CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP008750	Brucella melitensis strain 20236 isolate Bme20236 chromosome 1, complete sequence	1 crisprs	csa3,WYL,DEDDh	0	1	3	0
NZ_CP008751	Brucella melitensis strain 20236 isolate Bme20236 chromosome 2, complete sequence	0 crisprs	csa3,cas3,DEDDh	0	0	99	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP008750_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP008750_1

658884-658966

Orphan

Consensus_repeat	Method
ATCCCGAAAAGTGCGAAGCGGTTTTCGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP008750_1

>merge|NZ_CP008750|1|658884-658966|CRISPRCasFinder
ATCCCGAAAAGTGCGAAGCGGTTTTCGGATAAGATGCGCGCAAGGAAAGATCTGTATCCCGAAAAGTGCGAAGCGGTGTTCGG

>NZ_CP008750|1|1|658884-658966|CRISPRCasFinder
ATCCCGAAAAGTGCGAAGCGGTTTTCGG	ATAAGATGCGCGCAAGGAAAGATCTGT
ATCCCGAAAAGTGCGAAGCGGTGTTCGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP008750.1\|WP_004683363.1\|648836_649763_-\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271177
NZ_CP008750.1\|WP_002963791.1\|658394_658871_+\|SsrA-binding-protein-SmpB	unknown	unknown	gnl\|CDD\|235455
NZ_CP008750.1\|WP_002971501.1\|668438_669278_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380379
NZ_CP008750.1\|WP_004686526.1\|657422_658304_+\|4-hydroxy-tetrahydrodipicolinate-synthase	unknown	unknown	gnl\|CDD\|235107
NZ_CP008750.1\|WP_002963786.1\|653212_653854_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP008750.1\|WP_005969508.1\|654170_654827_+\|endonuclease	unknown	unknown	gnl\|CDD\|237082
NZ_CP008750.1\|WP_004685525.1\|661323_663576_+\|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase	unknown	unknown	gnl\|CDD\|223394
NZ_CP008750.1\|WP_002966733.1\|669327_669903_+\|DUF2062-domain-containing-protein	unknown	unknown	gnl\|CDD\|225757
NZ_CP008750.1\|WP_002963792.1\|659007_659679_-\|uracil-DNA-glycosylase	unknown	unknown	gnl\|CDD\|381681
NZ_CP008750.1\|WP_014489380.1\|664321_665077_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|236494
NZ_CP008750.1\|WP_004685524.1\|654889_656947_-\|lytic-transglycosylase-domain-containing-protein	unknown	unknown	gnl\|CDD\|381604
NZ_CP008750.1\|WP_004686530.1\|647340_648474_-\|pyridoxal-phosphate-dependent-aminotransferase	unknown	unknown	gnl\|CDD\|181255
NZ_CP008750.1\|WP_006136158.1\|651980_653069_+\|porin	unknown	unknown	gnl\|CDD\|308243
NZ_CP008750.1\|WP_004683386.1\|659709_660285_-\|NYN-domain-containing-protein	unknown	unknown	gnl\|CDD\|350235
NZ_CP008750.1\|WP_002963787.1\|653909_654092_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP008750.1\|WP_002963797.1\|663583_664162_+\|orotate-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|273579
NZ_CP008750.1\|WP_002963795.1\|660681_661083_+\|DNA-directed-RNA-polymerase-subunit-omega	unknown	unknown	gnl\|CDD\|234744
NZ_CP008750.1\|WP_002970988.1\|650037_651141_-\|porin	unknown	unknown	gnl\|CDD\|308243
NZ_CP008750.1\|WP_004683395.1\|666975_668187_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341031
NZ_CP008750.1\|WP_004686524.1\|665457_666792_+\|oxygen-independent-coproporphyrinogen-III-oxidase	unknown	unknown	gnl\|CDD\|237356

Protein	Function_ID	Function_description	E-value
NZ_CP008750.1\|WP_004683363.1\|648836_649763_-\|site-specific-integrase	gnl\|CDD\|271177	cd00796, INT_Rci_Hp1_C, Shufflon-specific DNA recombinase Rci and Bacteriophage Hp1_like integrase, C-terminal catalytic domain. Rci protein is a tyrosine recombinase specifically involved in Shufflon type of DNA rearrangement in bacteria. The shufflon of plasmid R64 consists of four invertible DNA segments which are separated and flanked by seven 19-bp repeat sequences. RCI recombinase facilitates the site-specific recombination between any inverted repeats results in an inversion of the DNA segment(s) either independently or in groups. HP1 integrase promotes site-specific recombination of the HP1 genome into that of Haemophilus influenza. Bacteriophage Hp1_like integrases are tyrosine based site specific recombinases. They belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	1.39039e-42
NZ_CP008750.1\|WP_006136158.1\|651980_653069_+\|porin	gnl\|CDD\|308243	pfam02530, Porin_2, Porin subfamily. This family consists of porins from the alpha subdivision of Proteobacteria the members of this family are related to pfam00267. The porins form large aqueous channels in the cell membrane allowing the selective entry of hydrophilic compounds this so called 'molecular sieve' is found in the cell walls of gram negative bacteria.	2.63888e-115
NZ_CP008750.1\|WP_002971501.1\|668438_669278_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|380379	cd06124, cupin_NimR-like_N, AraC/XylS family transcriptional regulators similar to NimR, N-terminal cupin domain. This family contains mostly bacterial proteins containing an AraC/XylS family helix-turn-helix (HTH) DNA-binding domain C-terminal to a cupin domain, and may be possible transcriptional regulators. Included in this family is Escherichia coli HTH-type transcriptional regulator NimR (also called YeaM) that negatively regulates expression of the nimT operon and its own expression. Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	5.72308e-33
NZ_CP008750.1\|WP_004686526.1\|657422_658304_+\|4-hydroxy-tetrahydrodipicolinate-synthase	gnl\|CDD\|235107	PRK03170, PRK03170, dihydrodipicolinate synthase; Provisional.	7.73311e-177
NZ_CP008750.1\|WP_004686524.1\|665457_666792_+\|oxygen-independent-coproporphyrinogen-III-oxidase	gnl\|CDD\|237356	PRK13347, PRK13347, coproporphyrinogen III oxidase; Provisional.	0
NZ_CP008750.1\|WP_005969508.1\|654170_654827_+\|endonuclease	gnl\|CDD\|237082	PRK12373, PRK12373, NADH-quinone oxidoreductase subunit E.	1.44499e-28
NZ_CP008750.1\|WP_004685525.1\|661323_663576_+\|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase	gnl\|CDD\|223394	COG0317, SpoT, Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription].	0
NZ_CP008750.1\|WP_002966733.1\|669327_669903_+\|DUF2062-domain-containing-protein	gnl\|CDD\|225757	COG3216, COG3216, Uncharacterized protein conserved in bacteria [Function unknown].	5.43979e-83
NZ_CP008750.1\|WP_002963792.1\|659007_659679_-\|uracil-DNA-glycosylase	gnl\|CDD\|381681	cd10031, UDG-F5_TTUDGB_like, Uracil DNA glycosylase family 5, includes Thermotoga maritima TTUDGB and similar proteins. Uracil DNA glycosylase family 5 includes Thermus thermophilus HB8 TTUDGB (also called UDGb) which is not only a UDG acting on double-stranded uracil-containing DNA, but also a hypoxanthine DNA glycosylase acting on double-stranded hypoxanthine-containing DNA (except for the C/I base pair), as well as a xanthine DNA glycosylase acting on both, double-stranded and single-stranded xanthine-containing DNA. TTUDGB also excises thymine from G:T mismatched DNA, and removes analogs of uracil from DNA, including 5-hydroxymethyluracil (hmU) and 5-fluorouracil (fU). This subfamily also contains Bradyrhizobium diazoefficiens family 5 homolog Blr5068 (UdgB) which has been found to efficiently excise uracil from ssDNA and dsDNA. Uracil-DNA glycosylases (UDGs) initiate repair of uracils in DNA. Similar to family 4 UDGs, members of this family possess four conserved cysteine residues required to coordinate the [4Fe-4S] iron-sulfur cluster. Uracil in DNA can arise as a result of mis-incorporation of dUMP residues by DNA polymerase or via deamination of cytosine. Uracil in DNA mispaired with guanine is one of the major pro-mutagenic events, causing G:C->A:T mutations. Thus, UDG is an essential enzyme for maintaining the integrity of genetic information. UDGs have been classified into various families on the basis of their substrate specificity, conserved motifs, and structural similarities. Although these families demonstrate different substrate specificities, often the function of one enzyme can be complemented by the other.	7.75632e-104
NZ_CP008750.1\|WP_014489380.1\|664321_665077_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|236494	PRK09391, fixK, transcriptional regulator FixK; Provisional.	3.86936e-50
NZ_CP008750.1\|WP_004685524.1\|654889_656947_-\|lytic-transglycosylase-domain-containing-protein	gnl\|CDD\|381604	cd13401, Slt70-like, 70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.	2.23686e-60
NZ_CP008750.1\|WP_002963795.1\|660681_661083_+\|DNA-directed-RNA-polymerase-subunit-omega	gnl\|CDD\|234744	PRK00392, rpoZ, DNA-directed RNA polymerase subunit omega; Reviewed.	1.70484e-25
NZ_CP008750.1\|WP_002963791.1\|658394_658871_+\|SsrA-binding-protein-SmpB	gnl\|CDD\|235455	PRK05422, smpB, SsrA-binding protein SmpB.	1.57135e-88
NZ_CP008750.1\|WP_004683386.1\|659709_660285_-\|NYN-domain-containing-protein	gnl\|CDD\|350235	cd10911, PIN_LabA, PIN domain of Synechococcus elongatus LabA (low-amplitude and bright) and related proteins. This subfamily contains Synechococcus elongatus PCC 7942 LabA which participates in cyanobacterial circadian timing, it is required for negative feedback regulation of the autokinase/autophosphatase KaiC, a central component of the circadian clock system, and appears to be necessary for KaiC-dependent repression of gene expression. This subfamily belongs to the LabA-like domain family which includes the N-terminal domain of limkain b1, a human autoantigen localized to a subset of ABCD3 and PXF marked peroxisomes. Also included in the LabA-like domain family are human ZNF451, uncharacterized Bacillus subtilis YqxD, uncharacterized Escherichia coli YaiI, and the N-terminal domain of a well-conserved group of mainly bacterial proteins with no defined function, which contain a C-terminal LabA_like_C domain. Curiously Pseudomonas putida S16 NicB , which is described as a putative NADH-dependent hydroxylase involved in the microbial degradation of nicotine also falls into the LabA-like family. The PIN (PilT N terminus) domain belongs to a large nuclease superfamily. The structural properties of the PIN domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions; in some members, additional metal coordinating residues can be found while some others lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	1.30427e-60
NZ_CP008750.1\|WP_004686530.1\|647340_648474_-\|pyridoxal-phosphate-dependent-aminotransferase	gnl\|CDD\|181255	PRK08153, PRK08153, pyridoxal phosphate-dependent aminotransferase.	0
NZ_CP008750.1\|WP_002963797.1\|663583_664162_+\|orotate-phosphoribosyltransferase	gnl\|CDD\|273579	TIGR01367, Orotate_phosphoribosyltransferase, orotate phosphoribosyltransferase, Thermus family. This model represents a distinct clade of orotate phosphoribosyltransferases. Members include the experimentally determined example from Thermus aquaticus and additional examples from Caulobacter crescentus, Helicobacter pylori, Mesorhizobium loti, and related species. [Purines, pyrimidines, nucleosides, and nucleotides, Pyrimidine ribonucleotide biosynthesis].	2.00708e-76
NZ_CP008750.1\|WP_004683395.1\|666975_668187_-\|MFS-transporter	gnl\|CDD\|341031	cd17478, MFS_FsR, Fosmidomycin resistance protein of the Major Facilitator Superfamily of transporters. Fosmidomycin resistance protein (FsR) confers resistance against fosmidomycin. It shows sequence similarity with the bacterial drug-export proteins that mediate resistance to tetracycline and chloramphenicol. This FsR family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	8.97193e-108
NZ_CP008750.1\|WP_002970988.1\|650037_651141_-\|porin	gnl\|CDD\|308243	pfam02530, Porin_2, Porin subfamily. This family consists of porins from the alpha subdivision of Proteobacteria the members of this family are related to pfam00267. The porins form large aqueous channels in the cell membrane allowing the selective entry of hydrophilic compounds this so called 'molecular sieve' is found in the cell walls of gram negative bacteria.	7.06318e-105

>NZ_CP008750.1|WP_002963791.1|658394_658871_+|SsrA-binding-protein-SmpB
MNKPKNSPARKMIAENRKARFNFEILDTLEAGLVLTGTEVKSLRANQANIAESYASFEDGEFWLINSYIPEYTQGNRFNHEPRRLRKLLVSRREMSRLFNSVSREGMTVVPLKLYFNDRGRAKLELALARGKKTHDKRETEKKRDWNREKARLLRDRG
>NZ_CP008750.1|WP_004686526.1|657422_658304_+|4-hydroxy-tetrahydrodipicolinate-synthase
MLKGSITALVTPFDREGAFDEKAFRAFVNWQIEEGTKGLVPVGTTGETPTLSHDEHKRVIEVCIEVAAGRVPVIAGAGSNNTVEAIELAQHAEKAGADAVLVVTPYYNKPNQRGLYEHFSRVARSISIPLVIYNVPGRSIIDMTPETMGALVRDCKNIVGVKDATGKIERVSEQRAICGKEFIQLSGEDATALGFNAHGGVGCISVTSNIAPRLCAEFQEACQAGNFAKALELQDRLMPLHKALFLEPNPSGPKYALSRLGRIENVLRSPMVTIEAATAEKIDHAMKHAVLIN
>NZ_CP008750.1|WP_004685524.1|654889_656947_-|lytic-transglycosylase-domain-containing-protein
MVSLAQSSLPPEIPTPLARPFAPTATHQSPISLVTPRPRPIAPDPMATSAVSRTDNPAVIGGTLKNGLDALSAKNVASAIASRNNLPRGSLDRQILTWAIATSGMDGVPSTEIAAAASELSGWPGMATLRRNSERALFKENPSSATIIATFGSTRPQTTEGMIALARAYVATGNSTKAHQLLSPWWTRKRLSSDDEQKILKEFSAILTREDHQRRLLHSLYNGHLQSARLLAGPAQAQSLYNAYAAVAQKSPNAASAIAAVDRSWQANPVYQFLKIRYLRRAERYNEAAELLLKAPRKASVLVDPDAWWVERRILSRELLDLGKPQLAYRLAAAHAAETPTMAAEAEFHAGWYALRALNQPKLAAPHFAKITQISARPISASRAYYWLGRAAEAGSGGDARAYYRRSAHFGTTFYGQLAAAKLNEKAPELAYPKPTEAERVRFASRPAVQAIKRLEQVGYGNKAAALYTQLSQELDSVGELALLAVMAERNDNHYMALRVGKTAAMRGLDVGALSHPLGAIPASANIKGSGKALAYAIARQESEFNVSAVSKAGARGLLQLMPATAKTVATRNGMSFSAQKLTADAAYNATLGAHFLGEQLDRFNGSYVLTFAGYNAGPRRASEWVEKYGDPRGKSVEQVVDWIERIPYSETRNYVQRVMENYEVYKTRLTGRADIKTDLVYGRR
>NZ_CP008750.1|WP_005969508.1|654170_654827_+|endonuclease
MPLLIVQLAILIAVAFVVGCFLGRILRRRKSAGSDHERTIVAAALSTPPLAEKPEPVPPAEPVRADSDPLKRKAGLEKARIEPVEGSADSDVAAAPVLKKVPAETPDDAGRPQWREAPRRGKADELTAIEGIGKAIEAVLHELGIFHYDQIAQWTREEAIWIERRIGFPGRVEREGWIAQAAKLAEPPAKSTTKRGAKTKKAANNVRSGTRRAKKQAG
>NZ_CP008750.1|WP_002963787.1|653909_654092_+|hypothetical-protein
MTVFPIRPFLCYDYSAKGLKCLAKYYAESLMLYLVETFWPVLVLAILIGAATGWLTAGER
>NZ_CP008750.1|WP_002963786.1|653212_653854_+|hypothetical-protein
MKKWFWPCLTWTACLTALALWFGADRVETDIAEQTAKALEPYVWAGFYVDGRDVVLKGMAPDPDMQRAAHAALEHVWAIRDITDLTTVLQLASPYRFKIGRNAQGLVLSGFIPNNESRDQVMTAAGEVAPDIFIDDEMAVARGNQPEFMERVLFAIDLAKKLPEAEIEIVDEKLSIRGTVSDEAIYDEIEALKAAQLPYGLKLAVLDVKKSVQ
>NZ_CP008750.1|WP_006136158.1|651980_653069_+|porin
MNIKSLLLGSAAALVAASGAQAADAIVAPESEAVEYVRVCDAYGAGYFYIPGTETCLRVHGYVRYDVKGGDDVYSGTDRNGWDKGARFALRVSTGSETELGTLKTFTELRFNYAANNSGVDGKYGNETSSGTVMEFAYIQLGGLRVGIDESEFHTFTGYLGDVINDDVISAGSYRTGKIAYTFTGGNGFSAVIALEQGGDNDGGYTGTTNYHIDGYMPDVVGGLKYAGGWGSIAGVVAYDSVIEEWAAKVRGDVNITDQFSVWLQGAYSSAATPDQNYGQWGGDWAVWGGLKYQATQKAAFNLQAAHDDWGKTAVTANVAYELVPGFTVTPEVSYTKFGGEWKNTVAEDNAWGGIVRFQRSF
>NZ_CP008750.1|WP_002970988.1|650037_651141_-|porin
MNIKSLLLGSAAALVAASGAQAADAIVAPEPEAVEYVRVCDAYGAGYFYIPGTETCLRVHGYVRYDVKGGDDVYSGTDRNGWDKGARFALMFNTNSETELGTLGTYTQLRFNYTSNNSRHDGQYGDFSDDRDVADGGVSTGTDLQFAYITLGGFKVGIDESEFHTFTGYLGDVINDDVVAAGSYRTGKIAYTFTGGNGFSAVIALEQGGEDVDNDYTIDGYMPHVVGGLKYAGGWGSIAGVVAYDSVIEEWATKVRGDVNITDRFSVWLQGAYSSAATPNQNYGQWGGDWAVWGGAKFIAPEKATFNLQAAHDDWGKTAVTANVAYQLVPGFTITPEVSYTKFGGEWKDTVAEDNAWGGIVRFQRSF
>NZ_CP008750.1|WP_004683363.1|648836_649763_-|site-specific-integrase
MIIVGETKIDTGDKYAPIIDYNLNYISGKNPKHRLVEHYSVAELTAKYINILWDDGPHKYNVRSFLGEIDEILKGARFSGFDQEMLDSIIGTLRERGNSNATINRKMAALSKLLRKAHKMGDIFNLPEFIRQKERVGRIRFLEQEEEKRLFAAIKSRCEDSYRLSVFLVDTGCRLGEAIGLTWNDIQEQRVTFWVTKSNRSRTVPLTRRARKASHIPRERLKGPFSMLNQVRFRQIWNEAKAEVGLGADDQIVPHILRHTCASRLVRGGIDIRRVQMWLGHQTLQMTMRYAHLATHDLDSCVKVLEIH
>NZ_CP008750.1|WP_004686530.1|647340_648474_-|pyridoxal-phosphate-dependent-aminotransferase
MAQPRLTPLVESLPSTVPFIGPETLELQRGKPFEARIGANENSFGPAPSVIEAMRNEATEVWKYGDPENYALRHAIAAHHGLKAEHIMPGAGVDALLGLIVRQYVQQGDKVINSLGGYPTFNYHVAGYGGQLVTVPYRDDKPDLDALIDAAAREKPALLYIANPDNPMGTWHGGADIQSFIERLPETTLLILDEAYCETAPASAFPPFETDRPNVLRMRTFSKAYGLAGIRCGYAVGNPVAIKTFDKVRDHFAVSRMAQAAAIAALKDQAYLHEVVGKICAGRDRIAAIAEANGLHAVASATNFVAIDCGRGKDFAQAVLNGLISRDIFVRKPGTPVLDRCIRVSVGVKEQLDQFEAAFPEALEEARKICAANAENT
>NZ_CP008750.1|WP_002963792.1|659007_659679_-|uracil-DNA-glycosylase
MISEPSPNCSICPRLHAFLQEWRQKEPAWHNAPVPPFLPGSDEDVRLLIVGLAPGLRGANRTGRPFTGDYAGELLYSTLCEFGFATGKFEARPDDSLRLLDACIVNAVRCVPPENKPVGSEINNCRQFLTPMLTRFPNLDAVVTLGTIAHQSTVRALGVPVSRHPFGHGKATDIGPLRIFSSYHCSRYNTNTGVLTDAMFRDVFKNVRAYLSEKAAGSARLSV
>NZ_CP008750.1|WP_004683386.1|659709_660285_-|NYN-domain-containing-protein
MFDSREKIALFIDGANLYAASKTLGFDIDYRKLLKAFQKRGYLLRAYYYTALVEDQEYSSIRPLIDWLDYNGYKVVTKAAREFTDSTGRRKVKGNMDIELTVDAMQLTDTVDHFVIFSGYGDFRSLVEALQRKGRKVSVVSTLTTQPAMISDELRRQADHFIDLVSLKAEIGRDPSERAPRRQEEDFDESY
>NZ_CP008750.1|WP_002963795.1|660681_661083_+|DNA-directed-RNA-polymerase-subunit-omega
MARVTVEDCVDKVENRFELVLLAGHRARQISQGAPITVDRDNDKNPVVALREIADETLSPDDLKEDLIHSLQKHVEVDEPEAAPAQIANAAEEIAEGIAEAGEEDVVTFDRMSEEELLAGIEGLVAPEKNDGF
>NZ_CP008750.1|WP_004685525.1|661323_663576_+|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase
MMRQYELVERVQRYKPDVNEALLNKAYVYAMQKHGSQKRASGDPYFSHPLEVAAILTDMHLDEATIAIALLHDTIEDTTATRQEIDQLFGPEIGKLVEGLTKLKKLDLVSKKAVQAENLRKLLLAISEDVRVLLVKLADRLHNMRTLGVMREDKRLRIAEETMDIYAPLAGRMGMQDMREELEELAFRYINPDAWRAVTDRLAELLEKNRGLLQKIETDLSEIFEKNGIKASVKSRQKKPWSVFRKMESKGLSFEQLSDIFGFRVMVDTVQDCYRALGLIHTTWSMVPGRFKDYISTPKQNDYRSIHTTIIGPSRQRIELQIRTREMDEIAEFGVAAHSIYKDRGSANNPHKISTETNAYAWLRQTIEQLSEGDNPEEFLEHTKLELFQDQVFCFTPKGRLIALPRGATPIDFAYAVHTDIGDSCVGAKVNGRIMPLMTELKNGDEVDIIRSKAQVPPAAWESLVATGKARAAIRRATRSAVRKQYSGLGMRILERAFERAGKPFSKDILKPGLPRLARKDVEDVLAAVGRGELPSTDVVKAVYPDYQDTRVTTQNNPAKAGEKGWFNIQNAAGMIFKVPEGGEGAAAKVDPAATTPKPGKRALPIRGTNPDLPVRFAPEGAVPGDRIVGILQPGAGITIYPIQSPALTAYDDQPERWIDVRWDIDDQMSERFPARISVSAINSPGSLAEIAQIAAANDANIHNLSMVRTAPDFTEMIIDVEVWDLKHLNRIISQLKESASVSSAKRVNG
>NZ_CP008750.1|WP_002963797.1|663583_664162_+|orotate-phosphoribosyltransferase
MNTDDVLAVFREAGAILEGHFILTSGLRSPVFLQKARVFMHADKTEKLCKALAEKIRAADLGPIDYVVGPAIGGLIPSYETSRHLGVPSVWVERENGVFRLRRFDVPKGARVVIVEDIVTTGLSIRETIDCMKDLGIEVVAAACIVDRSAGKADVGTRLISLAEYEVPAYPADKLPPELAAIPAVKPGSRNI
>NZ_CP008750.1|WP_014489380.1|664321_665077_+|helix-turn-helix-domain-containing-protein
MVVVPFALDQNQKLAARTPCNVCEDCCVRSMAVCSALDDGDLAALEAIMTSKKLDTNEMLVEEGEPKLRVYSLTSGMLRIYTSLPDGRRQIAGFLFPGDFLGLADDEVYSLLAEAVVPSALCAFSAKEMERLMERFPKLKERLYQMTRLALRTARDNQLVLGRLAPVEKLASFLLVLSARAEKRGEKPNPVHLLMNRTDIADYLGLTIETVSRSFTKLKTQGLIQLRDANTVEILSRRSLAVVAGLDPDNL
>NZ_CP008750.1|WP_004686524.1|665457_666792_+|oxygen-independent-coproporphyrinogen-III-oxidase
MHDDAIRRYAALAVPRYTSYPTAADFVPVGMDTTRRWLRQIGPEESVSLYIHVPYCSQICHYCGCNAKMAIREDVIENFVNALLGEIRTVSASLTARPRVAHLHWGGGTPSILNAGQFQTVLAAIRTAFDFDLSMEHAIELDPRTVTPLLAKTLAEMGVNRASLGVQDVDSRVQMAIGRVQPIETVAEATRLLREVGINRINFDLIYGLPLQTVETLRETCERVVTLSPDRVACYGYAHLPQRRANQRLIDENTLPDADERFRQARIVTDSFIGFGYQPVGIDHFALPDDDLAIAAREGTLNRNFQGYTNDRCGTLIGFGPSSISQFPGGYAQNISDVGQYRKRVEAGELATVRGYTLRDADRIRSAIISALMCNFCVDLNAVAPGMEFSDEFALLRPLVADGLVAVEGRTIRATENGKSLIRLVAAAFDEFRRDSVHGFSFAV
>NZ_CP008750.1|WP_004683395.1|666975_668187_-|MFS-transporter
MSVSAAQQPSNSSADNTVLTIILATSLGHFLNDMMQSLLPAIYPMLKENYSLSFWQIGLLTFTFQMTASILQPLVGIYTDRKPMPYSLTFGMGCTLIGLVFLATAHHYSFLLLGAACVGFGSSVFHPEAARVARLASGGRHGFAQSLFQVGGNFGSSIGPLLAAFIVLPFGQISVSWFSVAALIGMFVLWYVGNWYNRYRLANANKPKPDKTLPLPRNRVIASVAVLALLVFTKYIYMASLTSYYTFYTISHFGVSVQTSQLLLFLFLGAVAAGTIIGGPIGDKIGARKVIWASILGVLPFTLALPYANLEMTAVLTIIIGLILASAFPAIIVFAQELLPGRVGMLSGLFFGFAFGMAGIAAAVLGIVADQKGIEFVYRICSYLPFLGLLTIFLPKLERRRKA
>NZ_CP008750.1|WP_002971501.1|668438_669278_+|helix-turn-helix-transcriptional-regulator
MPENEDLQRFHEHRIAMLESMTGPAIALPTRYPDGYFVPRHSHSRAQLLCASQGVVLVTTDAGRWMIPSDHAMWIPAGVEHSVAILGDVFMRSIYISVDAISGVPNYLHVVGLTDLMRCLIIDATSHDSIPAPESRDGLVIELILRDLHTLPEYPLGLPFPSDPRLQKLCRDFVKKPSSRATIDEWADRMAMSRRSFTRHFQRETGVSLSVWRQQACLFAAVPRLSEGEPVTSVALDLGYDSVSAFTTMFRRMLGVPPKFYQPRLDVAPFERSDKAAFG
>NZ_CP008750.1|WP_002966733.1|669327_669903_+|DUF2062-domain-containing-protein
MLFQRRYPPTRWERLRLYLWPRRSFSRSFRYGGKRILRITASPHAVAAGLAVGVFSAFTPFFGFHLIIAIVLAYFLAGNVAAAALGTTLANPLTLPFIWGSTFELGRFIMSGSVDSVPPVHLGHALETMRFEEVWTPLLKPMLFGSTILGAAFAVLVYFVTRYAVSVFRRRRLERLAEKHRLHRQRELQKA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP008750_1	1.1\|658912\|27\|NZ_CP008750\|CRISPRCasFinder	658912-658938	27	NZ_CP013986	Klebsiella variicola strain LMG 23571 plasmid unnamed, complete sequence	45587-45613	5	0.815

1. spacer 1.1|658912|27|NZ_CP008750|CRISPRCasFinder matches to NZ_CP013986 (Klebsiella variicola strain LMG 23571 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

ataagatgcgcgcaaggaaagatctgt	CRISPR spacer
aacagatgctctcaaggaaagatctga	Protospacer
*  ****** * **************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

546683 : 649763

Paracoccus_phage(15.0%)

capsid,integrase,head,tail,protease,portal,transposase

attL 642338:642352|attR 652373:652387

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005969645.1\|546683_547238_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	3.9e-12	33.9
WP_087907707.1\|547401_548164_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	3.7e-21	40.0
WP_002975117.1\|548061_548379_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_004685492.1\|548989_550345_+	phosphomannomutase	NA	NA	NA	NA
WP_002963689.1\|550415_551840_+	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	9.0e-53	30.8
WP_002963690.1\|551872_553045_+	AGE family epimerase/isomerase	NA	NA	NA	NA
WP_002969456.1\|553127_554237_+	glycosyltransferase	NA	NA	NA	NA
WP_014489366.1\|556482_557484_+	ABC transporter permease	NA	NA	NA	NA
WP_002969455.1\|557562_558525_+	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_004683241.1\|558582_559635_+	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_004683244.1\|559642_560815_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_002966715.1\|560856_562164_-	xylose isomerase	NA	NA	NA	NA
WP_004683247.1\|562210_563662_-	xylulokinase	NA	NA	NA	NA
WP_004685498.1\|563694_564726_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_004686553.1\|564988_565432_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_004683253.1\|565413_565983_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_004686552.1\|566520_567984_-	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_004683258.1\|569820_570417_-	transcriptional regulator BetI	NA	NA	NA	NA
WP_002963705.1\|570607_571630_+	asparaginase	NA	NA	NA	NA
WP_002967489.1\|571674_572145_+	GreA/GreB family elongation factor	NA	NA	NA	NA
WP_004686549.1\|572141_572531_-	type II toxin-antitoxin system death-on-curing family toxin	A0A1B3AYM0	Gordonia_phage	7.7e-07	43.1
WP_004683261.1\|572527_572758_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_002963709.1\|572818_573811_-	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_004683264.1\|573966_574644_+	FadR family transcriptional regulator	NA	NA	NA	NA
WP_004686548.1\|574640_575939_+	CynX/NimT family MFS transporter	NA	NA	NA	NA
WP_002963712.1\|575995_576358_-	hypothetical protein	NA	NA	NA	NA
WP_002963713.1\|576693_578205_+	DUF853 domain-containing protein	A0A248XCZ8	Klebsiella_phage	1.4e-83	44.3
WP_002963714.1\|578402_579119_-	L,D-transpeptidase	NA	NA	NA	NA
WP_006139491.1\|579177_579420_+	hypothetical protein	NA	NA	NA	NA
WP_004683270.1\|580296_580896_+	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	6.2e-40	43.1
WP_002963717.1\|581067_581403_-	hypothetical protein	NA	NA	NA	NA
WP_002967492.1\|581520_583629_-	S9 family peptidase	NA	NA	NA	NA
WP_002963720.1\|584201_584630_+	MucR family transcriptional regulator	A0A1P8VVG0	Erythrobacter_phage	1.0e-20	47.6
WP_006136191.1\|584837_585149_-	hypothetical protein	NA	NA	NA	NA
WP_004686544.1\|585330_585786_+	hypothetical protein	NA	NA	NA	NA
WP_005969604.1\|585782_586556_+	hypothetical protein	NA	NA	NA	NA
WP_002967494.1\|586668_588006_+	amidase	NA	NA	NA	NA
WP_002963725.1\|588046_588472_-	SufE family protein	NA	NA	NA	NA
WP_004683280.1\|588551_589016_-	hypothetical protein	NA	NA	NA	NA
WP_004686543.1\|589306_591136_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.2e-22	28.9
WP_002971535.1\|591110_592079_+	peptidoglycan-binding protein	NA	NA	NA	NA
WP_002963729.1\|592092_592440_+	DUF1491 family protein	NA	NA	NA	NA
WP_006136186.1\|592450_593509_-	hypothetical protein	NA	NA	NA	NA
WP_004683287.1\|593706_594249_-	hypothetical protein	NA	NA	NA	NA
WP_002963732.1\|594241_594853_-	DUF1214 domain-containing protein	NA	NA	NA	NA
WP_006136183.1\|594859_597034_-	penicillin-binding protein 1A	NA	NA	NA	NA
WP_002963734.1\|597373_597886_+	hypothetical protein	NA	NA	NA	NA
WP_005969588.1\|597824_599084_+	DNA-packaging protein	A0A1V0DY66	Dinoroseobacter_phage	1.3e-71	40.6
WP_002963736.1\|599115_600309_+\|portal	phage portal protein	W8ECU7	Geobacillus_phage	7.0e-67	40.0
WP_002967499.1\|600305_600683_+	hypothetical protein	NA	NA	NA	NA
WP_004686539.1\|601360_602635_+\|capsid	phage major capsid protein	Q8HAD2	Salmonella_phage	3.1e-81	42.9
WP_002963740.1\|602799_603366_+\|head,tail	phage head-tail connector protein	NA	NA	NA	NA
WP_002967503.1\|603362_603701_+\|head	phage head closure protein	NA	NA	NA	NA
WP_006072374.1\|603822_604230_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_002963743.1\|604270_604684_+\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_004683300.1\|604680_605022_+	gene transfer agent family protein	NA	NA	NA	NA
WP_004683301.1\|605065_605236_+\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_002970984.1\|605240_605786_+\|tail	phage tail tape measure protein	A0A0S2SYD9	Pseudomonas_phage	2.8e-07	46.4
WP_002963747.1\|605788_606421_+	TIGR02217 family protein	A0A0B5A2K3	Paracoccus_phage	2.9e-48	47.6
WP_004683305.1\|606417_607293_+	DUF2163 domain-containing protein	A0A0K1Y6Z2	Rhodobacter_phage	4.5e-47	38.9
WP_004683307.1\|607289_607724_+	C40 family peptidase	NA	NA	NA	NA
WP_006136169.1\|607727_608915_+	hypothetical protein	A0A0B5A7K5	Paracoccus_phage	1.3e-36	34.7
WP_006136163.1\|608931_611589_+\|tail	glycoside hydrolase/phage tail family protein	A0A0B5A7K5	Paracoccus_phage	2.7e-143	35.4
WP_002969445.1\|611653_611860_+	hypothetical protein	NA	NA	NA	NA
WP_002971526.1\|612021_612318_+	hypothetical protein	NA	NA	NA	NA
WP_014489377.1\|612396_613086_+	response regulator transcription factor	NA	NA	NA	NA
WP_002969444.1\|613160_614471_+	hypothetical protein	NA	NA	NA	NA
WP_002971524.1\|614564_615017_+	hypothetical protein	NA	NA	NA	NA
WP_004686536.1\|615117_616257_+	c-type cytochrome biogenesis protein CcmI	NA	NA	NA	NA
WP_002963757.1\|616253_616751_+	cytochrome c maturation protein CcmE	NA	NA	NA	NA
WP_002963758.1\|616770_618762_+	heme lyase CcmF/NrfE family subunit	NA	NA	NA	NA
WP_004683319.1\|618758_619235_+	cytochrome c-type biogenesis protein CcmH	NA	NA	NA	NA
WP_004683321.1\|619376_620918_+\|protease	DegQ family serine endoprotease	A0A1B1IT49	uncultured_Mediterranean_phage	1.7e-28	29.8
WP_004683323.1\|621011_621719_+	response regulator transcription factor	NA	NA	NA	NA
WP_005969562.1\|621715_623122_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_004685514.1\|623244_626196_+	bifunctional [glutamine synthetase] adenylyltransferase/[glutamine synthetase]-adenylyl-L-tyrosine phosphorylase	NA	NA	NA	NA
WP_002966727.1\|626240_628352_-	O-antigen ligase family protein	NA	NA	NA	NA
WP_002963765.1\|628622_630974_-	PAS-domain containing protein	A0A1V0SGX0	Hokovirus	6.3e-27	34.8
WP_004685516.1\|631364_634016_-	aminopeptidase N	NA	NA	NA	NA
WP_002963767.1\|634241_635201_+	DMT family transporter	NA	NA	NA	NA
WP_005969556.1\|635205_636462_-	MFS transporter	NA	NA	NA	NA
WP_002963769.1\|636623_637496_-	uracil-DNA glycosylase	NA	NA	NA	NA
WP_004683340.1\|637884_639576_+	electron transfer flavoprotein-ubiquinone oxidoreductase	NA	NA	NA	NA
WP_006136161.1\|639691_640768_-	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_004683344.1\|640820_642323_-	AMP nucleosidase	NA	NA	NA	NA
642338:642352	attL	NA	NA	NA	NA
WP_004683346.1\|642363_642531_-	hypothetical protein	NA	NA	NA	NA
WP_002971518.1\|642527_642695_-	hypothetical protein	NA	NA	NA	NA
WP_004683348.1\|642889_643600_+	glutathione S-transferase N-terminal domain-containing protein	NA	NA	NA	NA
WP_002963776.1\|643658_644006_-	DUF2147 domain-containing protein	NA	NA	NA	NA
WP_004686532.1\|644002_644242_-	hypothetical protein	NA	NA	NA	NA
WP_004683353.1\|644511_644769_+	sel1 repeat family protein	NA	NA	NA	NA
WP_004683355.1\|644828_645599_-	YitT family protein	NA	NA	NA	NA
WP_004683357.1\|646253_646904_+	hypothetical protein	NA	NA	NA	NA
WP_006136160.1\|646948_647323_-	DUF423 domain-containing protein	NA	NA	NA	NA
WP_004686530.1\|647340_648474_-	pyridoxal phosphate-dependent aminotransferase	A0A1X7QHI1	Faustovirus	2.4e-16	24.2
WP_004683363.1\|648836_649763_-\|integrase	site-specific integrase	A0A076YL28	Mesorhizobium_phage	5.9e-29	31.6
652373:652387	attR	NA	NA	NA	NA

DBSCAN-SWA_2

874936 : 886848

uncultured_Mediterranean_phage(90.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004683698.1\|874936_875788_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	4.4e-31	33.5
WP_002964011.1\|875780_876506_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	1.5e-43	45.7
WP_002964012.1\|876651_876870_+	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	1.5e-07	65.1
WP_006094283.1\|876980_877547_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_002964014.1\|877543_878368_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	9.8e-44	41.1
WP_004683702.1\|878444_879728_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.6e-104	47.2
WP_004683703.1\|879876_880644_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.0e-39	40.2
WP_004683704.1\|880640_881309_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	6.6e-14	38.5
WP_002964018.1\|881453_881639_+	hypothetical protein	NA	NA	NA	NA
WP_002964019.1\|881687_882986_+	peptidoglycan DD-metalloendopeptidase family protein	Q8SBN9	Clostridium_phage	1.0e-18	41.1
WP_002964020.1\|883034_883901_-	ATP-binding protein	NA	NA	NA	NA
WP_002964021.1\|884060_884402_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	9.1e-12	40.2
WP_014490079.1\|884520_886848_+	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	6.2e-51	43.5

DBSCAN-SWA_3

957556 : 965895

Brucella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005968944.1\|957556_958261_+	hypothetical protein	A0A076GD06	Sinorhizobium_phage	4.5e-05	46.8
WP_002964091.1\|958257_958488_+	hypothetical protein	NA	NA	NA	NA
WP_002964092.1\|958484_958760_+	hypothetical protein	NA	NA	NA	NA
WP_002966806.1\|958782_959259_+	hypothetical protein	NA	NA	NA	NA
WP_004683739.1\|959604_960315_+	porin family protein	O11861	Bartonella_henselae_phage	5.1e-41	36.8
WP_002964095.1\|960662_960833_-	DUF1508 domain-containing protein	A0A2P1N580	Mycobacterium_phage	3.1e-05	45.1
WP_004683740.1\|961180_961495_-	BrnA antitoxin family protein	K4NZP3	Burkholderia_phage	2.0e-05	42.1
WP_002966807.1\|961494_961740_-	BrnT family toxin	NA	NA	NA	NA
WP_006135935.1\|963339_964032_+	hypothetical protein	A0A141GEY5	Brucella_phage	4.4e-106	97.5
WP_006135932.1\|964443_965895_+	hypothetical protein	A0A141GEY6	Brucella_phage	1.1e-135	56.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP008751

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 13522

Staphylococcus_phage(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002966575.1\|1384_1585_-	hypothetical protein	NA	NA	NA	NA
WP_004685890.1\|1895_2837_+	ribokinase	NA	NA	NA	NA
WP_002966573.1\|2913_3849_-	nucleoside hydrolase	NA	NA	NA	NA
WP_002966572.1\|3934_4846_-	ABC transporter permease	NA	NA	NA	NA
WP_002966571.1\|4842_5922_-	ABC transporter permease	NA	NA	NA	NA
WP_004681138.1\|5983_7555_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.8e-15	27.3
WP_002968810.1\|8907_9516_+\|protease	DUF922 domain-containing Zn-dependent protease	NA	NA	NA	NA
WP_002967156.1\|9487_10228_-	4'-phosphopantetheinyl transferase superfamily protein	NA	NA	NA	NA
WP_004681144.1\|10202_10979_-	2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	3.1e-15	30.0
WP_014489534.1\|10978_11851_-	isochorismatase	NA	NA	NA	NA
WP_004686826.1\|11902_13522_-	(2,3-dihydroxybenzoyl)adenylate synthase	A0A2K9KZV5	Tupanvirus	9.7e-11	23.6

DBSCAN-SWA_2

24181 : 27695

Pithovirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002971304.1\|24181_24934_+	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	1.4e-12	30.4
WP_002968219.1\|24933_25650_+	ABC transporter ATP-binding protein	A0A076FI99	Aureococcus_anophage	1.5e-11	26.4
WP_004685882.1\|25701_26184_+	VOC family protein	NA	NA	NA	NA
WP_014489535.1\|26187_26925_+	SDR family oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	7.0e-17	31.1
WP_032449634.1\|26942_27695_+	SDR family oxidoreductase	A0A0N9R355	Chrysochromulina_ericina_virus	6.5e-10	26.0

DBSCAN-SWA_3

33088 : 37293

Only_Syngen_Nebraska_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005972079.1\|33088_35806_+	magnesium-translocating P-type ATPase	A0A1J0FA34	Only_Syngen_Nebraska_virus	1.8e-38	25.7
WP_004681183.1\|35890_36241_+	hypothetical protein	NA	NA	NA	NA
WP_002968224.1\|36371_36575_+	hypothetical protein	NA	NA	NA	NA
WP_002966539.1\|36576_37293_+	MgtC/SapB family protein	G3MA03	Bacillus_virus	3.4e-16	47.9

DBSCAN-SWA_4

44325 : 44796

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002966528.1\|44325_44796_+	Hsp20 family protein	E3SM62	Prochlorococcus_phage	1.8e-18	36.6

DBSCAN-SWA_5

69195 : 74411

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002966508.1\|69195_70089_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.5e-61	46.0
WP_002968232.1\|70141_71680_-	outer membrane beta-barrel protein	NA	NA	NA	NA
WP_004685873.1\|71820_72822_+	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	1.7e-34	32.4
WP_002966505.1\|72936_73404_-	NfeD family protein	NA	NA	NA	NA
WP_004681235.1\|73424_74411_-	SPFH/Band 7/PHB domain protein	A0A2K9KZA2	Tupanvirus	4.3e-22	32.3

DBSCAN-SWA_6

79611 : 81474

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004685870.1\|79611_81474_-	M3 family oligoendopeptidase	A0A1X9I5X5	Streptococcus_phage	8.2e-38	23.8

DBSCAN-SWA_7

86428 : 90897

Agrobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014489542.1\|86428_87040_-	N-acetylmuramidase family protein	A0A2L0UYX0	Agrobacterium_phage	4.7e-27	41.0
WP_002966492.1\|87170_88088_+	rhodanese-related sulfurtransferase	NA	NA	NA	NA
WP_004681258.1\|88368_89124_+	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002966489.1\|89134_89821_+	molybdate ABC transporter permease subunit	NA	NA	NA	NA
WP_004681262.1\|89817_90897_+	molybdenum ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.9e-18	30.3

DBSCAN-SWA_8

97315 : 98449

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004681278.1\|97315_98449_+	type III PLP-dependent enzyme	A0A2K9L0W9	Tupanvirus	1.7e-38	30.6

DBSCAN-SWA_9

108115 : 110682

Cyanophage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002967175.1\|108115_109525_+	NADP-dependent phosphogluconate dehydrogenase	M4SJX8	Cyanophage	1.7e-24	30.7
WP_004681301.1\|109620_110682_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.5e-33	37.8

DBSCAN-SWA_10

129775 : 130756

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002966444.1\|129775_130756_+	glycosyltransferase family 2 protein	A8CG95	Salmonella_phage	9.9e-43	35.9

DBSCAN-SWA_11

136434 : 141809

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002966437.1\|136434_137067_-	aldolase	A0A077SK32	Escherichia_phage	2.3e-48	51.5
WP_002966436.1\|137092_138058_-	GDP-mannose 4,6-dehydratase	NA	NA	NA	NA
WP_002968266.1\|138057_138849_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	5.1e-58	48.6
WP_002966434.1\|138845_139631_-	hydroxypyruvate isomerase family protein	NA	NA	NA	NA
WP_004681364.1\|139630_140905_-	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	9.9e-128	57.8
WP_005971952.1\|140906_141809_-	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	8.1e-108	70.1

DBSCAN-SWA_12

167345 : 173573

Tupanvirus(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002968994.1\|167345_168173_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	2.3e-64	44.6
WP_004685101.1\|168448_169183_-	L,D-transpeptidase	NA	NA	NA	NA
WP_004685100.1\|169422_170079_+	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_004686171.1\|170197_170815_+	LysE family translocator	NA	NA	NA	NA
WP_004681426.1\|170925_172434_+\|tRNA	histidine--tRNA ligase	A0A2K9L6G5	Tupanvirus	5.4e-32	27.3
WP_005971898.1\|172442_173573_+	ATP phosphoribosyltransferase regulatory subunit	A0A2K9L0H9	Tupanvirus	3.8e-06	38.8

DBSCAN-SWA_13

178838 : 194254

uncultured_virus(28.57%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002966387.1\|178838_180479_-	chaperonin GroEL	A0A219YK78	uncultured_virus	7.4e-168	60.6
WP_002966386.1\|180569_180866_-	co-chaperone GroES	A0A221S4G8	uncultured_virus	1.6e-20	55.3
WP_004681440.1\|180954_181245_+	hypothetical protein	NA	NA	NA	NA
WP_005974657.1\|181346_182195_+	TIGR01459 family HAD-type hydrolase	NA	NA	NA	NA
WP_004686168.1\|182282_183272_+	bifunctional riboflavin kinase/FAD synthetase	A0A1V0SD03	Indivirus	8.2e-05	29.9
WP_004686167.1\|183615_186534_+\|tRNA	isoleucine--tRNA ligase	A0A2P1ELB8	Moumouvirus	3.7e-69	25.6
WP_002971287.1\|186725_187397_+	hypothetical protein	NA	NA	NA	NA
WP_004681448.1\|187741_188302_+	cytochrome b	NA	NA	NA	NA
WP_004686166.1\|188355_188829_-	nucleoside deaminase	A0A0B5J096	Pandoravirus	8.5e-08	45.2
WP_004686165.1\|188969_190715_+	pseudouridine synthase	NA	NA	NA	NA
WP_004681454.1\|190695_191259_+	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
WP_014489561.1\|191375_192890_+	insulinase family protein	L7RBE7	Acanthamoeba_polyphaga_moumouvirus	3.2e-24	24.7
WP_004686843.1\|192889_194254_+	insulinase family protein	G3MBJ8	Bacillus_virus	2.4e-18	22.9

DBSCAN-SWA_14

199382 : 199634

Caulobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002966369.1\|199382_199634_+	DUF4170 domain-containing protein	K4JVU0	Caulobacter_phage	3.8e-07	43.9

DBSCAN-SWA_15

203153 : 205025

Wolbachia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004686161.1\|203153_205025_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	4.3e-103	36.8

DBSCAN-SWA_16

221860 : 223036

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002966349.1\|221860_223036_-	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	1.5e-21	39.3

DBSCAN-SWA_17

232526 : 233339

Halovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002966336.1\|232526_233339_+	CbbQ/NirQ/NorQ/GpvN family protein	R4TG24	Halovirus	1.3e-11	27.5

DBSCAN-SWA_18

242129 : 243050

Microcystis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004681548.1\|242129_243050_+	formylglycine-generating enzyme family protein	A0A075BSL8	Microcystis_phage	7.9e-10	29.0

DBSCAN-SWA_19

246780 : 247608

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005971795.1\|246780_247608_+	sugar ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.6e-16	29.7

DBSCAN-SWA_20

252899 : 254750

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006135495.1\|252899_254750_-	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	9.7e-07	21.6

DBSCAN-SWA_21

260996 : 261992

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002971274.1\|260996_261992_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.7e-21	29.8

DBSCAN-SWA_22

265308 : 265749

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002966303.1\|265308_265749_+	pseudoazurin	E3SLB8	Synechococcus_phage	2.8e-05	36.5

DBSCAN-SWA_23

271176 : 272154

Phage_TP(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004686139.1\|271176_272154_-	U32 family peptidase	Q6DW11	Phage_TP	5.4e-17	32.0

DBSCAN-SWA_24

279168 : 282933

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004681614.1\|279168_282933_-	nitrate reductase subunit alpha	A0A077SK27	Escherichia_phage	2.4e-12	24.9

DBSCAN-SWA_25

291214 : 292216

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002966279.1\|291214_292216_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.8e-23	34.8

DBSCAN-SWA_26

295319 : 301277

Erysipelothrix_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005976989.1\|295319_296762_+	MFS transporter	A0A2K5B2B5	Erysipelothrix_phage	3.6e-09	23.4
WP_002966274.1\|297438_297660_+	glutaredoxin-like protein NrdH	V5UN81	Mycobacterium_phage	1.2e-17	56.9
WP_002966273.1\|297673_298081_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A1D6X8A1	Bacillus_phage	3.0e-09	36.7
WP_002969365.1\|298056_300273_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	1.2e-210	51.7
WP_004681638.1\|300287_301277_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A0N7CCA3	Skermania_phage	1.4e-137	75.2

DBSCAN-SWA_27

306441 : 307509

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004681651.1\|306441_307509_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.5e-28	35.3

DBSCAN-SWA_28

326041 : 337149

Hokovirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004681680.1\|326041_327457_-	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	1.3e-51	30.1
WP_002966241.1\|327453_328887_-	phosphomannomutase	NA	NA	NA	NA
WP_002968345.1\|329006_330113_-	P1 family peptidase	NA	NA	NA	NA
WP_002966239.1\|330136_331492_-	chloride channel protein	A0A1X9I5Z9	Streptococcus_phage	3.9e-05	27.0
WP_002969361.1\|331686_333180_+	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	1.9e-93	40.5
WP_004685038.1\|333339_334458_-	c-type cytochrome	NA	NA	NA	NA
WP_002966235.1\|334526_335480_-	hydrogen peroxide-inducible genes activator	NA	NA	NA	NA
WP_002966234.1\|335649_337149_+	catalase	A0A2K9L0T1	Tupanvirus	2.2e-89	43.2

DBSCAN-SWA_29

341054 : 342617

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004681699.1\|341054_342617_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	1.1e-14	29.7

DBSCAN-SWA_30

355025 : 369821

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004681717.1\|355025_357749_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	1.0e-12	25.1
WP_006135467.1\|357735_358440_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.6e-10	23.4
WP_002966211.1\|358442_359240_+	3-oxoacyl-ACP reductase FabG	NA	NA	NA	NA
WP_002968361.1\|359244_360063_+	shikimate dehydrogenase	NA	NA	NA	NA
WP_002966209.1\|360067_361702_+	GMC family oxidoreductase N-terminal domain-containing protein	A0A1V0SI18	Klosneuvirus	1.8e-52	31.4
WP_004686119.1\|361726_363160_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_004685027.1\|363215_364415_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004681729.1\|364477_365605_+	zinc-binding dehydrogenase	A0A0K0KVL7	Prochlorococcus_phage	3.4e-23	27.5
WP_002966205.1\|365808_366804_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_005971624.1\|366791_367781_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_002966203.1\|367854_368808_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.2e-23	31.4
WP_004686118.1\|368804_369821_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.5e-11	28.4

DBSCAN-SWA_31

384752 : 385823

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004681750.1\|384752_385823_-	GDP-mannose 4,6-dehydratase	M1HKY0	Acanthocystis_turfacea_Chlorella_virus	2.1e-123	61.7

DBSCAN-SWA_32

389856 : 390579

Bartonella_henselae_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004681766.1\|389856_390579_-	porin family protein	O11861	Bartonella_henselae_phage	2.4e-22	32.3

DBSCAN-SWA_33

403813 : 411276

Stenotrophomonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004686870.1\|403813_404875_+	SDR family oxidoreductase	A0A2D2W2J1	Stenotrophomonas_phage	8.5e-08	27.1
WP_006135454.1\|404913_406227_+	DUF4910 domain-containing protein	NA	NA	NA	NA
WP_004686107.1\|407033_408335_+	class I SAM-dependent methyltransferase	A0A1C9C5J0	Heterosigma_akashiwo_virus	2.6e-38	26.7
WP_014489587.1\|408337_409147_+	glucose-1-phosphate cytidylyltransferase	NA	NA	NA	NA
WP_004681804.1\|409143_409800_+	PIG-L family deacetylase	NA	NA	NA	NA
WP_004681807.1\|409995_411276_-	nitrate reductase	Q9KX94	Enterobacteria_phage	6.0e-133	58.7

DBSCAN-SWA_34

414420 : 415308

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002966181.1\|414420_415308_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	6.9e-11	26.9

DBSCAN-SWA_35

418998 : 423943

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004681822.1\|418998_419901_-	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	3.7e-52	42.9
WP_002972031.1\|419897_420668_-	AMP-binding protein	NA	NA	NA	NA
WP_006135446.1\|420794_421778_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_004686102.1\|422001_423246_+	phosphoglycerate dehydrogenase	A0A1V0SBV6	Catovirus	2.1e-106	49.9
WP_002970715.1\|423298_423943_-	peptide deformylase	K4JRM9	Caulobacter_phage	1.1e-21	39.7

DBSCAN-SWA_36

431212 : 435290

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005971535.1\|431212_432133_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.8e-17	30.5
WP_002966162.1\|432129_433269_+	ABC transporter permease	NA	NA	NA	NA
WP_004681835.1\|433306_433705_+	cupin domain-containing protein	NA	NA	NA	NA
WP_004686098.1\|433711_434530_-	ABC transporter permease	NA	NA	NA	NA
WP_004681837.1\|434522_435290_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.9e-26	33.5

DBSCAN-SWA_37

441381 : 442098

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002966153.1\|441381_442098_-	response regulator transcription factor	W8CYM9	Bacillus_phage	7.5e-32	36.2

DBSCAN-SWA_38

453906 : 455043

Emiliania_huxleyi_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004681847.1\|453906_455043_-	8-amino-7-oxononanoate synthase	V5LQ39	Emiliania_huxleyi_virus	5.0e-14	23.0

DBSCAN-SWA_39

467236 : 470640

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004681853.1\|467236_468973_+	thiol reductant ABC exporter subunit CydD	F2Y2R6	Organic_Lake_phycodnavirus	1.3e-13	32.2
WP_004686090.1\|468969_470640_+	thiol reductant ABC exporter subunit CydC	F2Y1V6	Organic_Lake_phycodnavirus	7.9e-08	25.5

DBSCAN-SWA_40

480273 : 481275

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004686089.1\|480273_481275_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.2e-23	36.5

DBSCAN-SWA_41

485538 : 490833

Erysipelothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060494771.1\|485538_486924_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	2.1e-38	28.0
WP_004681861.1\|486912_487674_-	SURF1 family protein	NA	NA	NA	NA
WP_002968969.1\|487920_488100_-	hypothetical protein	NA	NA	NA	NA
WP_004681862.1\|488367_490833_-	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	8.7e-80	42.8

DBSCAN-SWA_42

494585 : 496196

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002966097.1\|494585_496196_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.5e-19	33.5

DBSCAN-SWA_43

502742 : 507597

Tupanvirus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004681868.1\|502742_503339_+	NAD-dependent epimerase/dehydratase family protein	A0A2K9KZK0	Tupanvirus	2.8e-40	47.2
WP_004686083.1\|503338_504325_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	4.8e-45	36.1
WP_004686082.1\|506172_507597_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	6.6e-80	38.5

DBSCAN-SWA_44

511805 : 512565

Paenibacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087910426.1\|511805_512565_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	6.9e-20	42.4

DBSCAN-SWA_45

515741 : 518180

Stx2-converting_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004686077.1\|515741_517313_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	1.1e-72	35.4
WP_004681878.1\|517362_517716_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	2.3e-18	42.1
WP_002968421.1\|517712_518180_-	IS66 family insertion sequence hypothetical protein	A0A1B0YZU7	Pseudomonas_phage	5.1e-05	47.9

DBSCAN-SWA_46

527855 : 529418

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002966064.1\|527855_529418_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.5e-11	27.3

DBSCAN-SWA_47

543965 : 547257

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004684961.1\|543965_545789_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	5.6e-108	39.4
WP_004681894.1\|545892_547257_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A0N7G7I9	Chrysochromulina_ericina_virus	1.7e-24	30.0

DBSCAN-SWA_48

557172 : 559272

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002966042.1\|557172_559272_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	8.4e-108	38.6

DBSCAN-SWA_49

564713 : 568823

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002966034.1\|564713_565682_+	aspartate carbamoyltransferase catalytic subunit	M1HWF9	Paramecium_bursaria_Chlorella_virus	9.5e-30	37.4
WP_004681903.1\|565678_566965_+	dihydroorotase	NA	NA	NA	NA
WP_004681904.1\|567039_567645_+	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_014489611.1\|567641_568823_+	DNA-protecting protein DprA	S6BFL3	Thermus_phage	6.1e-23	38.3

DBSCAN-SWA_50

571891 : 588568

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004686067.1\|571891_574243_+	ribonuclease R	Q0GXV6	Lactococcus_phage	2.2e-56	33.3
WP_002968434.1\|574242_574704_+	DUF983 domain-containing protein	NA	NA	NA	NA
WP_006135410.1\|574712_575444_+	NUDIX hydrolase	NA	NA	NA	NA
WP_006135409.1\|575518_576661_+	MFS transporter	NA	NA	NA	NA
WP_002966024.1\|576819_576987_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_004681910.1\|577093_578479_-	PleD family two-component system response regulator	W8CYM9	Bacillus_phage	6.1e-14	35.6
WP_002966022.1\|578599_578971_-	response regulator	B5LWN0	Feldmannia_species_virus	3.1e-05	30.5
WP_002966021.1\|579151_579439_+	DUF3572 domain-containing protein	NA	NA	NA	NA
WP_002969333.1\|580453_581791_+	DNA polymerase IV	A0A218MNF2	uncultured_virus	1.6e-19	24.0
WP_004681912.1\|581960_584150_+	esterase-like activity of phytase family protein	M4SLV1	Cyanophage	2.8e-90	46.6
WP_004686062.1\|584678_585401_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.6e-10	29.7
WP_002968441.1\|586299_586677_-	endonuclease V	F4YXR7	Roseobacter_phage	4.5e-36	64.2
WP_002971236.1\|586817_587123_+	hypothetical protein	NA	NA	NA	NA
WP_002966014.1\|587267_587456_+	hypothetical protein	NA	NA	NA	NA
WP_004686061.1\|587602_587800_+	hypothetical protein	NA	NA	NA	NA
WP_002971235.1\|587860_588568_+	DNA polymerase III subunit epsilon	Q1WDI5	Streptomyces_phage	4.1e-06	31.2

DBSCAN-SWA_51

603877 : 604681

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006135395.1\|603877_604681_+	3-oxoadipate enol-lactonase	A0A2K9L3Q7	Tupanvirus	7.1e-07	22.1

DBSCAN-SWA_52

610852 : 612315

Organic_Lake_phycodnavirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004686049.1\|610852_611602_+	ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	1.1e-06	25.6
WP_004684935.1\|611598_612315_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.1e-10	24.5

DBSCAN-SWA_53

618698 : 623818

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004686047.1\|618698_619754_+	sn-glycerol-3-phosphate import ATP-binding protein UgpC	G3M9Y6	Bacillus_virus	6.1e-22	32.0
WP_060494774.1\|620015_621662_+	SLC13 family permease	NA	NA	NA	NA
WP_004681939.1\|621865_622465_-	nucleoside deaminase	NA	NA	NA	NA
WP_005971258.1\|622525_623818_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	2.0e-67	39.8

DBSCAN-SWA_54

633628 : 636292

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004681948.1\|633628_634591_+	ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	4.5e-72	46.4
WP_002968468.1\|634583_635537_+	iron chelate uptake ABC transporter family permease subunit	NA	NA	NA	NA
WP_002965962.1\|635533_636292_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.7e-19	27.6

DBSCAN-SWA_55

642608 : 649117

Planktothrix_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004681962.1\|642608_643370_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.4e-30	38.6
WP_005971238.1\|643578_645108_+	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_002965955.1\|645109_645832_+	RlmE family RNA methyltransferase	A0A1L3KJH5	Hubei_virga-like_virus	2.7e-05	28.4
WP_004681969.1\|646030_647440_-	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_014489624.1\|648001_649117_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	1.1e-24	34.3

DBSCAN-SWA_56

658643 : 665954

Mycoplasma_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004681989.1\|658643_659747_-	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	5.0e-19	38.7
WP_002972093.1\|661567_662089_-	superoxide dismutase family protein	Q9MC02	Salmonella_phage	3.0e-38	46.6
WP_060494776.1\|662361_663966_-	multicopper oxidase CueO	NA	NA	NA	NA
WP_002968479.1\|664025_664421_-	hypothetical protein	NA	NA	NA	NA
WP_002965935.1\|664673_665954_+	MHS family MFS transporter	Q6JIH2	Burkholderia_virus	2.3e-44	32.7

DBSCAN-SWA_57

673454 : 678911

Ostreococcus_tauri_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002968481.1\|673454_675278_+	3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (decyclizing)	C7U069	Ostreococcus_tauri_virus	1.0e-21	24.7
WP_002967271.1\|675281_676184_+	myo-inosose-2 dehydratase	NA	NA	NA	NA
WP_004682017.1\|676187_676997_+	5-deoxy-glucuronate isomerase	NA	NA	NA	NA
WP_002968483.1\|677028_677829_-	inositol monophosphatase	NA	NA	NA	NA
WP_004686029.1\|677849_678911_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.1e-28	36.1

DBSCAN-SWA_58

687892 : 690691

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014489628.1\|687892_690691_-	aminomethyl-transferring glycine dehydrogenase	M4QFZ1	Prochlorococcus_phage	1.1e-272	54.1

DBSCAN-SWA_59

702826 : 703993

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005971161.1\|702826_703993_-	glycine betaine/L-proline ABC transporter ATP-binding protein ProV	G3M9Y6	Bacillus_virus	8.7e-30	38.5

DBSCAN-SWA_60

707001 : 708832

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002965898.1\|707001_708054_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	1.8e-26	33.8
WP_002965897.1\|708058_708832_-	SDR family oxidoreductase	A0A0N9R355	Chrysochromulina_ericina_virus	3.8e-13	28.4

DBSCAN-SWA_61

712025 : 715146

Pandoravirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002965893.1\|712025_712397_+	RidA family protein	A0A0B5J923	Pandoravirus	1.4e-05	35.3
WP_004686016.1\|712423_713893_+	M81 family metallopeptidase	NA	NA	NA	NA
WP_002965890.1\|714351_715146_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.9e-16	34.0

DBSCAN-SWA_62

723977 : 725513

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004686015.1\|723977_725513_-	exodeoxyribonuclease VII large subunit	A0A1V0SD82	Indivirus	4.1e-35	32.8

DBSCAN-SWA_63

736781 : 743913

Cyanophage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004682109.1\|736781_738257_+	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	1.2e-76	36.6
WP_002968509.1\|738385_739084_+	6-phosphogluconolactonase	NA	NA	NA	NA
WP_004686011.1\|739119_740943_+	phosphogluconate dehydratase	NA	NA	NA	NA
WP_002967255.1\|741034_741934_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	2.7e-31	34.8
WP_004682112.1\|742254_743070_+	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	9.1e-26	34.4
WP_004682115.1\|743160_743913_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.4e-18	33.2

DBSCAN-SWA_64

752989 : 753646

Bacteriophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004684875.1\|752989_753646_-	helix-turn-helix transcriptional regulator	B6SCU0	Bacteriophage	1.3e-11	25.1

DBSCAN-SWA_65

762417 : 764003

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002965842.1\|762417_763218_-	nickel import ATP-binding protein NikE	G3M9Y6	Bacillus_virus	2.1e-14	29.4
WP_002965841.1\|763214_764003_-	nickel import ATP-binding protein NikD	G3M9Y6	Bacillus_virus	3.5e-06	22.4

DBSCAN-SWA_66

771441 : 775413

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004682156.1\|771441_772458_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.1e-24	39.2
WP_004682158.1\|772572_773754_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_004686000.1\|773913_775413_-	mannitol dehydrogenase family protein	G9E6E2	Micromonas_pusilla_virus	2.8e-44	30.3

DBSCAN-SWA_67

779369 : 782450

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004684864.1\|779369_782450_-	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	5.3e-58	23.3

DBSCAN-SWA_68

797476 : 798034

Geobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002965811.1\|797476_798034_+	SocA family protein	Q0H268	Geobacillus_phage	1.1e-09	31.9

DBSCAN-SWA_69

801947 : 807653

Liberibacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002965802.1\|801947_803474_+	SAM-dependent DNA methyltransferase	A0A220A2U4	Liberibacter_phage	2.9e-97	39.6
WP_004682202.1\|803463_804687_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_004682204.1\|804683_807653_+	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	1.3e-74	29.6

DBSCAN-SWA_70

815295 : 817771

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004685992.1\|815295_816750_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	3.2e-37	27.7
WP_004682216.1\|816760_817771_-	NAD(P)-dependent oxidoreductase	A0A0E3FNQ3	Synechococcus_phage	7.1e-12	25.4

DBSCAN-SWA_71

824873 : 826418

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004685988.1\|824873_826418_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.6e-18	28.0

DBSCAN-SWA_72

836070 : 844106

Klosneuvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002965774.1\|836070_837093_-	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	4.2e-36	33.6
WP_004682252.1\|837526_838114_-	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	4.7e-24	43.3
WP_002965771.1\|838265_840092_-	translational GTPase TypA	A0A2K5B2A5	Erysipelothrix_phage	2.3e-24	47.0
WP_002965770.1\|840334_841732_-	magnesium transporter	NA	NA	NA	NA
WP_002967234.1\|842057_844106_+	M3 family metallopeptidase	A0A1V0SD92	Indivirus	1.7e-28	23.1

DBSCAN-SWA_73

849880 : 860814

Klosneuvirus(40.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004685983.1\|849880_851779_+	MFS transporter	Q6JIH2	Burkholderia_virus	2.4e-37	32.7
WP_004682266.1\|851836_852889_-	bifunctional transcriptional activator/DNA repair protein Ada	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	4.5e-17	48.5
WP_004684836.1\|853029_854142_-	3-isopropylmalate dehydrogenase	NA	NA	NA	NA
WP_002972115.1\|854310_854505_+	hypothetical protein	NA	NA	NA	NA
WP_002965755.1\|854441_854636_-	Trm112 family protein	NA	NA	NA	NA
WP_006135652.1\|854812_855517_-	LON peptidase substrate-binding domain-containing protein	NA	NA	NA	NA
WP_004682272.1\|855580_856570_-	thioredoxin	A0A1X9I9P5	Staphylococcus_phage	2.0e-14	38.8
WP_002965752.1\|856802_857345_-\|tRNA	prolyl-tRNA synthetase associated domain-containing protein	NA	NA	NA	NA
WP_002968546.1\|858017_858176_+	hypothetical protein	NA	NA	NA	NA
WP_004682276.1\|858340_858766_+	group III truncated hemoglobin	NA	NA	NA	NA
WP_006135649.1\|858778_859855_-	ornithine cyclodeaminase	A0A1V0SL93	Klosneuvirus	1.0e-93	49.4
WP_002965747.1\|859893_860814_-	arginase	A0A1V0SJM8	Klosneuvirus	1.4e-22	33.3

DBSCAN-SWA_74

866885 : 874456

Burkholderia_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004684830.1\|866885_867818_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	5.2e-25	28.6
WP_004686899.1\|867966_868668_+	VOC family protein	NA	NA	NA	NA
WP_004682297.1\|868741_870274_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_004682299.1\|870497_871382_-	formyltetrahydrofolate deformylase	M4QRX9	Synechococcus_phage	9.9e-10	39.8
WP_004682301.1\|871525_872254_-	sugar isomerase domain-containing protein	NA	NA	NA	NA
WP_002965736.1\|872261_873428_-	N-acetylglucosamine-6-phosphate deacetylase	NA	NA	NA	NA
WP_004684828.1\|873424_874456_-	SIS domain-containing protein	A0A1J0F994	Only_Syngen_Nebraska_virus	5.0e-21	30.1

DBSCAN-SWA_75

895984 : 896482

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172438486.1\|895984_896482_+	aromatic amino acid lyase	A0A1V0S940	Catovirus	2.3e-11	34.5

DBSCAN-SWA_76

901907 : 903497

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004682332.1\|901907_903497_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.4e-14	29.8

DBSCAN-SWA_77

915276 : 919473

uncultured_Mediterranean_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004682346.1\|915276_916296_-	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	2.9e-77	42.1
WP_014517420.1\|916399_917659_-	aminotransferase class III-fold pyridoxal phosphate-dependent enzyme	A0A1V0SKB7	Klosneuvirus	1.3e-15	24.2
WP_004685967.1\|917586_919473_-	phosphotransferase	W8ED04	Mycobacterium_phage	4.7e-09	32.0

DBSCAN-SWA_78

922776 : 936110

Bacillus_virus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002965694.1\|922776_923592_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.9e-16	29.9
WP_002969295.1\|923584_924310_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	2.5e-06	24.6
WP_002965691.1\|924314_925202_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_004685964.1\|925203_926199_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_004682355.1\|926262_927861_+	GMC family oxidoreductase N-terminal domain-containing protein	A0A1V0S9M4	Catovirus	1.5e-51	29.0
WP_002965688.1\|928094_928931_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002965687.1\|929395_930454_+	methionine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.1e-30	37.6
WP_004682356.1\|930434_931100_+	ABC transporter permease	NA	NA	NA	NA
WP_002965685.1\|931112_931520_-	VOC family protein	NA	NA	NA	NA
WP_002965683.1\|931611_932499_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_002965682.1\|933037_933265_-	30S ribosomal protein S21	M1HLV7	Pelagibacter_phage	1.3e-06	58.1
WP_002972127.1\|933617_933917_+	hypothetical protein	NA	NA	NA	NA
WP_002968831.1\|933913_934813_+	hypothetical protein	NA	NA	NA	NA
WP_002965680.1\|934887_935364_-	MaoC family dehydratase	NA	NA	NA	NA
WP_002965679.1\|935438_936110_-	HAD family phosphatase	M1IMD4	Acanthocystis_turfacea_Chlorella_virus	3.1e-11	30.0

DBSCAN-SWA_79

943976 : 947389

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004682375.1\|943976_946274_-	EAL domain-containing protein	G3MA91	Bacillus_virus	1.5e-12	27.5
WP_002965670.1\|946639_947389_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.2e-18	30.5

DBSCAN-SWA_80

961077 : 961899

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024767883.1\|961077_961899_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-20	30.1

DBSCAN-SWA_81

971042 : 977998

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004682419.1\|971042_972089_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.7e-14	37.5
WP_004682421.1\|972263_973496_-	L-2-hydroxyglutarate oxidase	NA	NA	NA	NA
WP_004685950.1\|973651_974650_+	3'-5' exonuclease	A0A218M4G8	Erwinia_phage	4.0e-07	31.3
WP_006139851.1\|974725_976114_-	amidase	NA	NA	NA	NA
WP_004685948.1\|976127_976976_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.3e-22	34.0
WP_004682424.1\|976972_977998_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-18	33.2

DBSCAN-SWA_82

981403 : 982162

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002965637.1\|981403_982162_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.4e-15	29.8

DBSCAN-SWA_83

993446 : 996046

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002969378.1\|993446_994286_-	LOG family protein	A0A1D8KU27	Synechococcus_phage	1.3e-11	31.9
WP_004685944.1\|994493_995348_+	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
WP_006135614.1\|995491_996046_-	transglutaminase-like cysteine peptidase	V9QJI1	Rhizobium_phage	6.6e-12	31.1

DBSCAN-SWA_84

1000037 : 1004870

Caulobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002965616.1\|1000037_1000565_-	peptide deformylase	K4JRM9	Caulobacter_phage	4.2e-24	42.6
WP_004682457.1\|1000667_1001891_+	DNA recombination protein RmuC	NA	NA	NA	NA
WP_002965614.1\|1002119_1002425_-	SelT/SelW/SelH family protein	NA	NA	NA	NA
WP_004685941.1\|1002533_1002815_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_004682459.1\|1003061_1004870_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	3.2e-23	25.5

DBSCAN-SWA_85

1012814 : 1014644

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004682472.1\|1012814_1014644_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	6.8e-53	28.8

DBSCAN-SWA_86

1025785 : 1030194

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004685935.1\|1025785_1027363_+	peptide chain release factor 3	A0A1B0RXH7	Streptococcus_phage	8.2e-39	27.9
WP_002965590.1\|1027359_1028580_-	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	4.5e-37	32.1
WP_004682494.1\|1028610_1030194_-	2-polyprenylphenol 6-hydroxylase	A0A2N9QVT9	Dishui_lake_phycodnavirus	9.4e-27	26.5

DBSCAN-SWA_87

1033991 : 1038584

Shigella_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087907739.1\|1033991_1035196_-\|transposase	IS3-like element IS1953 family transposase	U5P429	Shigella_phage	3.2e-51	41.6
WP_004682505.1\|1035595_1036114_+	lactate dehydrogenase	NA	NA	NA	NA
WP_002967394.1\|1036544_1036829_+	type II toxin-antitoxin system PemK/MazF family toxin	NA	NA	NA	NA
WP_002968617.1\|1036837_1037347_-	hypothetical protein	R9TP69	Rhizobium_phage	4.8e-09	33.7
WP_004682510.1\|1037327_1038584_-	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	1.1e-35	30.2

DBSCAN-SWA_88

1042896 : 1043973

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004684750.1\|1042896_1043973_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.4e-26	33.7

DBSCAN-SWA_89

1049068 : 1051035

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004684753.1\|1049068_1050046_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.1e-15	30.9
WP_002969388.1\|1050042_1051035_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.2e-15	31.7

DBSCAN-SWA_90

1055237 : 1057237

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002968911.1\|1055237_1056242_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-18	29.1
WP_004684756.1\|1056238_1057237_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-18	29.8

DBSCAN-SWA_91

1074976 : 1077011

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002965578.1\|1074976_1076014_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.2e-08	26.9
WP_004682563.1\|1076006_1077011_+	dipeptide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.1e-15	30.8

DBSCAN-SWA_92

1080934 : 1082111

Shigella_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087907741.1\|1080934_1082111_+\|transposase	IS3-like element IS1953 family transposase	U5P429	Shigella_phage	3.1e-51	41.6

DBSCAN-SWA_93

1092841 : 1093738

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004685196.1\|1092841_1093738_+	metal ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.0e-11	29.8

DBSCAN-SWA_94

1129025 : 1130561

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014489682.1\|1129025_1130561_+	xylose ABC transporter ATP-binding protein	A0A2K9L0W2	Tupanvirus	9.1e-11	21.6

DBSCAN-SWA_95

1142485 : 1145129

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012677019.1\|1142485_1143769_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	3.4e-11	27.0
WP_002967140.1\|1143770_1145129_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	2.3e-13	23.4

DBSCAN-SWA_96

1156840 : 1157545

Cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002967144.1\|1156840_1157545_+	ABC transporter ATP-binding protein	A0A1M7XV31	Cedratvirus	3.8e-12	27.5

DBSCAN-SWA_97

1162788 : 1163961

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004685898.1\|1162788_1163961_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.1e-23	31.1

DBSCAN-SWA_98

1167681 : 1168395

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004686821.1\|1167681_1168395_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.7e-26	33.0

DBSCAN-SWA_99

1177127 : 1184281

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005972144.1\|1177127_1177421_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.1e-05	35.2
WP_005972141.1\|1177359_1177860_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_002966584.1\|1177856_1178585_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.1e-06	25.6
WP_005972136.1\|1178613_1180509_-	cation-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	8.5e-83	36.9
WP_004681110.1\|1180833_1182186_-	oxygen-independent coproporphyrinogen III oxidase	NA	NA	NA	NA
WP_004688785.1\|1182227_1182410_+	hypothetical protein	NA	NA	NA	NA
WP_002972227.1\|1182469_1182784_-	hypothetical protein	NA	NA	NA	NA
WP_002966579.1\|1183087_1184281_+	plasmid partitioning protein RepA	A0A240F4U1	Ochrobactrum_phage	1.5e-138	63.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP008750

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP008751

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection