAVAMSREILDGVDGVTISAADLTDADAVLAAPGVADLFDPTVPTAVLAVSVLHFVRDDAVLTRLLDRYCDAFGPGGLLVLSHGSTDVDDERAAEEMRTIERFTQESAQPAAARDRATLRRLLHRVDLLEPGLVDVSRWRPEPGHEPGRVVGMYAAVGEIVH
>NZ_CP012181.1|WP_010232861.1|6106899_6107715_+|crotonase/enoyl-CoA-hydratase-family-protein
MGEPTGIAVEVADGVARLRLDRAEAANALNEPMWFGLRDALRALDDDPAVRVVVISGNGRHFCSGIDVAMLGGLKETAADDSPGHGADRLRRVILDLQECLTAVERCRTPVIAAVHGVCLGAGLDLAVACDLRYATADASFVLKEVDMGLAADVGVLQRLPRIVGEGVAREMAYTCRPVSGTEARELRLVNGVYDDAAALEEGVAGLAAELAAKSPLAMRGTKYAITYARDHTVADSLDQIATWNGGQLVSADLQEAVSAFLEKRPGTYRD
>NZ_CP012181.1|WP_139323790.1|6105648_6106824_-|MFS-transporter
MRQRGAGDRTWWVACGLLFATAFGTNVPTPLLLVYRTELDLAPSTLAAIFGVYALGLAPSLLLGGPASDRFGRVRVLLPASVGVVLASLLFLGGASALWLLFAARFVQGLASGAVFSVGSAWLQDRAGADGAGRAARAASVAQTAGFCLGPLASGLLAAYGPLPLTLPYLVHVGLLVVAVAAVLVTVGTGSPPVGVVPRGLLPRPGFDPAARRTFVRVVVPTAVCVYAFPSVSVTVLPLLLPGASGLVAFTGLLAALTLGTGTLVQPFAHRPGARAGALGAALGALGFATGVVAALTGSVVAVAVAGILLGAGGGLCLNAGLTLVGRLAPASGRGAANGVFYTAAYLGFATPFLVTASAPVQALAVPLAVLVAVTVATAAWLAARAGDTAS
>NZ_CP012181.1|WP_010228973.1|6104791_6105595_-|RNA-methyltransferase
MPDLTSTANPRVKNLVRLRTRRHRDAAGVTLVEGHDELSLALDAGVRPTEVYWAPDLVRSEELLERMPGARATSVTREVFARIAYRESPDGWLAVAPAPGRPLDELELRPDALVLVAEGIEKPGNVGAMLRTAEACGVDAVVIATPDRAGTDFANPNVVRASKGTVFAVPVASAPTAEVQEWLRRRGVRSVVTTPAGTTELGRADLTGPTALVIGTEATGVTGPWLAGADATVVIPMRGTVNSLNASIAAAVVLFEAVRQRSGTSAG
>NZ_CP012181.1|WP_060573753.1|6103589_6104756_-|sensor-histidine-kinase
MPTVRDVLVALVVGAAAVAGALFADPSGRPLLPWGAVLIALATLLLCWRSRHPVPVLVAVMVPTALYYWLDHPDGPASLLVAVAVYTVASRVSWPHAVLTGVLVVLAWTGTEQLIVGPPPELHLDHYSWIVVTVALGVAVGAVRRAAEASAGRAEERLVRRVEQERLRIARDVHDVVSHSLSMIVVQAGVGAHVAARRPEEAVAALERIRDAGTDALRELRGTLALLRDPADPGADPGDGDGTAPDRHAGGLDRLDEVVRAGRAAGITVTVAGDAGALPPEVDRAAFGTVREAVTNTVRHAPDASAARVTLDRHGDLLHLRISDDGGPPAPAGERGRPEGQGLRGLAERAAALGGRCTAAPDGDGFVVTAELPVAIRTTPAAGGAAGA
>NZ_CP012181.1|WP_060573751.1|6102928_6103606_-|response-regulator-transcription-factor
MRRVPDVRVLLADDQPLIRAGLRVLLETEDGYAVAAEAADGAEAVRRARETRPDVALMDVRMPGTDGLDALSAITGDPELAGTRVIVLTTFDLDDYVYRALRSGASGFLLKDTDPVALLRAIDLVHAGEALLAPSVTRRLITEFARHGPAAPPGTDRLAVLTGREREVLALVGRGHTNGEIAAQLVISPATARTHVGRLLTKLGARDRVQLVVIAHETGLVGQRR
>NZ_CP012181.1|WP_082399110.1|6112414_6113248_-|SigB/SigF/SigG-family-RNA-polymerase-sigma-factor
MAEPDTRMDTATVATDDEYAHLDAPLRAFAAAPGDDPERAALREQLARGFHPVVRHIAGRYRHRGEPADDLEQVGAIGLLNALDRFDPEQGTPFLAYAVPTITGEIRRHFRDRTWSMRVPRRLKDFQTRMTRAQEELAVRHGRAPKVSELAEHLGTSREEVIEGLQAQDSYRSDSLDRLAGDTESPLGEIVGGADAGIGTVEDREALRPALRRLPERERTILLLRFFGNRTQTQIAEEVGLSQMHVSRLLARSLATLRRHLVEEPGGDSVSPMSDAG
>NZ_CP012181.1|WP_060573758.1|6113429_6113846_+|ATP-binding-protein
MGPRLHVELPADPGAAGRSRRETGRWLTSLCGADRPCETAQDLVLAVNEAVSNCVEHGYRAAPSGTVSLRGTADGARVRMEISDRGSWREPPEDNGCRGRGLGMIEAVTEDVRVERGPGGTTVTFHGTLGRCPGVCSD
>NZ_CP012181.1|WP_010224586.1|6113876_6114020_-|hypothetical-protein
MSESSTQHADAGWPHPASEAARLDGRYSPDRTGAPTRLTDDAGIHRD
>NZ_CP012181.1|WP_060573759.1|6114261_6115146_+|MaoC-family-dehydratase-N-terminal-domain-containing-protein
MPETAATGVLADLVRDWDPPQVTDSRRVDPWPAAAFADLLDAPVPDLRDGAALPPMWHWLLLLPHPRTSEIGEDGHPTDGPFLPPVPGRRRMFAGGRFHAHGTIPFGSVLGSRSSVTTVTPKSGRSGEMLFVTVRHELTVDGGDDVVAVEEQDIVYRSEPEGTERRVVERPVADQPDPGGAWRLRRPTDSVLLSRFSALTYNGHRIHHDLPYVTGVEGYPDLVIHGPLMALLALELPRQNAPSDRVTGFEYRLARPAFVPSALVATGDRSGAEATVAVAAEGVQPSLTATVHLG
>NZ_CP012181.1|WP_060573760.1|6115192_6116353_+|acyl-CoA-dehydrogenase-family-protein
MGVLSTEEQAVVDVVRDFVDREVKPSVNEVEHSGEYPEKWIEQMKELGIYGLAVPEPWGEAPVSMPCYALVTAELARGWMSLAGAMGGHTVVAKLLVEFGTQEQKDRYLPRMATGELRATMALTEPGGGSDLQNMATHAAPDGDGYVINGSKTWISNARRSGLIALLCKTDPAAEPKHRGISVLLVEHGPGLTVSKDLPKLGYKGVESCELIFDDMRVPAGAVLGGTPGRGFGQMMKGLETGRIQVASRALGVADAALEDSLRYAQDRESFGKPIWQHQSVGNHLADMATKITAARQLILYAAQKYDRGERCDMEAGMAKLFTSEIAMEVALNAVRIHGGYGYSTEFDVERYFRDAPLMIVGEGTNEIQRNVIAAQLVKRGGLERG
>NZ_CP012181.1|WP_010224589.1|6116349_6117198_+|CoA-ester-lyase
MTDTTTDTGYTLRGPALLFCPGDRPERYAKAAAAADTVILDLEDAVGPDGKDAARAAVVAGLAELDPAAVVVRVNAPGTAWHDADVAALAGHPDVAVMLPMAARAADVAALAPRPVIALCETAAGVLAAPEIAAAPNCTGLMWGSEDLVADLGGRPGRAPGGGYRPAVEEARIRILYAARAAGVTPVDTVLVAIDDLDTLRTDSESAVGSGYAAKACIHPKQVTVVREAFLPTDDEVAEAREVLDAAREHTGGGVFRLHGRMIDAPVLAHAREVLRQAGAPV
>NZ_CP012181.1|WP_050802195.1|6117307_6118159_+|LysR-family-transcriptional-regulator
MTRAAEKLSVAQPTLSRALGRLERQVGAPLFDRVARRLRLNASGEIMLEHARRSLAELAAAGDRIATLRDPDHGTVRLAFLHSIAAGLTPEMLRAYRSHAPGVVFELTQAAGHEIIEHVRAGRADLGLTAPRPDDDELAWTGLYRQQLCLAVPADHRLAGRPRVALSAAGTDPFVALRAPIGLRRLTDELCARAGLSPRFAFESTEIGTLEGFVSAGLGVAIVPEPRPDRAEPGVSYVPLTDATAHRSIGLTWLRERPAPPVVARFADFVVERYRDRAPGTRP
>NZ_CP012181.1|WP_060573761.1|6118173_6118590_+|hypothetical-protein
MPDDPTTIPLGHDELRAVTAFAVACARPALEIVEHACPGDPRPRDAVDAAHAFAGGADRTRATRDAAWAAHRAAQETRDAGLAAASDAARAAGHAAGADGSASWSGDWTRRSGDAAVPGPQSPRPRPMTSFMISVVPP
>NZ_CP012181.1|WP_060573762.1|6118532_6119684_-|acyl-CoA-dehydrogenase-family-protein
MRRTLYESDHEDFRSAFRAFVDKEVAPHGERWTADGIVPRELFTTAGANGFLGMDVPESYGGGGVPDFRFNAVVIEELMDAGAGGLGLGMTLHNDIVIPYLLAYGSDEQKQRWLPDAVSGNAILAIAMTEPGTGSDLASMTTTAVREGDHYVVNGSKTFITNGINADLVVVAVKTDPSQKHKGMSLLVLERGMEGFERGRNLDKLGQHAQDTAELSFTDVRVPVGNLLGPDEGQGFTQLVTNLPQERLSIAVAGVAAARTALTQSLEYVKERKAFGSPIGSFQNSKFVLAELDTEIDIAEHYVDDCVRALNAGELTAVDASKAKYWCTELQGRVVDKCLQLHGGYGYMSEYPISTAYADARITRIYGGTTEIMKEVIGRGLGL
>NZ_CP012181.1|WP_010224644.1|6119712_6120474_-|3-hydroxyacyl-CoA-dehydrogenase
MDINGSVAVVTGGASGLGLATTEKLVEQGGKVVIIDLPSSQGEAVADKLGDAVRFVPADVTDEAQVGAALDAAEELGTVRIAVNCAGIGNAAKTYGKKGAFPLDGFTKVINVNLIGTFNVIRLAAERIATAEPVDGDRGVVINTASVAAFEGQIGQAAYSASKGGIVGMTLPIARDLADLGIRVCTIAPGLFETPLLGALPEDVKASLGKQVPHPSRLGQPAEYAKLAAHIVENPMLNGETIRLDGAIRMQPR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP012181_6	6.2\|4656703\|22\|NZ_CP012181\|CRISPRCasFinder	4656703-4656724	22	NZ_CP012181.1	4656733-4656754	0	1.0
NZ_CP012181_6	6.2\|4656703\|22\|NZ_CP012181\|CRISPRCasFinder	4656703-4656724	22	NZ_CP012181.1	4656748-4656769	0	1.0
NZ_CP012181_5	5.1\|2316074\|35\|NZ_CP012181\|CRISPRCasFinder	2316074-2316108	35	NZ_CP012181.1	2316135-2316169	1	0.971
NZ_CP012181_6	6.2\|4656703\|22\|NZ_CP012181\|CRISPRCasFinder	4656703-4656724	22	NZ_CP012181.1	4112076-4112097	2	0.909
NZ_CP012181_6	6.2\|4656703\|22\|NZ_CP012181\|CRISPRCasFinder	4656703-4656724	22	NZ_CP012181.1	2245847-2245868	2	0.909

1. spacer 6.2|4656703|22|NZ_CP012181|CRISPRCasFinder matches to position: 4656733-4656754, mismatch: 0, identity: 1.0

cccgcgccggtcgtccccgcgc	CRISPR spacer
cccgcgccggtcgtccccgcgc	Protospacer
**********************

2. spacer 6.2|4656703|22|NZ_CP012181|CRISPRCasFinder matches to position: 4656748-4656769, mismatch: 0, identity: 1.0

cccgcgccggtcgtccccgcgc	CRISPR spacer
cccgcgccggtcgtccccgcgc	Protospacer
**********************

3. spacer 5.1|2316074|35|NZ_CP012181|CRISPRCasFinder matches to position: 2316135-2316169, mismatch: 1, identity: 0.971

gccgcaccccgtggcgggcgtcacgcaccccgtcg	CRISPR spacer
gccgcaccccgtggtgggcgtcacgcaccccgtcg	Protospacer
**************.********************

4. spacer 6.2|4656703|22|NZ_CP012181|CRISPRCasFinder matches to position: 4112076-4112097, mismatch: 2, identity: 0.909

cccgcgccggtcgtccccgcgc	CRISPR spacer
cccgcgctcgtcgtccccgcgc	Protospacer
*******. *************

5. spacer 6.2|4656703|22|NZ_CP012181|CRISPRCasFinder matches to position: 2245847-2245868, mismatch: 2, identity: 0.909

cccgcgccggtcgtccccgcgc	CRISPR spacer
cccgcgccggtccgccccgcgc	Protospacer
************  ********

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP012181_6	6.2\|4656703\|22\|NZ_CP012181\|CRISPRCasFinder	4656703-4656724	22	NZ_LR134463	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 21, complete sequence	7935-7956	1	0.955
NZ_CP012181_6	6.2\|4656703\|22\|NZ_CP012181\|CRISPRCasFinder	4656703-4656724	22	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	502775-502796	2	0.909
NZ_CP012181_7	7.2\|4657798\|22\|NZ_CP012181\|CRISPRCasFinder	4657798-4657819	22	NZ_CP039433	Rhodococcus sp. SGAir0479 plasmid unnamed	76884-76905	2	0.909
NZ_CP012181_1	1.1\|1109594\|36\|NZ_CP012181\|CRISPRCasFinder	1109594-1109629	36	NZ_CP042999	Aquisphaera giovannonii strain OJF2 plasmid pOJF2_2, complete sequence	8631-8666	9	0.75

1. spacer 6.2|4656703|22|NZ_CP012181|CRISPRCasFinder matches to NZ_LR134463 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 21, complete sequence) position: , mismatch: 1, identity: 0.955

cccgcgccggtcgtccccgcgc	CRISPR spacer
cccgcgcccgtcgtccccgcgc	Protospacer
******** *************

2. spacer 6.2|4656703|22|NZ_CP012181|CRISPRCasFinder matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 2, identity: 0.909

cccgcgccggtcgtccccgcgc	CRISPR spacer
gccgagccggtcgtccccgcgc	Protospacer
 *** *****************

3. spacer 7.2|4657798|22|NZ_CP012181|CRISPRCasFinder matches to NZ_CP039433 (Rhodococcus sp. SGAir0479 plasmid unnamed) position: , mismatch: 2, identity: 0.909

ctgcccgccacggtcgtcgtca	CRISPR spacer
ctgcccgccacggtcatcgtcc	Protospacer
***************.*****

4. spacer 1.1|1109594|36|NZ_CP012181|CRISPRCasFinder matches to NZ_CP042999 (Aquisphaera giovannonii strain OJF2 plasmid pOJF2_2, complete sequence) position: , mismatch: 9, identity: 0.75

gcccgcgagtgcggccaggtcctcccgggtgcgcgc	CRISPR spacer
ggccgcgaacgcggccaggtcctcccggtagtggtg	Protospacer
* ******..******************  *.*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2542155 : 2593263

Rhodococcus_phage(10.0%)

protease,integrase,transposase

attL 2553012:2553028|attR 2591751:2591767

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082399315.1\|2542155_2543169_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_060574669.1\|2544245_2545394_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_082538368.1\|2545430_2545649_+	transglycosylase family protein	A0A1I9SA30	Rhodococcus_phage	4.6e-09	54.4
WP_060575097.1\|2545788_2547336_+	serine/threonine protein kinase	M1PCM5	Moumouvirus	3.0e-17	28.3
WP_060575098.1\|2547322_2549203_-	S9 family peptidase	NA	NA	NA	NA
WP_060575099.1\|2549285_2551862_-	carboxylate--amine ligase/circularly permuted type 2 ATP-grasp protein	NA	NA	NA	NA
2553012:2553028	attL	NA	NA	NA	NA
WP_082398825.1\|2553740_2554547_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_010225434.1\|2554564_2555239_-	DUF429 domain-containing protein	NA	NA	NA	NA
WP_010225435.1\|2555257_2555725_+	ribose-5-phosphate isomerase	A0A222YX14	Synechococcus_phage	1.7e-08	28.7
WP_060575100.1\|2555724_2556540_+	Fpg/Nei family DNA glycosylase	A0A1V0CNR6	Kaumoebavirus	1.8e-05	26.1
WP_010225439.1\|2556551_2557331_+	HAD family hydrolase	NA	NA	NA	NA
WP_060575101.1\|2557377_2558838_-	acetyl-CoA carboxyl transferase	NA	NA	NA	NA
WP_060575102.1\|2558834_2560022_-	CoA transferase	NA	NA	NA	NA
WP_060575103.1\|2560051_2561416_-	SLC13 family permease	NA	NA	NA	NA
WP_060576496.1\|2561606_2562290_+	FadR family transcriptional regulator	NA	NA	NA	NA
WP_060575104.1\|2562305_2562971_-	RraA family protein	NA	NA	NA	NA
WP_082398827.1\|2562978_2564442_-	AMP-binding protein	Q75ZG1	Hepacivirus	1.3e-27	32.6
WP_050802427.1\|2564438_2565755_-	MHS family MFS transporter	Q6JIH2	Burkholderia_virus	1.2e-32	30.6
WP_060575105.1\|2565907_2566786_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_060575106.1\|2566793_2567549_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	3.3e-06	27.4
WP_010228145.1\|2567888_2568179_+	hypothetical protein	NA	NA	NA	NA
WP_010228144.1\|2568260_2569709_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_010228143.1\|2569903_2570767_+	universal stress protein	NA	NA	NA	NA
WP_010228142.1\|2570763_2571291_-	DsbA family protein	NA	NA	NA	NA
WP_010228141.1\|2571341_2572682_+	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	5.1e-58	39.8
WP_060575107.1\|2572683_2573760_-	winged helix DNA-binding domain-containing protein	NA	NA	NA	NA
WP_060575108.1\|2573756_2574083_-	DUF4180 domain-containing protein	NA	NA	NA	NA
WP_145982543.1\|2574182_2574638_+	hypothetical protein	NA	NA	NA	NA
WP_060575110.1\|2574726_2575770_+	NAD(P)-dependent alcohol dehydrogenase	K7Z7U2	Megavirus	6.9e-10	24.5
WP_060575111.1\|2575817_2576426_+	hypothetical protein	NA	NA	NA	NA
WP_060575112.1\|2576453_2577404_-	phosphotransferase	NA	NA	NA	NA
WP_060575113.1\|2577475_2577832_+	VOC family protein	NA	NA	NA	NA
WP_060575114.1\|2577866_2578541_-	class F sortase	NA	NA	NA	NA
WP_033199283.1\|2578610_2579414_-	hypothetical protein	NA	NA	NA	NA
WP_060576498.1\|2579805_2580726_+	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_060575115.1\|2580815_2581526_-	ANTAR domain-containing protein	NA	NA	NA	NA
WP_060575116.1\|2581610_2582216_-	response regulator transcription factor	NA	NA	NA	NA
WP_168170454.1\|2582212_2583442_-	two-component sensor histidine kinase	NA	NA	NA	NA
WP_145982545.1\|2583450_2584368_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_060575118.1\|2584677_2585064_-	hypothetical protein	NA	NA	NA	NA
WP_060575119.1\|2585208_2586138_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_060576499.1\|2586310_2586787_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_168170455.1\|2587054_2587336_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_168170456.1\|2588700_2588874_-	hypothetical protein	NA	NA	NA	NA
WP_145982547.1\|2588995_2589217_+	hypothetical protein	NA	NA	NA	NA
WP_060575120.1\|2589274_2589493_-	cold shock domain-containing protein	NA	NA	NA	NA
WP_060575121.1\|2589736_2590654_+\|integrase	tyrosine-type recombinase/integrase	A0A142F1N9	Bacillus_phage	2.6e-13	25.1
WP_060575122.1\|2590920_2591118_-	hypothetical protein	NA	NA	NA	NA
WP_060575005.1\|2592171_2593263_-\|transposase	IS630 family transposase	NA	NA	NA	NA
2591751:2591767	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP012182

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

359598 : 427470

Enterobacteria_phage(25.0%)

transposase,integrase

attL 362536:362552|attR 430226:430242

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060577292.1\|359598_360828_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_082538557.1\|361429_361639_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_060633851.1\|361920_362799_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
362536:362552	attL	NA	NA	NA	NA
WP_060577290.1\|362840_364247_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_060577289.1\|364345_365713_-	MFS transporter	NA	NA	NA	NA
WP_060577288.1\|366046_367306_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_082538460.1\|367791_368208_+\|transposase	transposase	NA	NA	NA	NA
WP_168172337.1\|368237_369683_-	AAA family ATPase	H2BD70	Pseudomonas_phage	1.4e-29	30.3
WP_060633892.1\|370526_372002_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_060575501.1\|371998_372766_+	ATP-binding protein	U5N3V8	Enterobacteria_phage	3.8e-58	48.1
WP_082538461.1\|372714_373326_-	UvrD-helicase domain-containing protein	NA	NA	NA	NA
WP_145984171.1\|373593_375501_-	AAA family ATPase	NA	NA	NA	NA
WP_060577283.1\|375793_377035_-	methyltransferase domain-containing protein	A0A2H4UUL2	Bodo_saltans_virus	3.3e-75	36.5
WP_082538462.1\|377464_378358_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	6.6e-94	56.6
WP_082538463.1\|378369_379353_+	dTDP-glucose 4,6-dehydratase	A0A1D8EQC0	Escherichia_phage	1.8e-68	42.3
WP_060577484.1\|379352_380657_+	NDP-hexose 2,3-dehydratase family protein	NA	NA	NA	NA
WP_082538464.1\|381028_381742_+	response regulator transcription factor	W8CYM9	Bacillus_phage	4.5e-29	33.2
WP_145984172.1\|381871_382498_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_060577279.1\|382561_382969_+	MerR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_060577483.1\|383009_384344_-	MFS transporter	NA	NA	NA	NA
WP_060577278.1\|385431_387735_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	8.0e-19	29.8
WP_060633853.1\|387767_388712_-	SRPBCC family protein	NA	NA	NA	NA
WP_060577276.1\|388741_389521_-	3-oxoacyl-ACP reductase FabG	A0A0N9R355	Chrysochromulina_ericina_virus	3.7e-08	23.6
WP_082538467.1\|389522_390971_-	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_060577275.1\|390981_391449_-	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_145984220.1\|391526_393242_-	acetyl-CoA carboxylase, carboxyltransferase subunit beta	NA	NA	NA	NA
WP_060577273.1\|393267_393519_-	acyl carrier protein	NA	NA	NA	NA
WP_060577272.1\|393575_394793_-	ketosynthase chain-length factor	NA	NA	NA	NA
WP_060577482.1\|394789_396061_-	beta-ketoacyl-[acyl-carrier-protein] synthase family protein	NA	NA	NA	NA
WP_060577271.1\|396060_396390_-	TcmI family type II polyketide cyclase	NA	NA	NA	NA
WP_060577481.1\|396429_397923_-	FAD-dependent monooxygenase	NA	NA	NA	NA
WP_145984173.1\|398414_399557_+	DUF1205 domain-containing protein	NA	NA	NA	NA
WP_060577269.1\|400602_401751_+	DegT/DnrJ/EryC1/StrS family aminotransferase	E5ES42	Bathycoccus_sp._RCC1105_virus	3.6e-36	30.5
WP_060577268.1\|401737_402361_+	dTDP-4-dehydrorhamnose 3,5-epimerase family protein	I7HJC4	Enterobacteria_phage	9.4e-15	28.5
WP_060577480.1\|402444_403446_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_168172311.1\|403611_404517_+	hypothetical protein	NA	NA	NA	NA
WP_060577266.1\|404509_405373_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_168172338.1\|405516_406509_+	DUF1205 domain-containing protein	NA	NA	NA	NA
WP_060577264.1\|406598_407210_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_145984176.1\|407322_408342_-	hypothetical protein	NA	NA	NA	NA
WP_060577262.1\|409945_410389_-	DUF2269 family protein	NA	NA	NA	NA
WP_168172339.1\|410677_411220_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_060577260.1\|411452_412229_-	2-phosphosulfolactate phosphatase	NA	NA	NA	NA
WP_060577259.1\|412225_413116_-	aminoglycoside phosphotransferase family protein	NA	NA	NA	NA
WP_145984177.1\|413243_414275_-	hypothetical protein	NA	NA	NA	NA
WP_060577257.1\|414274_414946_-	hypothetical protein	NA	NA	NA	NA
WP_145984178.1\|415184_415922_+	hypothetical protein	NA	NA	NA	NA
WP_060577479.1\|415976_416645_-	TetR/AcrR family transcriptional regulator C-terminal domain-containing protein	NA	NA	NA	NA
WP_060577255.1\|416858_418493_+	chaperonin GroEL	A0A240F779	uncultured_virus	1.3e-153	55.4
WP_060577254.1\|418594_419551_-	hypothetical protein	NA	NA	NA	NA
WP_060572134.1\|419729_420953_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_060577253.1\|422084_422420_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_082538470.1\|423724_424486_-\|integrase	site-specific integrase	A0A1P8D5X7	Corynebacterium_phage	3.7e-05	30.0
WP_060577251.1\|424866_425271_+	hypothetical protein	NA	NA	NA	NA
WP_060577250.1\|425321_426947_-	hypothetical protein	NA	NA	NA	NA
WP_060577249.1\|427029_427470_-\|integrase	site-specific integrase	NA	NA	NA	NA
430226:430242	attR	NA	NA	NA	NA

DBSCAN-SWA_2

601663 : 743640

113

Mycobacterium_phage(25.0%)

transposase,integrase

attL 677601:677619|attR 755642:755660

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060577462.1\|601663_602656_+\|transposase	IS481 family transposase	A0A0M3LS26	Mannheimia_phage	3.5e-11	31.9
WP_060577109.1\|603054_604053_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_145984195.1\|604331_604583_-	hypothetical protein	NA	NA	NA	NA
WP_060577461.1\|604579_605002_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_145986101.1\|605250_605580_+	hypothetical protein	NA	NA	NA	NA
WP_060633860.1\|606215_606857_-	ATP-binding protein	NA	NA	NA	NA
WP_060577104.1\|607221_608145_+	universal stress protein	NA	NA	NA	NA
WP_060577103.1\|608713_609211_-	universal stress protein	NA	NA	NA	NA
WP_168172348.1\|609207_610041_-	universal stress protein	NA	NA	NA	NA
WP_145984197.1\|610599_611439_+	hypothetical protein	NA	NA	NA	NA
WP_060577100.1\|611753_612347_-	hypothetical protein	NA	NA	NA	NA
WP_060577099.1\|612343_614080_-	GMC family oxidoreductase	NA	NA	NA	NA
WP_060577098.1\|614298_615399_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_060577097.1\|615581_618395_+	AfsR/SARP family transcriptional regulator	NA	NA	NA	NA
WP_060577096.1\|623012_623735_-	hypothetical protein	NA	NA	NA	NA
WP_060577095.1\|624595_624973_-	STAS domain-containing protein	NA	NA	NA	NA
WP_082538504.1\|625257_628254_-	DEAD/DEAH box helicase family protein	A0A2K9V3E9	Faecalibacterium_phage	2.1e-11	26.6
WP_060577093.1\|628454_628760_+	hypothetical protein	NA	NA	NA	NA
WP_060577090.1\|630409_632164_-	cytochrome c oxidase subunit I	NA	NA	NA	NA
WP_060577460.1\|632958_633600_-	thioredoxin domain-containing protein	NA	NA	NA	NA
WP_060577087.1\|634186_634816_-	redoxin domain-containing protein	NA	NA	NA	NA
WP_060577086.1\|634812_635601_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_082399751.1\|635597_636062_-	cytochrome c-type biogenesis protein CcmH	NA	NA	NA	NA
WP_060577084.1\|636087_638076_-	heme lyase CcmF/NrfE family subunit	NA	NA	NA	NA
WP_174521826.1\|638072_638519_-	cytochrome c maturation protein CcmE	NA	NA	NA	NA
WP_060577083.1\|638637_639399_-	cytochrome c biogenesis protein CcsA	NA	NA	NA	NA
WP_060577082.1\|639410_640088_-	heme exporter protein CcmB	NA	NA	NA	NA
WP_082399749.1\|640084_640702_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.5e-07	26.8
WP_060577081.1\|640831_641542_+	cytochrome C biogenesis protein CcdA	NA	NA	NA	NA
WP_060577080.1\|641562_642342_-	M23 family metallopeptidase	G8I8L5	Mycobacterium_phage	8.1e-24	50.0
WP_060577079.1\|642959_643526_+	L,D-transpeptidase	NA	NA	NA	NA
WP_082538505.1\|644546_645833_+	AMP-binding protein	NA	NA	NA	NA
WP_145984225.1\|646174_648520_+	peptide synthetase	NA	NA	NA	NA
WP_060577077.1\|648516_649524_+	TauD/TfdA family dioxygenase	NA	NA	NA	NA
WP_168172349.1\|649794_649965_-	hypothetical protein	NA	NA	NA	NA
WP_060577075.1\|650625_650898_+	hypothetical protein	NA	NA	NA	NA
WP_082538506.1\|650976_652092_+	cysteine synthase family protein	NA	NA	NA	NA
WP_060577073.1\|652706_653303_-\|transposase	transposase	A0A222ZN33	Mycobacterium_phage	2.5e-25	41.1
WP_060577456.1\|653823_654465_-	PadR family transcriptional regulator	H9EB19	Vibrio_phage	6.3e-06	32.3
WP_060577072.1\|654559_655429_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_060577071.1\|655425_655623_-	hypothetical protein	NA	NA	NA	NA
WP_060577070.1\|655629_656586_-	mandelate racemase/muconate lactonizing enzyme family protein	Q6A202	Oenococcus_phage	7.7e-16	27.7
WP_060577069.1\|656860_658093_+	cytochrome P450	NA	NA	NA	NA
WP_060633863.1\|658089_659082_+	cupin domain-containing protein	NA	NA	NA	NA
WP_060577455.1\|659110_660055_+	oxidoreductase	NA	NA	NA	NA
WP_082538507.1\|660209_661553_+	aromatic acid/H+ symport family MFS transporter	A0A0M3UL24	Mycobacterium_phage	2.4e-07	29.6
WP_060577066.1\|661954_662533_-	NUDIX hydrolase	NA	NA	NA	NA
WP_082538508.1\|662555_662945_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_082538564.1\|662971_663979_+\|transposase	IS481 family transposase	A8RHK4	Spiroplasma_virus	6.2e-08	27.7
WP_060633864.1\|664809_665988_-	DUF2236 domain-containing protein	NA	NA	NA	NA
WP_060577062.1\|666845_667508_-	DUF3159 domain-containing protein	NA	NA	NA	NA
WP_082538510.1\|667737_668607_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_060577060.1\|668603_669023_+	Dabb family protein	NA	NA	NA	NA
WP_060577059.1\|669074_670268_+	cytochrome P450	NA	NA	NA	NA
WP_060577058.1\|670311_671592_+	cytochrome P450	NA	NA	NA	NA
WP_168172351.1\|671811_673044_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	9.0e-17	26.2
WP_060577056.1\|673202_674270_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_060577454.1\|675677_676670_-\|transposase	IS481 family transposase	A0A0M3LS26	Mannheimia_phage	3.5e-11	31.9
WP_082538512.1\|677119_678217_-\|transposase	IS110 family transposase	NA	NA	NA	NA
677601:677619	attL	NA	NA	NA	NA
WP_060577055.1\|678603_679293_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_060577054.1\|679306_680101_-	SDR family oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	1.3e-16	31.9
WP_060577053.1\|680158_681070_-	glycine betaine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_082538513.1\|681107_682064_-	proline/glycine betaine ABC transporter permease	NA	NA	NA	NA
WP_082538514.1\|682060_683320_-	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.8e-26	35.1
WP_060577052.1\|683329_684253_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_060577051.1\|684249_685386_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_060577050.1\|685451_685973_-	3-dehydroquinate dehydratase	NA	NA	NA	NA
WP_060633867.1\|689035_690121_+	hypothetical protein	NA	NA	NA	NA
WP_060633868.1\|690572_690992_+	hypothetical protein	NA	NA	NA	NA
WP_082538565.1\|691051_691735_+	recombinase family protein	A0A286S1P7	Klebsiella_phage	2.2e-33	46.9
WP_060633869.1\|691731_692349_+	hypothetical protein	NA	NA	NA	NA
WP_060577046.1\|692421_693666_-	hypothetical protein	NA	NA	NA	NA
WP_168172352.1\|693672_694230_-	hypothetical protein	NA	NA	NA	NA
WP_145984201.1\|694319_695561_+	amidohydrolase family protein	NA	NA	NA	NA
WP_060633871.1\|695613_696078_-	hypothetical protein	NA	NA	NA	NA
WP_060577039.1\|696558_696891_+	hypothetical protein	NA	NA	NA	NA
WP_145984202.1\|696878_697304_-	hypothetical protein	NA	NA	NA	NA
WP_060577035.1\|698186_698657_+	hypothetical protein	NA	NA	NA	NA
WP_060577033.1\|698907_699963_+	MinD/ParA family protein	NA	NA	NA	NA
WP_060577030.1\|699962_701207_+	glycoside hydrolase family 16 protein	NA	NA	NA	NA
WP_060633873.1\|701839_703753_+	hypothetical protein	NA	NA	NA	NA
WP_082538517.1\|703688_704603_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_145984226.1\|704719_705034_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_145982901.1\|705483_707622_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_082538519.1\|707618_707933_+	transglycosylase family protein	A0A1J0GVU2	Streptomyces_phage	4.9e-20	68.2
WP_060633874.1\|707969_708893_+	trypsin-like peptidase domain-containing protein	NA	NA	NA	NA
WP_060633875.1\|708889_709915_+	hypothetical protein	NA	NA	NA	NA
WP_145984204.1\|709965_710286_+	hypothetical protein	NA	NA	NA	NA
WP_145984205.1\|710297_711128_+	hypothetical protein	NA	NA	NA	NA
WP_060577021.1\|711124_712891_+	hypothetical protein	NA	NA	NA	NA
WP_060577019.1\|712964_714494_+	hypothetical protein	NA	NA	NA	NA
WP_060577016.1\|714490_716206_+	ATP-binding protein	NA	NA	NA	NA
WP_060577013.1\|716214_717354_+	C40 family peptidase	A0A1C9EHF6	Mycobacterium_phage	3.8e-30	37.0
WP_060577011.1\|717350_718064_+	J domain-containing protein	A0A2K9L1L4	Tupanvirus	7.2e-11	46.8
WP_060577007.1\|719545_721375_+	TraM recognition domain-containing protein	NA	NA	NA	NA
WP_060577005.1\|721495_721933_+	hypothetical protein	NA	NA	NA	NA
WP_060577003.1\|721929_723231_+	hypothetical protein	NA	NA	NA	NA
WP_060577002.1\|723339_724062_+	hypothetical protein	NA	NA	NA	NA
WP_168172353.1\|724144_728347_-	relaxase domain-containing protein	V5UQN3	Mycobacterium_phage	3.5e-28	26.1
WP_060576998.1\|728936_729755_-	hypothetical protein	NA	NA	NA	NA
WP_168172354.1\|730186_730339_-	hypothetical protein	NA	NA	NA	NA
WP_060576994.1\|732002_732491_-	hypothetical protein	NA	NA	NA	NA
WP_060576992.1\|732539_732830_-	hypothetical protein	NA	NA	NA	NA
WP_082538566.1\|732885_733188_-	hypothetical protein	NA	NA	NA	NA
WP_082538567.1\|733846_734371_-	hypothetical protein	NA	NA	NA	NA
WP_060576985.1\|735048_735348_+	hypothetical protein	NA	NA	NA	NA
WP_082538568.1\|735593_736436_+	DNA-protecting protein DprA	S6BFL3	Thermus_phage	1.6e-28	37.1
WP_145984206.1\|736432_737230_+	hypothetical protein	NA	NA	NA	NA
WP_060572134.1\|737676_738900_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_060633877.1\|738952_739702_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.4e-12	29.1
WP_082538521.1\|739967_740840_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_060633879.1\|740847_742191_-	MFS transporter	NA	NA	NA	NA
WP_060572134.1\|742416_743640_+\|transposase	IS110 family transposase	NA	NA	NA	NA
755642:755660	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP012181

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP012182

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection