CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP006371	Aureimonas sp. AU20 plasmid pAU20d, complete sequence	1 crisprs	NA	1	0
NZ_CP006368	Aureimonas sp. AU20 plasmid pAU20a, complete sequence	1 crisprs	NA	1	0
NZ_CP006374	Aureimonas sp. AU20 plasmid pAU20g, complete sequence	0 crisprs	NA	0	0
NZ_CP006375	Aureimonas sp. AU20 plasmid pAU20rrn, complete sequence	0 crisprs	NA	0	0
NZ_CP006373	Aureimonas sp. AU20 plasmid pAU20f, complete sequence	0 crisprs	NA	0	0
NZ_CP006370	Aureimonas sp. AU20 plasmid pAU20c, complete sequence	0 crisprs	NA	0	0
NZ_CP006372	Aureimonas sp. AU20 plasmid pAU20e, complete sequence	0 crisprs	NA	0	0
NZ_CP006367	Aureimonas sp. AU20 chromosome, complete genome	0 crisprs	DEDDh,csa3,WYL,cas3	0	4
NZ_CP006369	Aureimonas sp. AU20 plasmid pAU20b, complete sequence	1 crisprs	csa3,DEDDh	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP006371_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP006371_1

2468-2583

Orphan

Consensus_repeat	Method
TACGCATGTTCGGGGGCGCTTCCACGCATGTTCGGGGGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP006371_1

>merge|NZ_CP006371|1|2468-2583|CRISPRCasFinder
TACGCATGTTCGGGGGCGCTTCCACGCATGTTCGGGGGCGGTTGGTCTGAGTGACACGCATGTTCGGGGGCGCTCGTACGCATGTTCGGGGGCGCTTCCACGCATGTTCGGGGGCG

>NZ_CP006371|1|1|2468-2583|CRISPRCasFinder
TACGCATGTTCGGGGGCGCTTCCACGCATGTTCGGGGGCG	GTTGGTCTGAGTGACACGCATGTTCGGGGGCGCTCG
TACGCATGTTCGGGGGCGCTTCCACGCATGTTCGGGGGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP006371.1\|WP_061978981.1\|1263_2328_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|309782
NZ_CP006371.1\|WP_061978986.1\|11006_11372_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP006371.1\|WP_061978982.1\|4406_5009_+\|GIY-YIG-nuclease-family-protein	unknown	unknown	gnl\|CDD\|198380
NZ_CP006371.1\|WP_061978987.1\|11620_11926_-\|HigA-family-addiction-module-antidote-protein	unknown	unknown	gnl\|CDD\|274228
NZ_CP006371.1\|WP_061978979.1\|241_919_+\|ParA-family-protein	unknown	unknown	gnl\|CDD\|349760
NZ_CP006371.1\|WP_082640066.1\|11934_12216_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|226079
NZ_CP006371.1\|WP_082640065.1\|10285_11050_-\|nucleotidyl-transferase-AbiEii/AbiGii-toxin-family-protein	unknown	unknown	gnl\|CDD\|378065
NZ_CP006371.1\|WP_061978980.1\|1050_1251_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP006371.1\|WP_148640241.1\|2960_3869_-\|metallophosphoesterase	unknown	unknown	gnl\|CDD\|277349
NZ_CP006371.1\|WP_061978989.1\|13173_13536_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP006371.1\|WP_061978983.1\|5093_5822_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP006371.1\|WP_082640063.1\|6254_10136_+\|Ti-type-conjugative-transfer-relaxase-TraA	unknown	unknown	gnl\|CDD\|274289
NZ_CP006371.1\|WP_082640067.1\|12453_13002_-\|PAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|369881

Protein	Function_ID	Function_description	E-value
NZ_CP006371.1\|WP_061978989.1\|13173_13536_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	5.84173e-13
NZ_CP006371.1\|WP_061978981.1\|1263_2328_+\|hypothetical-protein	gnl\|CDD\|309782	pfam04796, RepA_C, Plasmid encoded RepA protein. Family of plasmid encoded proteins involved in plasmid replication. The role of RepA in the replication process is not clearly understood.	3.33215e-30
NZ_CP006371.1\|WP_082640067.1\|12453_13002_-\|PAS-domain-containing-protein	gnl\|CDD\|369881	pfam08447, PAS_3, PAS fold. The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.	1.31526e-11
NZ_CP006371.1\|WP_148640241.1\|2960_3869_-\|metallophosphoesterase	gnl\|CDD\|277349	cd07404, MPP_MS158, Microscilla MS158 and related proteins, metallophosphatase domain. MS158 is an uncharacterized Microscilla protein with a metallophosphatase domain. Microscilla proteins MS152, and MS153 are also included in this family. The domain present in members of this family belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	1.88306e-33
NZ_CP006371.1\|WP_061978982.1\|4406_5009_+\|GIY-YIG-nuclease-family-protein	gnl\|CDD\|198380	cd00719, GIY-YIG_SF, GIY-YIG nuclease domain superfamily. The GIY-YIG nuclease domain superfamily includes a large and diverse group of proteins involved in many cellular processes, such as class I homing GIY-YIG family endonucleases, prokaryotic nucleotide excision repair proteins UvrC and Cho, type II restriction enzymes, the endonuclease/reverse transcriptase of eukaryotic retrotransposable elements, and a family of eukaryotic enzymes that repair stalled replication forks. All of these members contain a conserved GIY-YIG nuclease domain that may serve as a scaffold for the coordination of a divalent metal ion required for catalysis of the phosphodiester bond cleavage. By combining with different specificity, targeting, or other domains, the GIY-YIG nucleases may perform different functions.	4.91791e-07
NZ_CP006371.1\|WP_061978987.1\|11620_11926_-\|HigA-family-addiction-module-antidote-protein	gnl\|CDD\|274228	TIGR02607, Virulence-associated_protein_I, addiction module antidote protein, HigA family. Members of this family form a distinct clade within the larger family HTH_3 of helix-turn-helix proteins, described by pfam01381. Members of this clade are strictly bacterial and nearly always shorter than 110 amino acids. This family includes the characterized member HigA, without which the killer protein HigB cannot be cloned. The hig (host inhibition of growth) system is noted to be unusual in that killer protein is uncoded by the upstream member of the gene pair. [Regulatory functions, DNA interactions, Regulatory functions, Protein interactions, Mobile and extrachromosomal element functions, Other].	2.03266e-31
NZ_CP006371.1\|WP_061978979.1\|241_919_+\|ParA-family-protein	gnl\|CDD\|349760	cd02042, ParAB_family, partition proteins ParAB family. ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in Rhizobium etli symbiotic plasmid. This operon is involved in the plasmid replication and partition.	2.20474e-24
NZ_CP006371.1\|WP_082640063.1\|6254_10136_+\|Ti-type-conjugative-transfer-relaxase-TraA	gnl\|CDD\|274289	TIGR02768, conjugal_transfer_protein_TraA, Ti-type conjugative transfer relaxase TraA. This protein contains domains distinctive of a single strand exonuclease (N-terminus, MobA/MobL, pfam03389) as well as a helicase domain (central region, homologous to the corresponding region of the F-type relaxase TraI, TIGR02760). This protein likely fills the same role as TraI(F), nicking (at the oriT site) and unwinding the coiled plasmid prior to conjugative transfer.	0
NZ_CP006371.1\|WP_082640065.1\|10285_11050_-\|nucleotidyl-transferase-AbiEii/AbiGii-toxin-family-protein	gnl\|CDD\|378065	pfam08843, AbiEii, Nucleotidyl transferase AbiEii toxin, Type IV TA system. This family was recently identified as belonging to the nucleotidyltransferase superfamily. AbiEii is the cognate toxin of the type IV toxin-antitoxin 'innate immunity' bacterial abortive infection (Abi) system that protects bacteria from the spread of a phage infection. The Abi system is activated upon infection with phage to abort the cell thus preventing the spread of phage through viral replication. There are some 20 or more Abis, and they are predominantly plasmid-encoded lactococcal systems. TA, toxin-antitoxin, systems on plasmids function by killing cells that lose the plasmid upon division. AbiE phage resistance systems function as novel Type IV TAs and are widespread in bacteria and archaea. The cognate antitoxin is pfam13338.	0.00900947
NZ_CP006371.1\|WP_082640066.1\|11934_12216_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|226079	COG3549, HigB, Plasmid maintenance system killer protein [General function prediction only].	2.37301e-31

>NZ_CP006371.1|WP_061978981.1|1263_2328_+|hypothetical-protein
MSKIDSVSLSDKLGAIRDEDLLAELREFEGRSTYAIMVKELTRRQGKRDREAKAAQAIEKLPVGVRRRARARIQVESEKPSADYLRFLPTPLAICSLPYRALPADVTRYERRQGKMSLVVSSGTLMAPNGEWTPQPVPWGPKARLIMAHLSTEALRNQSSTVETGASFSEFMREIGFEPTGGREGNIRHFKDQLRALAACRMTFGAWDGHRSATMEMKPLEKVELWYEGHPDQRSLSPNTIQFSESFYNQLKKHALPIDVRALKAFSNSARKLDLLFWITYRATRLDEPLILDWKPLKEQFGEGISRDRKFREQLTEDLAAIKEVFPKLQIKVTTQGLEMNPTDPSLLALPKKR
>NZ_CP006371.1|WP_061978980.1|1050_1251_+|hypothetical-protein
MPNAKAEPTKEAFDARALRRSNRTAKLNIATSPEVRERFWRLAQQHDLLSGEEMLVALMDAFEQAS
>NZ_CP006371.1|WP_061978979.1|241_919_+|ParA-family-protein
MPVIVLCSTKGGVGKSTTALLLAQVYAEAGSNVTLIDADPNQPLATWASRFAKSVPKRLEIIGDVTEETVVEVIDDAAERKPFVIVDLEGSANVTASYAISRADLVLIPMRGKQLDVDQAARVVSLIERESKVFRRQIPYRVMFSMIGMIQSREQKHIRTTLDEKGIPVLDSALFERAAFSAIFQIGGTIFDLTVEDVSNPKAAQENATAVAQSVIAALNEENAR
>NZ_CP006371.1|WP_148640241.1|2960_3869_-|metallophosphoesterase
MARLWILSDLHLETLPHPDAFAPTPPDFDVLVCAGDVWRADPAHGFRVLRRLAGNKPVVCVLGNHEHWNSVLGERLPAARKAAEAYGVTLLQGDAVTLAGCRFVGTTLWSDYALAGDTVKPDGETGEAIRVEQEVEHGPGTALLTIGATVAQHRIERARLVELIDAHTGPEPLVVVTHHAPHPDCVPPQDHGTFLAGNGASDLSPLLDTGRIDLWVHGHLHHSVQMALASGTLIRCNPAGTRFSNSSFDPALTMPAREICDPIRIRDRLAPVLAMAQAAGPYAPTTWEEEKRFMDEIWGEED
>NZ_CP006371.1|WP_061978982.1|4406_5009_+|GIY-YIG-nuclease-family-protein
MPCLAFLEPHELAIEDLSVDGSLLFDEEDLRSLDDARLCAYAMGYAGTAGTFHDAPDPYAPTYWVYAICRPDGTPFYVGMTTCLERRWQEHRASIDELPKLREDLAGEPNPHADTMLRYRRIQQIATHLADGTGPIFRQLGEAGSCKEVLALETTWVHRMTAQGHKLLNPGAHRAIPKHYRSHRRYERKYHCDAAQAGTR
>NZ_CP006371.1|WP_061978983.1|5093_5822_-|hypothetical-protein
MQDAAIDAYRRFARGEPGVCQETGEGGAFAFADEHEITCGFDSRYDTKCFVWLMPERGPVGPRCDRWIDQALRERRIGLHASDQGAIDVFDPAILQAAFGMGAERMASVLSLQTDADGRVGFDELASVSLHLRFVLEGWIKHGSLPLLHIVERMLQPVDRADEPEAVGRLAMLVQVALHQAGGGHPENPVQAGASAGLHEATERWVEERMRARQRREEAERCEPLLAAEFAAALETLARASD
>NZ_CP006371.1|WP_082640063.1|6254_10136_+|Ti-type-conjugative-transfer-relaxase-TraA
MAIYSFRQSAISGGYGQSAVAAAAYRHSVRMERERGNQIEDYSHKKGTIHSEIVLPPNAPGWLLSALHVRTYDPDSAANRVEGPAAAVASEALWNAVETGEKRRDAHYATELVLALPVELTREQNIELVRAFIEQNYSAKGRVADWAYHLPEGREHNPHVHILSTVRPLTEQGFGPKATIAYNEDGEPRKTARGDVVYEKWSGTKPELYAMRASWAEEVNHALSIAGYDITVDHRSFMERGIHEIEPTLHRGKTHHMREITPEHEVPKFDQEDRAANFQAFCQNPSLVLEHITREQSTFDTRDIAKVLHRYAGRGNDIQGLMQQVGMLPELVTVQAQIHDPESDRIVQRERFTTTAVLEREALLQERIHSRHHDHSFAVAPEVREAAYLRSEEAQGFSYSPEQRAAIERLTRDEGVGVMVGIAGAGKSTVMRAVNEIYHSEETRVWGAALAGKAADNLQQSSGIASRTLASWESSWSRGFDHLNKGDVFVIDEAGMVASAQMLRVMERLDEFGAKVLLVGDARQLQPIEAGAAFRSIAHEVGYVELTEVRRQERDDHAQASVLFGAGQTRSALSIYHGNDAFQFHETASSAYQSAIEGWKHDWTAGADVVMLAHTNRDVLALNALAREAIRLDGGLSDGERFVTARGVREFAVGDRVLFLENDRHLGVRNGTIGVVEEIVEGRLGVSVPDRLEPVTVSREGYNNIDHGYATTIHKSQGATHDRVHVVASGMMDAQLSYVALSRHREEVTMHVPLDAFTHPSRSELATPDYALNRLAMDRLKDTSLDYAPTLDYTQARQALDERRAYEQSLAGRFDAFLEQRGLPHPSDVLQSVREFANQFFEQRRAIPAHEQIRVPTERAIPERDPSHQFEPGEDLRHALNRLEHVQSHSAAMNHEGLARRSAFFTAENELTRSVTAEPLRAYAETVAAIVPPSLVVSIGPHLPDAQDEPRLAHLSPPVLDALQANWRDVHAVSRGTWELGLLETVRAIDTSYRQEREDRSVLRDYERMVADQLKRHERVPEPVLEPSVPVAPRRDFLPAVTSWLLSVDQAVAQAVARDSDVLYFETLVRKTALHVWRDVESAWAQAKAEIVASPNNVMVTINRIEREPQSFGELLGGRTWLLRPDAERQAAIEHVPRLGSIVYEYAGSLARMEPIVREREIAWRHAMRQPLPALSREARSLLDDLNQAHSMRTSGKREQSQELSLKALENKPAWEELQSWSRDLSSRLTMPDAIHRIPGLSREDQATVQHTIEAVSVAERQADAAQKHERSRVWQIEQERIYGHERGHQWEW
>NZ_CP006371.1|WP_082640065.1|10285_11050_-|nucleotidyl-transferase-AbiEii/AbiGii-toxin-family-protein
METEMSERWPALLPDAEAILDHYRVKENATLRVGGGTSLTFFVDHRLSFDLDLFVGDPAPRAGHLHRLMASGLPRSLTSDVQYPGNFVKLVWDDIGEIDLLAAAPLTPHPGIPVRVQGVDLCLEHPEEVVTKKLVYRATSPAAVKGRDIYDIHACLGAGLVRPSNLAGVVGAERFDAVLEALEYDTDRIMEEVRELSQRRFAPSPDDLRRSMLELASASPAMDFVEYGAPLNFEHLEARIGLRIEAGTDARRCP
>NZ_CP006371.1|WP_061978986.1|11006_11372_-|hypothetical-protein
MVAISKMSSIEEADVPQAWRSLIVNAWTPYGRRSSTLATVYAVIVGEIGSDHDRFIVRKLLEGADPSLLFSAIRRSAMGYRSLAGVADSVGARSGDNVAAIRDRASRHGNRNVRKMAGTSS
>NZ_CP006371.1|WP_061978987.1|11620_11926_-|HigA-family-addiction-module-antidote-protein
MLANMLPPIHPGEILREEFLIPLDLTPYALAKAIDVPRTRIERLAREETPVTTDTALRLARYFGTSAEFWTSLQATFELRTEGEAKREALLKIQPRQNVAA
>NZ_CP006371.1|WP_082640066.1|11934_12216_-|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MIRAYRGKHTEAVASGESPKGFPGDLLRASQRKLAMLNAAAALEDLRAPPGNRLEALHGDREGQHSIRINDQWRICFHWTDAGPEDVEIVDYY
>NZ_CP006371.1|WP_082640067.1|12453_13002_-|PAS-domain-containing-protein
MNDSEDNQIVRNLVGIWNWQVSTNLVTACDQVCEYINVPPETGRHGVKPERFIAAIHPDDREQLARIVATVIAEGNSLTAEYRLMSRLHGTRWVRSIGRCFRTANGDLTHISGYLVDIDPPLSHPLESERKEQEMALIDHLLQARDLAVSLNYKMVCALIDATLLETGYQTAAVLEAEPETP
>NZ_CP006371.1|WP_061978989.1|13173_13536_+|helix-turn-helix-transcriptional-regulator
MTSDPFDRHLGKRIEALRRAQKKSVQSLASELGITHQQVRKYENGQNRVSASTLYRLARTLNVTPSVFFQGMEHVDARRALGPFPRMEPAYEELLERVKDMQVREALRHLFAGVAKLDQP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP006371_1	1.1\|2508\|36\|NZ_CP006371\|CRISPRCasFinder	2508-2543	36	NZ_CP006371	Aureimonas sp. AU20 plasmid pAU20d, complete sequence	2508-2543	0	1.0

1. spacer 1.1|2508|36|NZ_CP006371|CRISPRCasFinder matches to NZ_CP006371 (Aureimonas sp. AU20 plasmid pAU20d, complete sequence) position: , mismatch: 0, identity: 1.0

gttggtctgagtgacacgcatgttcgggggcgctcg	CRISPR spacer
gttggtctgagtgacacgcatgttcgggggcgctcg	Protospacer
************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP006368_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP006368_1

479230-479346

Orphan

Consensus_repeat	Method
CTGCTGCGTCACCTGGTCGAGCTGCTGGATCGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP006368_1

>merge|NZ_CP006368|1|479230-479346|CRISPRCasFinder
CTGCTGCGTCACCTGGTCGAGCTGCTGGATCGCGGCGCTGGTCTGCTGCGCCACCTGGTCGATCTGCGCGGCCGACTGCGTGACCTGCTGCGTCACCTGATCGAGCTGCTGGATCGC

>NZ_CP006368|1|1|479230-479346|CRISPRCasFinder
CTGCTGCGTCACCTGGTCGAGCTGCTGGATCGC	GGCGCTGGTCTGCTGCGCCACCTGGTCGATCTGCGCGGCCGACTGCGTGAC
CTGCTGCGTCACCTGATCGAGCTGCTGGATCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP006368.1\|WP_082639879.1\|467610_469713_-\|dihydroxyacetone-kinase-subunit-DhaK	unknown	unknown	gnl\|CDD\|376910
NZ_CP006368.1\|WP_061978260.1\|466844_467477_-\|dihydroxyacetone-kinase-subunit-L	unknown	unknown	gnl\|CDD\|274099
NZ_CP006368.1\|WP_061978262.1\|471481_472255_-\|D-threitol-dehydrogenase	unknown	unknown	gnl\|CDD\|180723
NZ_CP006368.1\|WP_061978264.1\|473545_474532_-\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|181922
NZ_CP006368.1\|WP_061978261.1\|469796_470441_-\|dihydroxyacetone-kinase-subunit-L	unknown	unknown	gnl\|CDD\|237723
NZ_CP006368.1\|WP_061978269.1\|481571_482636_+\|spore-photoproduct-lyase-family-protein	unknown	unknown	gnl\|CDD\|188401
NZ_CP006368.1\|WP_061978321.1\|483644_484598_-\|sugar-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225263
NZ_CP006368.1\|WP_061978272.1\|484885_486898_+\|transketolase	unknown	unknown	gnl\|CDD\|223100
NZ_CP006368.1\|WP_061978271.1\|483064_483526_-\|RpiB/LacA/LacB-family-sugar-phosphate-isomerase	unknown	unknown	gnl\|CDD\|235509
NZ_CP006368.1\|WP_061978273.1\|487822_488887_+\|fructose-bisphosphate-aldolase-class-II	unknown	unknown	gnl\|CDD\|181691
NZ_CP006368.1\|WP_061978263.1\|472422_473406_-\|substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|380536
NZ_CP006368.1\|WP_061978270.1\|482651_482891_-\|DUF2934-domain-containing-protein	unknown	unknown	gnl\|CDD\|378572
NZ_CP006368.1\|WP_061978267.1\|477750_478716_-\|magnesium-and-cobalt-transport-protein-CorA	unknown	unknown	gnl\|CDD\|213364
NZ_CP006368.1\|WP_061978266.1\|476362_477583_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341024
NZ_CP006368.1\|WP_061978320.1\|470454_471456_-\|dihydroxyacetone-kinase-subunit-DhaK	unknown	unknown	gnl\|CDD\|376910
NZ_CP006368.1\|WP_082639869.1\|487031_487799_+\|triose-phosphate-isomerase	unknown	unknown	gnl\|CDD\|234589
NZ_CP006368.1\|WP_061978265.1\|474590_476072_-\|sugar-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224053

Protein	Function_ID	Function_description	E-value
NZ_CP006368.1\|WP_082639879.1\|467610_469713_-\|dihydroxyacetone-kinase-subunit-DhaK	gnl\|CDD\|376910	pfam02733, Dak1, Dak1 domain. This is the kinase domain of the dihydroxyacetone kinase family EC:2.7.1.29.	1.96078e-160
NZ_CP006368.1\|WP_061978260.1\|466844_467477_-\|dihydroxyacetone-kinase-subunit-L	gnl\|CDD\|274099	TIGR02365, dha_L_ycgS, dihydroxyacetone kinase, phosphoprotein-dependent, L subunit. Two types of dihydroxyacetone kinase (glycerone kinase) are described. In yeast and a few bacteria, e.g. Citrobacter freundii, the enzyme is a single chain that uses ATP as phosphoryl donor and is designated EC 2.7.1.29. By contract, E. coli and many other bacterial species have a multisubunit form (EC 2.7.1.-) with a phosphoprotein donor related to PTS transport proteins. This family represents the subunit homologous to the E. coli YcgS subunit.	6.05668e-56
NZ_CP006368.1\|WP_061978262.1\|471481_472255_-\|D-threitol-dehydrogenase	gnl\|CDD\|180723	PRK06841, PRK06841, short chain dehydrogenase; Provisional.	6.5969e-130
NZ_CP006368.1\|WP_061978264.1\|473545_474532_-\|sugar-ABC-transporter-permease	gnl\|CDD\|181922	PRK09512, rbsC, ribose ABC transporter permease protein; Reviewed.	3.98555e-101
NZ_CP006368.1\|WP_061978261.1\|469796_470441_-\|dihydroxyacetone-kinase-subunit-L	gnl\|CDD\|237723	PRK14479, PRK14479, dihydroxyacetone kinase; Provisional.	1.76508e-62
NZ_CP006368.1\|WP_061978269.1\|481571_482636_+\|spore-photoproduct-lyase-family-protein	gnl\|CDD\|188401	TIGR03886, hypothetical_protein_SlinDRAFT_56750, spore photoproduct lyase family protein. This uncharacterized radical SAM domain protein occurs rarely and sporadically in species that include select Alphaproteobacteria and Actinobacteria, and in Deinococcus deserti VCD115. It is a distant but full-length homolog to the Bacillus subtilis spore photoproduct lyase (spl), which monomerizes thymine dimers created as DNA damage by uv radiation.	0
NZ_CP006368.1\|WP_061978321.1\|483644_484598_-\|sugar-binding-transcriptional-regulator	gnl\|CDD\|225263	COG2390, DeoR, Transcriptional regulator, contains sigma factor-related N-terminal domain [Transcription].	5.6704e-88
NZ_CP006368.1\|WP_061978272.1\|484885_486898_+\|transketolase	gnl\|CDD\|223100	COG0021, TktA, Transketolase [Carbohydrate transport and metabolism].	0
NZ_CP006368.1\|WP_061978271.1\|483064_483526_-\|RpiB/LacA/LacB-family-sugar-phosphate-isomerase	gnl\|CDD\|235509	PRK05571, PRK05571, ribose-5-phosphate isomerase B; Provisional.	1.15441e-62
NZ_CP006368.1\|WP_061978273.1\|487822_488887_+\|fructose-bisphosphate-aldolase-class-II	gnl\|CDD\|181691	PRK09196, PRK09196, fructose-bisphosphate aldolase class II.	0
NZ_CP006368.1\|WP_061978263.1\|472422_473406_-\|substrate-binding-domain-containing-protein	gnl\|CDD\|380536	cd06313, PBP1_ABC_ThpA_XypA, periplasmic sugar-binding proteins (ThpA and XypA) of ABC-type transport systems. This group includes periplasmic D-threitol-binding protein ThpA and xylitol/L-sorbitol-binding protein XypA, which are part of sugar ABC-type transport systems. Both ThpA and XypA share homology with a family of pentose/hexose sugar-binding proteins of the type 1 periplasmic binding protein superfamily, which consists of two domains connected by a three-stranded hinge.	4.58759e-119
NZ_CP006368.1\|WP_061978270.1\|482651_482891_-\|DUF2934-domain-containing-protein	gnl\|CDD\|378572	pfam11154, DUF2934, Protein of unknown function (DUF2934). This bacterial family of proteins has no known function.	5.22744e-10
NZ_CP006368.1\|WP_061978267.1\|477750_478716_-\|magnesium-and-cobalt-transport-protein-CorA	gnl\|CDD\|213364	cd12830, MtCorA-like, Mycobacterium tuberculosis CorA-like subfamily. This bacterial subfamily belongs to the Thermotoga maritima CorA (TmCorA)-like family of the MIT superfamily of essential membrane proteins involved in transporting divalent cations (uptake or efflux) across membranes. This subfamily includes the Mg2+ transporter Mycobacterium tuberculosis CorA (which also transports Co2+). Thermotoga maritima CorA forms funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport by a related protein, Saccharomyces cerevisiae Alr1p. Natural variants in this signature sequence may be associated with the transport of different divalent cations. The functional diversity of the MIT superfamily may also be due to minor structural differences regulating gating, substrate selection, and transport.	9.6793e-132
NZ_CP006368.1\|WP_061978266.1\|476362_477583_+\|MFS-transporter	gnl\|CDD\|341024	cd17471, MFS_Set, Sugar efflux transporter (Set) family of the Major Facilitator Superfamily of transporters. This family is composed of sugar transporters such as Escherichia coli Sugar efflux transporter SetA, SetB, SetC and other sugar transporters. SetA, SetB, and SetC are involved in the efflux of sugars such as lactose, glucose, IPTG, and substituted glucosides or galactosides. They may be involved in the detoxification of non-metabolizable sugar analogs. The Set family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.64152e-54
NZ_CP006368.1\|WP_061978320.1\|470454_471456_-\|dihydroxyacetone-kinase-subunit-DhaK	gnl\|CDD\|376910	pfam02733, Dak1, Dak1 domain. This is the kinase domain of the dihydroxyacetone kinase family EC:2.7.1.29.	2.4667e-154
NZ_CP006368.1\|WP_082639869.1\|487031_487799_+\|triose-phosphate-isomerase	gnl\|CDD\|234589	PRK00042, tpiA, triosephosphate isomerase; Provisional.	5.24041e-102
NZ_CP006368.1\|WP_061978265.1\|474590_476072_-\|sugar-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224053	COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism].	0

>NZ_CP006368.1|WP_061978267.1|477750_478716_-|magnesium-and-cobalt-transport-protein-CorA
MTVVAAYEYRDGKRLREVSLSEPLPPREPGSFVWIGIADPTEAEMSALGHCFDLHPLALEDASHPHVRPKLEVYDGELFLVARTAMREGDHIRYGNTSIFVSEDVIVTIRTGSHSDHRPLRAKLEASPLLLRYGVDYVLYGVLDFVVANYEPVLESIEEDLFDMERRALDAFLTRGEINTLFSIRRELARFGRIMGPMEEVLERLAHLEHKGLDAEVRPYFSDVYGRVRRATARIEGARDSITATLEASSLLEQHRQGEITRQLAAWAAILAVPTAIAGVYGMNFENMPELHWRYGYFVVLTAIVGIAGFLFWRFRRSGWL
>NZ_CP006368.1|WP_061978266.1|476362_477583_+|MFS-transporter
MIVPSPSPRQAGREAALILLFLFGLALTNASLVTFMGFHIVHDLGQPPWAIGLYAGVTTLVSVTANRAAGERIDRGWPIARLVSLANLCMLAGTLILALPHDYARLLTLAAPLVALGQTATTSLYSLGRLHAERNGIDPARANTRLRTMTSLGWMIGPPLGFGAADLWGSASVFRHAAVLAALCLGLGFLCLPRGFRKDTPTPANSSAAAREDGPNPALRIAGLVCLLFSISQCLCAVSLPIFLIQDIGLPTFAPGLSFGVKCLFEVVLILSCAPLIARFGARTCLLASAGLGVLAYALLSKVHSIPTLIVGAAAEGVYYGLFAGVSASFVQGFSRGRIGRATSLYMNSLFLGSLAATSLLAALATFLSFRATILAAMGTMAGAAILLLLTRRFDAQSDLAASGRA
>NZ_CP006368.1|WP_061978265.1|474590_476072_-|sugar-ABC-transporter-ATP-binding-protein
MSAPLLRVEGLRKSFGGVAALKDGRFELAPGSVHALCGGNGAGKSTFLSILMGIHKRDGGTIWRGEREVEFSGPAEALAAGIAIIEQELSPVPFMTVAENIYLGREPSGRFGGIDFRAMNRDAQSLLDELGFQIRASQTMQTLTVAQMQLVEIAKALSHDAEVIFMDEPTSAIGEREAQQLFSAIERLKAQGRGIVYVSHRLSEIFQIADSYTVFRDGAYVASGKLAETDRPSLIRMIVGREMGEEYIKTNAPTAEIGLEVEGLSSPGHISDISFSVRKGEIFGIYGLMGSGRTEIFDALFGLDPKAQGQIRVEGADVSITGPRDAMRQGIALVTEDRKQTGLNLSDSVRANIALASLPEMSPGFVMRGKAEVEASRAMIERFAIKAARDTMPVSGLSGGNQQKVVLGKWFLRNPRLLLLDEPTRGVDVGAKREIYRVICDFAAGGGTVVMISSEIDEVLGMSDRVMVMRGGRSAGILERAEASAQSLVHLST
>NZ_CP006368.1|WP_061978264.1|473545_474532_-|sugar-ABC-transporter-permease
MKPATGWFGSERRRLLIQEYGIFIAFLVLVAVLALSNEFFLTAGNISNVLLQTSINGVLAIGMTFVILTRGIDLSVGSVVALAGMVSASLATTSPAGVAGGPYPVALALAAGIGVGVLTGSIVGLIVSRFSVPAFVATLGMLSAARGATLIYGNGRPVPGLVPDFRWIGTGNVLGVPMPVVILAGVFIVSWWILSRTRFGRYIYAVGGNPHAAKTSGIDVTRIRFLVYVISGALSGLAGMILSARTGSALPQAGVAYELDAIAAVVIGGTSLSGGVGRVTGTLIGALIIGVMNNGLDLLGIQSYYQQILKGALIVGAVMLDQTRKHGA
>NZ_CP006368.1|WP_061978263.1|472422_473406_-|substrate-binding-domain-containing-protein
MKKLMLAFAMASALYAPAAMAQEKLKIGATVYGLNAEFMQIWTAALQKHPAVKSGEVEVTIFDGRYDALVQQEQFNTMITQKYNAIIFVPMDVEAGAAAVQTAHDAGIPVVGSNARVNSDLLASYVGSNDVEAGELEAKSVLDKMGCKGNVVIIEGPIGQSGQIQRLEGNEKALAACPDVKVLEQQTANWSRAEAQTLMENWLTSHPGQIGGVIGQNDEMALGAIEAIKAANLKVEDFAIAGIDGVTDAINAVKAKEMASILQDANAQAQGALDVAIKAVKPDYQPQSDIWKQYPAMSWKDGKEKTYLVPWTPVTLDNADKLLESRK
>NZ_CP006368.1|WP_061978262.1|471481_472255_-|D-threitol-dehydrogenase
MSDASPQVDLNFSLAGKVALVTGGGSGIGAAIAQAYAQKGARIAVLDIQQEAAEAMAKSLGDDAKAFRCDVSDAASVTSAIDAVLAAFGQIDIAVNSAGIVALAPAEDLGVDAWDKTIAINLKGTFLVSQAAGRAMIKAGRGGKIVNLASQAGTVAIDEHVAYCASKFGVIGLSKTLAAEWGKHGICVNTISPTIVLTDLGRKAWSGEKGEAARRRIPSGRFAYPQEIAAAAVFLASNGADMINGADLLVDGGYTIV
>NZ_CP006368.1|WP_061978320.1|470454_471456_-|dihydroxyacetone-kinase-subunit-DhaK
MQRFINNPDEVVEDTVKGFVKAHPDLVRLSERNRRVIVSTFAPQKGKVGVVTGGGSGHEPAFIGYTGRNMLDAVAVGELFSSPTAKSFHDAFKEADGGAGVVCLYGNYAGDNMNVKMATKLASKDGIEIATVVANDDVCSAPLSEREKRRGVAGEILLWKIGGAKAASGASLEEVRATAQRAIDNCRSVGIGLGPCTLPAVGHPNFQIEPGTMEVGIGHHGEPGIRVEPLKTAAEVARDMATIVLDDHALPEGAQVAVLVSGLGATPLNELYILGDTIEEEIAKRGLKIHRTYVGNYFTSLEMVGATLTVIALDEELKALLDAPAACPALVQV
>NZ_CP006368.1|WP_061978261.1|469796_470441_-|dihydroxyacetone-kinase-subunit-L
MQSFSNSGSGAIVLAMADRIVENRAYLSEIDGKIGDGDHGVNMAKGFGMAADRLKGRDVSLTEAMETLSEVLMGEIGGSMGPLYGMMFTEFSETLGQTEAIDAPLFSAMLHKGLEGIQSIGSAKVGDKTLIDTLVPAVEAFDQATGEGRSFADALDALTKGAEAGRDSTIDLVAKIGRASRLGERSRGVLDAGATSCAMILTVLAEGAKARLSA
>NZ_CP006368.1|WP_082639879.1|467610_469713_-|dihydroxyacetone-kinase-subunit-DhaK
MTTAKPKLKTAKDGTADAAIPVPLRFGDDPQLWAAWLYYEEGLTQGEIADAMGVSRATVNATLADARERGVVDITIEPQRLAAVTLAREVKRHFGLHDCLVVPNGGEAGQLIDRLGRAGGLALIDLLRSGDTLAVAWGRTVLAVARQLRAPRLQDLRVVQATGGMSTGTPFSPELCASAIADALGAFCLPLTAPGIVSSPELRALLLDEPLLRAQFEALRGASRALLGISSLRPNSTIHSSGFFDAVPLQDYLARNAVGVVAGRFIGPGGEPVEGPLDERTIGLSLQDLAGIERRIAVAGGFDKVPAILATLRGRHCDVLVTDAATARGILDAEGVASTAFLKRGQRPSDAPPAAGPELQRRFVKKFLNDPDDVVDEMLDGAARAHRTHLVPVPGARRAFMAKAGARKGRVALVVGGGSGHEPCFLGYVGRGMASAVAVGNVFSSPPPDPILRAARACDGGAGVLFVYGNYAGDTMNFEMAAELATDAGIAVRTVVTTDDVASSSPEDRDGRRGVAGNVFVFKVAGAACDLGWTLEACEAAARRANQRTYTMGVALEPCSMPQSRRFNFAIGPDEMEVGVGIHGEPGVSREAIRPADAVADTIMDRILSELPEDRGGRVAVLVNSFGATPLMELYVLYRRVEQRLAARGLTVARNWIGHYCTSLDMAGASVSVLHLDDALLALLDHPCDTPFFHVAPSTT
>NZ_CP006368.1|WP_061978260.1|466844_467477_-|dihydroxyacetone-kinase-subunit-L
MEQTASNRLAAVFAAIRQAVEAEKTHLSELDGPIGDADHGTTMALGFRAVDRTLSASRDASPSVIFAQAAAAFLDAVGASTGPLYATGFRRAAQRLEGRVEFGPEEQVLTLEGIAAGIAERGKAQRGDKTMLDVWLPAAEAARAAFVRKQPLWPAVTETAERAAEATGSMVASRGRAARLGERSLGHLDPGAVSAALILRAMAGILSPTA
>NZ_CP006368.1|WP_061978269.1|481571_482636_+|spore-photoproduct-lyase-family-protein
MALRPLIDPTRIYLEPAARAHPRGQAILARFPQAEQVEVESYARIPELFNDPSSVDGWLSIKRDVLVLGLKKSMTLRPNGRSADFIAPSSSNGCAMACSYCYVPRRKGYANPVTIFVNGEDVVAALRRHAGRLGPKPQPNSVDPVDWVYDLGENGDLSVDATLSDNVHLLVEAFRGMPNAKGSFATKHVNRDLLSYDPQGRTRIRFSLMPQAMARSVDIRTSPIAERIAAINDFVAAGYEVHVNFSPVIVHEQWEGEWKALFGELDAALSPAAKRQLKFEIIMLTHNAGLHEINLGWHPKGEDALWRPDLQEEKVSESGMVNLRYRHGWKGQWLARLRTWLNEAMPYCEVRYAF
>NZ_CP006368.1|WP_061978270.1|482651_482891_-|DUF2934-domain-containing-protein
MFHGEDMQMIRDRAYAIWQSEGHPEGRALEHWLMAERQRLASDSAQPWYEANGMEGETAFMRRMLWTAQPFVAEHATFH
>NZ_CP006368.1|WP_061978271.1|483064_483526_-|RpiB/LacA/LacB-family-sugar-phosphate-isomerase
MKIVLGGDSAGVPLVKVLMEHLQKRTDLEVVDASAAPTGESERYATTTDRIASQVVDGTFDRGILVCGTGIGVCISANKVPGIRAALTHDTYSAERAALSNNAQIITMGARVIGPELAKAIVDSYLAQTFDPASSSGPNVDAIDAVEQKYKSA
>NZ_CP006368.1|WP_061978321.1|483644_484598_-|sugar-binding-transcriptional-regulator
MTEIARRYYEGDATQADIAAEFGLSRMKVSRLLRQAREEGVVDVRIRVHRTVAADIEERLCARFGLKRALIAADRADAEAQRDDVALVVADYLDRELFTGATVAVGMGRNVAAVADTRGRPAVESAVFVCATGGAHRAGEPGNADHICRKLARRFGGTPETLYAPAYVPDAALRDALLRNQTVRRTLDVARSADFALIGIGDLGEESHMVRMGWFKRDEILAARAAGVVGDLMGYDFFDLEGRERNEILGGRVIGLRLEEMRAIPNVVAIASEPTKTVAILAALRTGIIGVLATSLVNAQSILALDEATRLATQKAP
>NZ_CP006368.1|WP_061978272.1|484885_486898_+|transketolase
MLDKPNLPPLDVTVTRYLASGIRFLSMDAVEAANSGHPGMPLGMADVATVLFSRFMKFDAKQPNWPDRDRFVLSAGHGSMLLYSLLHLTGYEDFTIDELKRFRQLHSKAAGHPEFGEGAGIETTTGPLGQGLATAVGMALAERILNARFGTDLCEHYTYTIAGDGCLMEGVSQEAISLAGHLKLNKLIVLWDDNRITIDGATDLTTSDNVAGRFASANWNTDAVDGHDPAAIAAAIERAQKSDKPTLIACRTTIGYGGGKKAGTSGVHGSPLGAEGIAYAREYFTWAHEPFVLPEDLTDQWKSFGRRGEADAKAWAERLAKADPAQREAFERVLKDGFDGNPAELLSELKTKMIADKASLATRKAGQMVVEALTAKSAKLIGGSADLSGSNLTKAGAAKPVQAGAYDGNYIFYGVREHAMAAVMNGLSLHGGFTPFGGTFLCFSDYARPAMRLSALMHQPVVYVMTHDSIGQGEDGPTHQPIEHLASLRAMPNMLVMRPADGIETVECWEAALGDVKAPTTLVLSRQNLKAVRTEASSENLSAKGAYVLREAEGGARAVTILATGSEVEIAVAAAEALAGEGVKAAVVSMPCWELFAKQPKSYRDAVLGSAPRIAVEAASPFGWTRFVEDEDDVIGMNGFGASAPGADLYKHFGITAEKVAEKAKAKARA
>NZ_CP006368.1|WP_082639869.1|487031_487799_+|triose-phosphate-isomerase
MRKRPWIGTSWKMNKTIAEADAFCEILKASDRAHRSDDAQLFVIPPFTVLHRVAEQLKATDVIVGAQNAHWKDSGAWTGEISVPQVRDCGGALVEIGHSERRTFFNETDETVALKTAATVRHGLTALVCIGDTKEEYDSGRTQEALERQVLAAISKVDWAGGAKVILAYEPVWSIGEGGTPAEPDFADAQHKRIKALTADRLGAPLSVVYGGSVNPGNCVDLALCEHIDGLFIGRSAWSAEGYLGIVADVTAALG
>NZ_CP006368.1|WP_061978273.1|487822_488887_+|fructose-bisphosphate-aldolase-class-II
MALITLRQLLDHAAEHGYGVPAFNINNMEQGLAILAAAAKTDAPVILQASRGARAYANDLILARLIEGLSEMHPDIPICMHLDHGNNEATCITAIQHGFTSVMMDGSLKEDGASLADYSYNAGITRRVSDMAHWCGASVEGEIGVLGSLETGSGEKEDGHGFEGTLSHDQLLTDPEEAVRFVEDTHVDALAVAMGTSHGAYKFSRKPDGEVLAMNVIEAIHRKLPNTHLVMHGSSSVPEDLQEIVNKHGGEIKPTWGVPVEEIQRGIRHGVRKINIDTDCRLAMTGAIRKVFAEKPEEFDPRKYLGPAMTAVTKLAAQRFEEFGTAGHASAIKPIALSDMAKRYRNGSLKTSAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP006368_1	1.1\|479263\|51\|NZ_CP006368\|CRISPRCasFinder	479263-479313	51	NZ_CP006368	Aureimonas sp. AU20 plasmid pAU20a, complete sequence	479263-479313	0	1.0

1. spacer 1.1|479263|51|NZ_CP006368|CRISPRCasFinder matches to NZ_CP006368 (Aureimonas sp. AU20 plasmid pAU20a, complete sequence) position: , mismatch: 0, identity: 1.0

ggcgctggtctgctgcgccacctggtcgatctgcgcggccgactgcgtgac	CRISPR spacer
ggcgctggtctgctgcgccacctggtcgatctgcgcggccgactgcgtgac	Protospacer
***************************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2498000 : 2513083

uncultured_Mediterranean_phage(55.56%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061976125.1\|2498000_2498702_-	dTMP kinase	M1PSC7	Streptococcus_phage	2.7e-34	38.8
WP_082639361.1\|2498698_2499892_-	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_061976126.1\|2499971_2501150_-	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	5.0e-17	48.9
WP_061976127.1\|2501365_2502505_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	2.6e-103	53.9
WP_061976128.1\|2502501_2503584_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_061976129.1\|2503596_2504067_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	3.2e-39	56.1
WP_061976130.1\|2504166_2504709_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	1.1e-32	50.0
WP_061976131.1\|2504728_2505241_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	7.7e-23	34.8
WP_148640031.1\|2505279_2505552_+	hypothetical protein	NA	NA	NA	NA
WP_082639363.1\|2505579_2508357_-	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	1.6e-98	33.3
WP_061976133.1\|2508747_2509383_+	MarC family protein	NA	NA	NA	NA
WP_061976134.1\|2509394_2509958_-	single-stranded DNA-binding protein	A0A0K1LLZ9	Caulobacter_phage	2.5e-43	72.7
WP_061976135.1\|2510206_2513083_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	62.0

DBSCAN-SWA_2

2615126 : 2626458

uncultured_Mediterranean_phage(75.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061976210.1\|2615126_2617712_-	protein translocase subunit SecD	A0A1B1IVP7	uncultured_Mediterranean_phage	2.6e-58	49.4
WP_061976211.1\|2617835_2618177_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	7.2e-09	34.1
WP_061976212.1\|2618315_2619182_+	ATP-binding protein	NA	NA	NA	NA
WP_082639386.1\|2619242_2620631_-	M23 family metallopeptidase	S5VY01	Leptospira_phage	5.0e-08	31.0
WP_061976214.1\|2620688_2621336_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1J0MC50	Streptomyces_phage	3.1e-13	36.1
WP_061976215.1\|2621342_2622098_-	5'/3'-nucleotidase SurE	NA	NA	NA	NA
WP_061976216.1\|2622101_2623385_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.9e-102	54.7
WP_061976217.1\|2623424_2624240_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	2.5e-47	44.7
WP_082639387.1\|2624236_2624764_-	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_061976218.1\|2624812_2625043_-	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	7.0e-08	67.4
WP_061976219.1\|2625432_2626458_-	beta-N-acetylhexosaminidase	A0A1B1IVS3	uncultured_Mediterranean_phage	9.1e-23	45.0

DBSCAN-SWA_3

2768126 : 2785002

Sinorhizobium_phage(20.0%)

integrase,tail,protease,capsid,terminase,portal,head

attL 2764205:2764218|attR 2771145:2771158

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2764205:2764218	attL	NA	NA	NA	NA
WP_061976334.1\|2768126_2769224_+\|integrase	site-specific integrase	A0A291AUQ3	Sinorhizobium_phage	3.4e-76	42.7
WP_061976335.1\|2770140_2770566_-	hypothetical protein	NA	NA	NA	NA
WP_061976336.1\|2770876_2771344_+	hypothetical protein	NA	NA	NA	NA
2771145:2771158	attR	NA	NA	NA	NA
WP_061976337.1\|2772264_2774751_-	hypothetical protein	A0A291AUM6	Sinorhizobium_phage	9.5e-58	47.7
WP_061976338.1\|2774764_2776381_-\|terminase	terminase large subunit	A0A2K5B285	Erysipelothrix_phage	1.2e-69	32.1
WP_187301261.1\|2776352_2776754_-\|terminase	phage terminase small subunit P27 family	A0A1B3AYP2	Gordonia_phage	5.1e-14	38.6
WP_148640062.1\|2776750_2777080_-\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_187301262.1\|2777067_2777532_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_061976342.1\|2777528_2777903_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_187301263.1\|2777902_2778151_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_061976344.1\|2778782_2779139_-\|tail	phage tail protein	L7TKL1	Rhizobium_phage	5.0e-21	46.4
WP_082639415.1\|2779135_2779492_-	HNH endonuclease	Q38456	Bacillus_phage	1.2e-17	49.0
WP_061976345.1\|2779491_2780082_-\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_061976346.1\|2780085_2780583_-	hypothetical protein	A0A2D1GNF2	Pseudomonas_phage	4.0e-08	28.6
WP_061976347.1\|2780596_2781748_-\|capsid	phage major capsid protein	E4ZFM5	Streptococcus_phage	3.3e-45	33.5
WP_148640063.1\|2781759_2782281_-\|head,protease	HK97 family phage prohead protease	A0A0R6PIR7	Moraxella_phage	9.0e-19	38.5
WP_061976348.1\|2782277_2783426_-	hypothetical protein	NA	NA	NA	NA
WP_061976349.1\|2783422_2783755_-	gene transfer agent family protein	NA	NA	NA	NA
WP_187301264.1\|2783751_2785002_-\|portal	phage portal protein	A0A2K5B287	Erysipelothrix_phage	1.4e-46	32.0

DBSCAN-SWA_4

3108997 : 3169387

Paracoccus_phage(16.67%)

tRNA,tail,protease,capsid,portal,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_148640153.1\|3108997_3110617_-\|tRNA	lysine--tRNA ligase	NA	NA	NA	NA
WP_148640075.1\|3110761_3111631_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_061976625.1\|3111741_3113703_+	glycosyltransferase	NA	NA	NA	NA
WP_061976626.1\|3113675_3113921_-	DUF2188 domain-containing protein	NA	NA	NA	NA
WP_061976627.1\|3114390_3114810_+	NUDIX hydrolase	NA	NA	NA	NA
WP_061976628.1\|3114870_3115677_-	formate dehydrogenase accessory sulfurtransferase FdhD	NA	NA	NA	NA
WP_061976629.1\|3115928_3116591_+	TerC family protein	W8EBD0	Pseudomonas_phage	5.3e-16	34.9
WP_148640154.1\|3116611_3117055_+	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	E7DN65	Pneumococcus_phage	7.1e-25	50.0
WP_061976631.1\|3117127_3118258_+	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	2.1e-49	33.9
WP_061976632.1\|3118570_3119842_-	porin	NA	NA	NA	NA
WP_061976633.1\|3120492_3121584_+	pyridoxal phosphate-dependent aminotransferase	A0A142C026	Faustovirus	5.7e-15	25.5
WP_061976634.1\|3121614_3121878_-	hypothetical protein	NA	NA	NA	NA
WP_061977856.1\|3122160_3122511_+	DUF2147 domain-containing protein	NA	NA	NA	NA
WP_148640076.1\|3122587_3122869_-	hypothetical protein	NA	NA	NA	NA
WP_061976635.1\|3122861_3124133_+	porin	NA	NA	NA	NA
WP_061976636.1\|3124416_3124761_+	DUF2147 domain-containing protein	NA	NA	NA	NA
WP_061976637.1\|3124968_3125676_-	glutathione S-transferase N-terminal domain-containing protein	NA	NA	NA	NA
WP_156421136.1\|3125853_3126012_+	hypothetical protein	NA	NA	NA	NA
WP_148640077.1\|3126088_3127591_+	AMP nucleosidase	NA	NA	NA	NA
WP_061976638.1\|3127595_3128621_+	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_061976639.1\|3128743_3129976_+	peptide antibiotic transporter SbmA	NA	NA	NA	NA
WP_061977858.1\|3130003_3131680_-	electron transfer flavoprotein-ubiquinone oxidoreductase	NA	NA	NA	NA
WP_061976640.1\|3131874_3132738_+	uracil-DNA glycosylase	A0A127AW33	Bacillus_phage	1.1e-16	32.1
WP_061976641.1\|3132862_3134113_+	MFS transporter	NA	NA	NA	NA
WP_082639711.1\|3134122_3135037_-	DMT family transporter	NA	NA	NA	NA
WP_187301271.1\|3135345_3137994_+	aminopeptidase N	NA	NA	NA	NA
WP_061976643.1\|3138369_3140643_+	PAS domain-containing sensor histidine kinase	A0A1V0SGX0	Hokovirus	2.5e-25	35.3
WP_082639713.1\|3140846_3143771_-	bifunctional [glutamine synthetase] adenylyltransferase/[glutamine synthetase]-adenylyl-L-tyrosine phosphorylase	NA	NA	NA	NA
WP_061977860.1\|3143811_3145230_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_061976645.1\|3145270_3145987_-	response regulator transcription factor	NA	NA	NA	NA
WP_061976646.1\|3146097_3147615_-	Do family serine endopeptidase	A0A1B1IT49	uncultured_Mediterranean_phage	3.7e-28	30.9
WP_061976647.1\|3147735_3148227_-	cytochrome c-type biogenesis protein CcmH	NA	NA	NA	NA
WP_061976648.1\|3148229_3150209_-	heme lyase CcmF/NrfE family subunit	NA	NA	NA	NA
WP_061976649.1\|3150205_3150709_-	cytochrome c maturation protein CcmE	NA	NA	NA	NA
WP_061976650.1\|3150705_3151884_-	c-type cytochrome biogenesis protein CcmI	NA	NA	NA	NA
WP_061976651.1\|3151995_3152403_-	hypothetical protein	NA	NA	NA	NA
WP_061977861.1\|3152616_3153960_-	sensor histidine kinase	NA	NA	NA	NA
WP_061976652.1\|3154047_3154710_-	response regulator transcription factor	NA	NA	NA	NA
WP_061976653.1\|3154745_3155078_-	hypothetical protein	NA	NA	NA	NA
WP_061976654.1\|3155157_3155364_-	hypothetical protein	NA	NA	NA	NA
WP_061976655.1\|3155404_3159283_-\|tail	glycoside hydrolase/phage tail family protein	A0A0K1Y6G6	Rhodobacter_phage	4.4e-211	37.7
WP_061976656.1\|3159286_3159733_-	C40 family peptidase	F4YXU4	Roseobacter_phage	3.8e-26	44.0
WP_061976657.1\|3159732_3160620_-	DUF2163 domain-containing protein	A0A0B5A5B8	Paracoccus_phage	7.1e-40	37.5
WP_061976658.1\|3160616_3161243_-	DUF2460 domain-containing protein	A0A0B5A2K3	Paracoccus_phage	5.7e-52	51.4
WP_082639465.1\|3161244_3161838_-\|tail	phage tail tape measure protein	D6PGB3	uncultured_phage	2.4e-07	30.8
WP_061976659.1\|3161839_3162070_-\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_061976660.1\|3162066_3162405_-	gene transfer agent family protein	NA	NA	NA	NA
WP_061976661.1\|3162404_3162818_-\|tail	phage major tail protein, TP901-1 family	I3UM07	Rhodobacter_phage	1.9e-11	31.9
WP_061976662.1\|3162899_3163313_-	DUF3168 domain-containing protein	A0A141GEW7	Brucella_phage	1.8e-09	27.6
WP_061976663.1\|3163375_3163558_-	hypothetical protein	NA	NA	NA	NA
WP_061976664.1\|3163554_3163887_-\|head	phage head closure protein	NA	NA	NA	NA
WP_061976665.1\|3163888_3164449_-\|head,tail	phage head-tail connector protein	NA	NA	NA	NA
WP_061976666.1\|3164524_3165778_-\|capsid	phage major capsid protein	M1FPN2	Enterobacteria_phage	3.3e-75	43.0
WP_061976667.1\|3165765_3166317_-\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	1.1e-27	41.2
WP_061976668.1\|3166313_3166661_-	hypothetical protein	NA	NA	NA	NA
WP_061976669.1\|3166680_3167877_-\|portal	phage portal protein	W8ECU7	Geobacillus_phage	1.8e-62	37.7
WP_061977863.1\|3168166_3169387_-	DNA-packaging protein	A0A0K1LMR9	Caulobacter_phage	6.0e-74	42.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP006369

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP006369_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP006369_1

28579-28723

Orphan

Consensus_repeat	Method
CAGGCCGCCTCCACCGAGC	CRT

3 spacers

The CRISPR arrays of NZ_CP006369_1

>merge|NZ_CP006369|1|28579-28723|CRT
CAGGCCGCCTCCACCGAGCAGCTGGGGCAGGGAACGGTCGAGCAGGCCGCCTCGGCCCAGCTTCTGAGCCGCGGCATTTCCGAACAGGCCGCCTCCACCGAGCGGCTCAGCCAGGGCGCCACGGAACAGGCCGCCGCCACCGAGC

>NZ_CP006369|1|1|28579-28723|CRT
CAGGCCGCCTCCACCGAGC	AGCTGGGGCAGGGAACGGTCGAG
CAGGCCGCCTCGGCCCAGC	TTCTGAGCCGCGGCATTTCCGAA
CAGGCCGCCTCCACCGAGC	GGCTCAGCCAGGGCGCCACGGAA
CAGGCCGCCGCCACCGAGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP006369.1\|WP_082639890.1\|18821_20042_-\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340831
NZ_CP006369.1\|WP_061978334.1\|21485_21899_-\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|378915
NZ_CP006369.1\|WP_082639893.1\|20207_21092_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_CP006369.1\|WP_061978346.1\|41874_42555_+\|MtnX-like-HAD-IB-family-phosphatase	unknown	unknown	gnl\|CDD\|236562
NZ_CP006369.1\|WP_061978343.1\|36813_38898_-\|MCP-four-helix-bundle-domain-containing-protein	unknown	unknown	gnl\|CDD\|223910
NZ_CP006369.1\|WP_061978347.1\|42554_43490_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|212539
NZ_CP006369.1\|WP_061978335.1\|22063_22849_+\|amino-acid-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270342
NZ_CP006369.1\|WP_061978341.1\|29897_31409_-\|esterase-like-activity-of-phytase-family-protein	unknown	unknown	gnl\|CDD\|379191
NZ_CP006369.1\|WP_061978348.1\|43486_43864_+\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|185011
NZ_CP006369.1\|WP_082639946.1\|40106_41603_-\|glutamate-1-semialdehyde-2,1-aminomutase	unknown	unknown	gnl\|CDD\|234607
NZ_CP006369.1\|WP_061978336.1\|22947_23622_+\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
NZ_CP006369.1\|WP_061978333.1\|14058_17433_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340831
NZ_CP006369.1\|WP_061978337.1\|23623_24373_+\|amino-acid-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
NZ_CP006369.1\|WP_082639944.1\|17447_18662_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340856
NZ_CP006369.1\|WP_082639895.1\|31964_32105_+\|DUF1127-domain-containing-protein	unknown	unknown	unknown
NZ_CP006369.1\|WP_061978680.1\|32278_34870_-\|response-regulator	unknown	unknown	gnl\|CDD\|237425
NZ_CP006369.1\|WP_061978342.1\|35143_36460_-\|cation:proton-antiporter	unknown	unknown	gnl\|CDD\|223104
NZ_CP006369.1\|WP_061978338.1\|24480_25698_+\|cysteine-desulfurase-like-protein	unknown	unknown	gnl\|CDD\|273906
NZ_CP006369.1\|WP_061978339.1\|25694_27095_+\|dihydropyrimidinase	unknown	unknown	gnl\|CDD\|184033
NZ_CP006369.1\|WP_148640204.1\|39151_39658_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670

Protein	Function_ID	Function_description	E-value
NZ_CP006369.1\|WP_082639890.1\|18821_20042_-\|glycosyltransferase-family-4-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	2.34908e-16
NZ_CP006369.1\|WP_061978334.1\|21485_21899_-\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|378915	pfam12680, SnoaL_2, SnoaL-like domain. This family contains a large number of proteins that share the SnoaL fold.	0.00171242
NZ_CP006369.1\|WP_082639893.1\|20207_21092_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	5.12397e-43
NZ_CP006369.1\|WP_061978346.1\|41874_42555_+\|MtnX-like-HAD-IB-family-phosphatase	gnl\|CDD\|236562	PRK09552, mtnX, 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed.	1.434e-26
NZ_CP006369.1\|WP_061978343.1\|36813_38898_-\|MCP-four-helix-bundle-domain-containing-protein	gnl\|CDD\|223910	COG0840, Tar, Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms].	4.86064e-56
NZ_CP006369.1\|WP_061978347.1\|42554_43490_+\|hypothetical-protein	gnl\|CDD\|212539	cd11593, Agmatinase-like_2, Agmatinase and related proteins. This family includes known and predicted bacterial and archaeal agmatinase (agmatine ureohydrolase; AUH; SpeB; EC=3.5.3.11), a binuclear manganese metalloenzyme that belongs to the ureohydrolase superfamily. It is a key enzyme in the synthesis of polyamine putrescine; it catalyzes hydrolysis of agmatine to yield urea and putrescine, the precursor for biosynthesis of higher polyamines, spermidine, and spermine. As compared to E. coli where two paths to putrescine exist, via decarboxylation of an amino acid, ornithine or arginine, a single path is found in Bacillus subtilis, where polyamine synthesis starts with agmatine; the speE and speB encode spermidine synthase and agmatinase, respectively. The level of agmatinase synthesis is very low, allowing strict control on the synthesis of putrescine and therefore, of all polyamines, consistent with polyamine levels in the cell. This subfamily belongs to the ureohydrolase superfamily, which includes arginase, agmatinase, proclavaminate amidinohydrolase, and formiminoglutamase.	3.79092e-05
NZ_CP006369.1\|WP_061978335.1\|22063_22849_+\|amino-acid-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270342	cd13624, PBP2_Arg_Lys_His, Substrate binding domain of the arginine-, lysine-, histidine-binding protein ArtJ; the type 2 periplasmic binding protein fold. This group includes the periplasmic substrate-binding protein ArtJ of the ATP-binding cassette (ABC) transport system from the thermophilic bacterium Geobacillus stearothermophilus, which is specific for arginine, lysine, and histidine. ArtJ belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	7.46251e-66
NZ_CP006369.1\|WP_061978341.1\|29897_31409_-\|esterase-like-activity-of-phytase-family-protein	gnl\|CDD\|379191	pfam13449, Phytase-like, Esterase-like activity of phytase. This is a repeated domain that carries several highly conserved Glu and Asp residues indicating the likelihood that the domain incorporates the enzymic activity of the PLC-like phospho-diesterase part of the proteins.	1.67149e-32
NZ_CP006369.1\|WP_061978348.1\|43486_43864_+\|EamA-family-transporter	gnl\|CDD\|185011	PRK15051, PRK15051, 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; Provisional.	7.28373e-06
NZ_CP006369.1\|WP_082639946.1\|40106_41603_-\|glutamate-1-semialdehyde-2,1-aminomutase	gnl\|CDD\|234607	PRK00062, PRK00062, glutamate-1-semialdehyde 2,1-aminomutase.	4.43083e-180
NZ_CP006369.1\|WP_061978336.1\|22947_23622_+\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	1.31274e-71
NZ_CP006369.1\|WP_061978333.1\|14058_17433_-\|glycosyltransferase	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	6.51084e-56
NZ_CP006369.1\|WP_061978337.1\|23623_24373_+\|amino-acid-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	2.12565e-143
NZ_CP006369.1\|WP_082639944.1\|17447_18662_-\|glycosyltransferase	gnl\|CDD\|340856	cd04950, GT4_TuaH-like, teichuronic acid biosynthesis glycosyltransferase TuaH and similar proteins. Members of this family may function in teichuronic acid biosynthesis/cell wall biogenesis. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.	2.54894e-117
NZ_CP006369.1\|WP_148640204.1\|39151_39658_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	1.57948e-16
NZ_CP006369.1\|WP_061978680.1\|32278_34870_-\|response-regulator	gnl\|CDD\|237425	PRK13557, PRK13557, histidine kinase; Provisional.	4.80645e-129
NZ_CP006369.1\|WP_061978342.1\|35143_36460_-\|cation:proton-antiporter	gnl\|CDD\|223104	COG0025, NhaP, NhaP-type Na+/H+ and K+/H+ antiporters [Inorganic ion transport and metabolism].	7.56626e-44
NZ_CP006369.1\|WP_061978338.1\|24480_25698_+\|cysteine-desulfurase-like-protein	gnl\|CDD\|273906	TIGR01976, am_tr_V_VC1184, cysteine desulfurase family protein, VC1184 subfamily. This model describes a subfamily of probable pyridoxal phosphate-dependent enzymes in the aminotransferase class V family (pfam00266). The most closely related characterized proteins are active as cysteine desulfurases, selenocysteine lyases, or both; some are involved in FeS cofactor biosynthesis and are designated NifS. An active site Cys residue present in those sequences, in motifs resembling GHHC or GSAC, is not found in this family. The function of members of this family is unknown, but seems unlike to be as an aminotransferase. [Unknown function, Enzymes of unknown specificity].	2.48182e-116
NZ_CP006369.1\|WP_061978339.1\|25694_27095_+\|dihydropyrimidinase	gnl\|CDD\|184033	PRK13404, PRK13404, dihydropyrimidinase; Provisional.	0

>NZ_CP006369.1|WP_061978339.1|25694_27095_+|dihydropyrimidinase
MTAPFDLVIRGGTVATASDVFAADIGVRDGRIVQIGEALGEGAETIDATGRFVLPGGIDSHVHLSQPSGEGITMADDFESGTRSALFGGNTTILPFCLQEKGQSIREALKCYHALAEGQCYTDHSFHMIVSDPTAAVLGQELPALVADGYTSFKVFMTYEGLRLNDREILETMDVARRTGALVMVHCENEDAIRYLIGRHEAEGDVAPRAHATTRPVAVEREATHRALSLAEVVDVPVVIVHVSNGPAIEEIARARARGRKVIGETCPQYLMLTADDLEGMDWEGAKFVCSPPPRDKASQDACWTGLESGTFDLFSSDHCPFRYDDSAGKLNPKGRTSFRHIPNGIPGVETRLPILFSEGVMKGRIDLPRFVALTSTNHAKVYGLERKGRIAVGMDADIAIWDPAARRTIRHADLHDGADYSPYEGVPIQGWPTDVILGGKVMIRDGALEGRKGDGRYRPRALPRL
>NZ_CP006369.1|WP_061978338.1|24480_25698_+|cysteine-desulfurase-like-protein
MTLDLDFVRAQFPALQGEWAYMDNAGGSQVLRRVADRVFDYLLTTNVQTGASYEPSRVSTERVSQSRTAFARFMNCDPGEIVMGASTTALIRYLSESMVGRLQPGDEIILTNTDHEANIGPWLKHEARGVVIRWWRCDPETFELNLEDLKGLMTERTKLVCVTHASNILGTINPIRQIADIVHGGGAELCVDAVAYAPHRAIDVKALDADYYIFSVYKVFGPHHAVMFGKREKLLELDNIYHYFFDKGRVPHKLEPGNINYECAFGSIGAVDYVEELGARDGAAPGRASVEAGFAAIAEQERALTAQLMDFLASRNSVRVIGRTSSAIADRVSTVSFTVGEESSKRIVEAVDKAQVGIRYGDFYAKRIVEEHGLTRTDGVVRVSMVHYNTAAELNRLIAALEPAL
>NZ_CP006369.1|WP_061978337.1|23623_24373_+|amino-acid-ABC-transporter-ATP-binding-protein
MAVTANEPIIRMRGVAKRYGTFQALKGVDLEVAAGEVVVLLGPSGSGKSTLIRCINHLEEYDAGDVFVGGVRVERGRNLLKVRQQTGMVFQAFNLFPNLSVLDNVALGPVRVKKLSWEASRAKARTLLDRVGIAAQAEKFPTQLSGGQQQRVGIARALAMEPRILLFDEPTSALDPEMVGEVLDVIKGLAHSGVTLVLVTHEMGFARQVADRIVFMEEGEIREVSTPDVFFTSTRNERARAFLDAVLNH
>NZ_CP006369.1|WP_061978336.1|22947_23622_+|amino-acid-ABC-transporter-permease
MDIVTTFFNMDVLWRSMPQLLQGLWRTILLGGLSIVLGLLGGLGLALMRLYAPRPLRWLSICYIDVFRALPVLVWLVIVYYAFPFIGIRLSPFASACLALTTVSSAYTAEIYRAGIEAIPRGQFEAAQSIGLNAVDVMRDVVLPQAVRIVIPPLTNNSINVMKDTALASVVALPDLLKQATQAQALAANPTPLIGAAMLYLILLLPLVRLVARFEKRYSAREAR
>NZ_CP006369.1|WP_061978335.1|22063_22849_+|amino-acid-ABC-transporter-substrate-binding-protein
MTRIKLAALAAALLTIASPAAAKSLTVGANIGNVPWEFQDEKSETVGFEVELVKEMAKRMGYDETSFENIPFNGLFSAVQSGRIDAAISSITITKKRLESVSFAQPYYDSDQSLSVLKSSGIEGLKGLNGKVVGVDTGSTGDIYATAHEKELGLSEIRRFEGLSPAMLDLAAGRIDGYISDIPAVAYYIKDKPQYAVVERIPTGEQYSVMFAKDSPLVAEATKAITAMKTDGFLSGLHEKWFGTKPDAATSTVKVAETPKL
>NZ_CP006369.1|WP_061978334.1|21485_21899_-|nuclear-transport-factor-2-family-protein
MADKLHTERNEADVAIVRAYLEASMVPDPDRAAGFMAPGCTITFTGGRAFSHPSGPTSVNAARYKWVKKRMERFDVAPGDGVTTVYSCGYLYGEWPDGTPFDNNRYVDRFEVVNGRITKMDVWNDSAEWILDPALRR
>NZ_CP006369.1|WP_082639893.1|20207_21092_+|GntR-family-transcriptional-regulator
MHCDRKVHTIWVGFRGSESVSSAFFARIRRATPSETGVEGRQGVTKDSTPDGQADATDRASVICRAIRRAILERALAPGDKLPEDQLGERFGVSRTLARHALGQLASEGLVELRRNRIAVVATPSFEEARDEFDIRIELERLVVRRLAGHLSPRQLAELAEHVAAEEAARGGPETTSLRLATEFHVRLAEMTGRPTLSRYVRETAYRSCLSLATFGRPHSSECAISEHREVLTALEAGDETSAAELMAHHLDQVAQRALLKAPEARGDLMEILAPYAETDVPAPRRRRKQAAEG
>NZ_CP006369.1|WP_082639890.1|18821_20042_-|glycosyltransferase-family-4-protein
MRIDAVAGANGRSIVVIGDLVEGWPPHDLGAQELDRLALDGLEPPQPAPETETPPPVIGGYLERLPLSCVAAGLAAQVEIWHFARSQDLPPTRHESPWLTRRVFRLDREGAPFSSTHMLRHIERFGAPAILVVLGLGVDERVLDACETSFKVYNSIDAPSLRVPPDVSRHFDLVLTGAEWQSAEVEARHPGMATAVMPIGPEFADPETFRPLGTDKPYDVVYVAAAQGYKRHDILFDALASAPRPLRALCVFGYGEMGEALRREAHERGLQVDFVGPPGVPFAEVNALMNQARIGVVCGVDDGAPAILTEYMLAGLPVLANEKLACGLHFIRPETGRAAPAERFGEALVAMLDDLGRFRPREAVLENWIWPRTVERFGALVQRKASGACRMAASDVPLSRFAPAPD
>NZ_CP006369.1|WP_082639944.1|17447_18662_-|glycosyltransferase
MRRFARDHRVFFFEEPIGCDHPLPYLEYHPFPADGIVALRPRLPHWWNEAEREAGLRGLLAMLVEISCAGEPVLWFYTPMMFAFAGEVEAAAVVYDCMDELSGFRFADPRLTEMEAALMRRADLVFTGGWSLFDAKRTLHDNIHPFPSAVDAKHFGRARRANGAAPGDQAGLSGPIFGFYGVIDERLDLDLLRELASLRPDWSFVMLGPIAKIDPAELPRGPNLHWLGPKSYGELPHYLAGWDVALMPFAINEATRFISPTKTPEYLAGGRPVVSTAINDVIRHYGALEGVAIAGDPPAFAAACERALSLGRAGPWLGQADALLAAISWDRTQADMARLLTEAVLAARLASTRAANDEADGASAALAPYLARVAQSAEAEDEVGPGRCPGAVAAAAMLTAGSST
>NZ_CP006369.1|WP_061978333.1|14058_17433_-|glycosyltransferase
MLRVCLATDSLIPSGVGEHMLALARELAGEAEVIIAADPRSGLLERALRAGLAAIGFDAGEPETLTTALSPWRPDILHIQAGIGWEGHGLAAAGRASGARAVLRTEHLPFVLTDPEQIRDYLRSVGEVDAVLCVSDAAARTYVQAGVDPASVEVVRNGIPEPAPSRSREEAREALGLSPEAPVLLVPARLTEQKGHRVLLEALPALRAAVPGLVCLLAGDGPLRAALEAQAEAAGLLSHPEPAPEARRLVAVGAWDDAPEAGDDLDLAVRPRDALVSSSGCVRFLGHREDVADLLAAADLLVLPSRFEGLPLAVLEAMAAGRPVVATRIGGTDEAVAEGETGWLAEPGDASALSEAIGAALCDPAALRRAGAAGRVRFEAAFRASRMARETGALYRRRLAASPFPMQDVQMTRTRIGFVGAGGIAHRHLGILDGFDDVEIVGFADTDRAKAEEAALARGARAFADAAEMMDACRPDAVYICIPPFAHGAPERAAIERGIPFFVEKPVALDLGTAEAIAAEVEAKGLVTAVGYHWRYLDTVEEARGLLADNPAQLLSGYWLDSTPPPQWWWREDRSGGQVVEQATHLLDLARFLFGEVKEVYGRAGHMDREAFPGLDVATVSTASLTFESGLVANLASTCLLGWNHRVGLHIFADRLAIELTDHDIMVDVGRGRPVRGADGDPVWREDRDFVDAVAGRENRIRCPYGDAVITHRLALAVVESGRSGEVIELPLDAPPRAPLAPLQFQPRPEHHGEPHALPPGHRHIRSLGVERPGEPYHFQYEEGPPGEGQVRLDTLYTGFSAGTELTFLKNTNPYLHSRWDGGRGVFVPGEAGQHFPLPFLGYMEVARVCESRAGGFAPGEVVASTYAHKSGHTADPFHDLLVKMPASVDPMLGIYVAQMGPIAANGLLHADAELGGADVTRLGQGVAGRPVLVIGGGVVGLLVALFARRAGAAEIVVADPSPFRRERIEALGFTAMDEDGAWNHAKARWHHGGGDRGADFVFQTRADARSLHAALRALRPQGTVIDLAFYQGGAEAVRLGEEFHHNGLNIRCAQINRVPRGLGFSWNKRRLAEETIGLLTERGADIARHMITHVVPFEEAPAFLRDLVANRPDFLQIVFKVAD
>NZ_CP006369.1|WP_061978341.1|29897_31409_-|esterase-like-activity-of-phytase-family-protein
MRIRRLTALFLAAAAFAGAARAEPVAYPKASVSEAPGEETAVLNGETFVNHGLVAAARVPAANLDFLGDTLGSFSAMLIEPGSWQKTAEGYTARLRTLPDRGYNEPDKGFFSDYQGRLVDFDLSLKLDGKAGTLSVTPTGTGTPLTGFDGKPTTGADPASHTMTENGHVLPSPAEGALGAGRLSLDAEGVARRADGRIYVSDEYAADIYLFAADGRLEGIIDPSPAIVPMTDGRIDDNSLKAPDTGRRNNQGLEALSISPDGKTLFAVLQSGAVQDSSASKNQANRATTRVYVYDISADALPKAPKAVYALELPVYSKKGNGEIDATAALSEMAALSDHQFLLLTRDGNGWGCGCKNPEMVKQILVVDTAGATNLAGTDFETTTKPIAPKVGERNVLDPAITPVKSAVLVNMLNPVQLARVGLNIDNEKADAKTLSEKWEALALAPARDPNAPNDVFLFVGNDNDFLTTKGVMQGKSYDAGLDNDSMVLAYRLTLPETVKLGW
>NZ_CP006369.1|WP_082639895.1|31964_32105_+|DUF1127-domain-containing-protein
MTLARLFEDKTQFRPNARELNRMTARELSDIGMSRFDMPTARRTAR
>NZ_CP006369.1|WP_061978680.1|32278_34870_-|response-regulator
MGRRVRETDWSASALGAYESWPQSLRSSLSLVLNAKGIAALYWGPEQWLLYNDAYGAALGDRHPLAFGRPMPEVLTDIAPVLGPQVAEVLRTGAGFAIENLAMTMRRHDRDELTAWTYSFSPVQGEDGGFAGVLLLATEVTDQARIGIRRDALIALGNVFRDVENADELAAGANAILGRALGVSRVGYDTIDPESEVLRVRREWNAPGIEGLAPDIHLRSYGSYVEDLKRGETNVIPDARLDPRTADAADQLKALSVQAFVNVPLVEQGRLVALLYVNDVHARAWPEEDLDLIREFAMRLRIAVERASAAQALRDSEALSRENVQRVQLALSAGAIIGTWLWDLPSDRFTVDEAFAKAFGLDPALGREGLSLAQVVSTVHPDDQEALAAAIGEAVARGGAYAHQYRTRRADGNYYWLEANGRVEHGPDGTPLNFPGVLIDIEERRAIEAERERVTEMLRNLTETLEQRVADKTAELMLSEEALRQSQKMEAVGQLTGGLAHDFNNLLAGICGSLDMMQTRIAQGRFGEIDRYMTAAQGAAKRAAALTHRLLAFSRRQTLEPKPSDVDRIVAGMEEMVRRTVGPAIAVEVHGTAGLWPVLVDPNQLENALLNLCINARDAMPHGGRLVLETANRTIAERAALVRDMPPGDYASLTVSDNGVGMAPEIMERVFEPFFTTKPIGLGTGLGLSMIYGFAKQSGGEVRLHSQVGEGTSVTIFLPRHAVAEADARVPEPEPASPRTGAGETVLVIDDEPLVRMLVVDVLEDLGYSAIEAADGPEGLEILRSGIGVDLLVTDVGLPKGMNGRQVADAARALRPGLKVLFVTGYAETAVLSHGHLESGMQVVTKPFDLTVLARRIKDLINS
>NZ_CP006369.1|WP_061978342.1|35143_36460_-|cation:proton-antiporter
MSLPFSWSPDPYILVLTGAGVLIALVAWLPLALRRLPLSLPIVCIGLGALIFSLPQVTLRPLPLHHPELVERFSEFVVIIALMGAGLKIDRVFGFRRWSVAWRLIGITMPLGIAAITMLAGWWIGLSWTLALLLGAALAPTDPVLAADVQVGPPKSGEEDEVRFGLTSEAGLNDGFAFPFVHLAIALAAASTTGEPWFAHWLSLNVVWEIGAGVAGGYAIGKLFGWLTFHVPAKTKLAKTGDGLIALSATFVSYGVTELIHCYGFLAVFVTALTFRHAHRDHDFQRDMHALTEQIERIAMMVLLILFGGALVSGLLAPLRWVDVAAVLAILLVIRPLTGLLGLLGHPADGRERLTLAFFGIRGVGSIYYLAYGLNHIEGVQDGERLWAIVGLVILVSILMHGLTVTPIMRRLDRTHGRDPDTGQATPPPGLQGPATER
>NZ_CP006369.1|WP_061978343.1|36813_38898_-|MCP-four-helix-bundle-domain-containing-protein
MRLTIKLKLATAFAGVLALMGGTGYYGLHGLQLSNENMQTFVSRPYAQTKRVEDAARGMQNIGRSVNRMLASKDDSEMAEVRASIEKGLADELSIMKGYRDALTPDAVGTPATADAVLAAIQTWQGMVNKTMDLIQENTTTRANELFAQKAVPLVDELTEDFRLARERIRTEGSNDRLRDAASAARLGLPQMMYRLKVATGEPDKARGAAAFDVFQTSFKAFDEGMNAYLAAAEDTPLAADAKEQMGNWADLKPLVEKIGALGMTKSVESANTLYSGEGRPFLLATIKQMDELIAAETKVAEGLASDTQDQYGTTRLTMLVLIGLGLLLGTGAALWLALSISRGLNLAMHHARKIGGGDISERIRVRQNDEIGDLLTTICQMRVKLNETVISIRESAHQVASGSSQSAATAEQLSAGSSQQAAASEEASAAVEEMTANVRQNADNAGTTEKIARQASESAEKTGVAVGASVEAMRIIAEKISVVQEIARQTDLLALNAAIEAARAGQHGKGFAVVASEVRKLAERSQSAAQEIGQLSAQTLVTSEEAGRMLDALVPDIQKTAELVSEISAACREQSVGIEQINQAIQQLDQVTQSNAGAANEMAATAGQLSSEVQRLEATTSFFKLENGIGSKPAAVARQAKVEALRANVQAFGAAHGKRAPVAAKQAPAPAPRSDGGFDMDLDSDKGFERLSA
>NZ_CP006369.1|WP_148640204.1|39151_39658_-|MarR-family-transcriptional-regulator
MHSLSSQSPEILLWFLLIETALALRQVTERHLKGGSVSLTPGEIRTLDYVMRHQSTRQVVLAERMGIEPMTLSVYLDRLESFGLIERKKDPGDRRLKLVEPTDNAAKVVADLEPTLTEIYQAMAKGIDREDLVRITAGLTMIRANLAKCPDVTPTAAPIVAKVSAKRD
>NZ_CP006369.1|WP_082639946.1|40106_41603_-|glutamate-1-semialdehyde-2,1-aminomutase
MSGLPLSAIPWGPEPCRTWHGKCRGWIRPARPPTIRRRQDERAKPPGPLRRTALNIALKLQRRTDTSASLFASAQEVIPGGVNSTARATWSGWEPYPLFVTSGSGSHVIDADGNDYVDYLLGLGPMILGHRPPRVTRAVVEQIENVGTVFALPAAAEADLARKIIAAVPSVESVRLSNTGTEGVLYATRLARAYTGRRKIVRFEGMYHGFSDGVYWSKHPKIETAGPDARPVPVPQGPGLPKGVEENLIILPWNDAEALRSVIAEQGHEIAAVLTEPMMCNTGCILPLPGYLEAMREMTAEAGIVLIFDEVITGFRLGLAGAQGVFGITPDLSVFAKGLGGGFPVAAVGGRREIMDLVSDGTVSLAGTYTANGIAVAAANATLDELNEPGAYERLYAVSDRLRHGLEEIFKASGLPAHVVGLGPVLQVWFSDAPIHNYRDAERHADQDMFRRWWLGMIERGILFHPGAYENLFVSFAHSDLDVDTTLAAAREVVATLS
>NZ_CP006369.1|WP_061978346.1|41874_42555_+|MtnX-like-HAD-IB-family-phosphatase
MGFDILCDFDGTISRSDVTDLLLERLAVPGWEAVEASWERGEIGSRECMARQVALIDASAEELDAVLEEVEIDPGFPAFLGAALKLGARVSVVSDGIDYAIRRVLARHGVRGLPVLANRLVATGERSYRLEHPHAEAGCASGAGTCKCAVAGHQATSRRILIGDGRSDFCGSGAVELVLAKGALASHCEDLGRRHVAFTSFDELTAQLAQIVDLLPPLERRATEAA
>NZ_CP006369.1|WP_061978347.1|42554_43490_+|hypothetical-protein
MRRAPMRLLDLDGSLPDQAPLAERLRDGRAERIDLKALGNPLRLWSSGRDWRRLEAALATSERGGPAPFLTLFGSGDYHHVSAALIARAPGPLSVVHFDNHPDWCRCFPARHCGGWVNMALAQDHVQRVVTIGPCADDLHRPDRKGANLEALSDGRHQVFAWRRAPTPTRKSVSDGPGHRVRSGEIHWRNVEAENFTCFMDELIASLPPGRVWITVDKDVLAPSEAVTNWDQGQMPLARVIEAIGMIGQAREIVGADICGDHAPARHRHPMKLTEAWMDQPRGGPPGGPDVALACNGEANRRLVEALEAFA
>NZ_CP006369.1|WP_061978348.1|43486_43864_+|EamA-family-transporter
MSGLAAPLVLGLTVILDVGGQILFKTGLDGSDETDTAQHEKVGLVRRVLGSPQIAAGVGLYAVEFVAWLFVLSHMDLSVAFPIATLSYVGVVLASRLFLGEAVPPRRWMSTLLIAAGAALVGVSA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP006369_1	1.1\|28598\|23\|NZ_CP006369\|CRT	28598-28620	23	NZ_CP006369	Aureimonas sp. AU20 plasmid pAU20b, complete sequence	28598-28620	0	1.0
NZ_CP006369_1	1.2\|28640\|23\|NZ_CP006369\|CRT	28640-28662	23	NZ_CP006369	Aureimonas sp. AU20 plasmid pAU20b, complete sequence	28640-28662	0	1.0
NZ_CP006369_1	1.3\|28682\|23\|NZ_CP006369\|CRT	28682-28704	23	NZ_CP006369	Aureimonas sp. AU20 plasmid pAU20b, complete sequence	28682-28704	0	1.0
NZ_CP006369_1	1.1\|28598\|23\|NZ_CP006369\|CRT	28598-28620	23	NZ_CP013600	Rhizobium sp. N741 plasmid pRspN741e, complete sequence	436946-436968	2	0.913
NZ_CP006369_1	1.1\|28598\|23\|NZ_CP006369\|CRT	28598-28620	23	NZ_CP013504	Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence	436946-436968	2	0.913
NZ_CP006369_1	1.1\|28598\|23\|NZ_CP006369\|CRT	28598-28620	23	NZ_CP013510	Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence	435387-435409	2	0.913
NZ_CP006369_1	1.1\|28598\|23\|NZ_CP006369\|CRT	28598-28620	23	NZ_CP013521	Rhizobium sp. N113 plasmid pRspN113d, complete sequence	439634-439656	2	0.913
NZ_CP006369_1	1.1\|28598\|23\|NZ_CP006369\|CRT	28598-28620	23	NZ_CP013494	Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence	433753-433775	2	0.913
NZ_CP006369_1	1.1\|28598\|23\|NZ_CP006369\|CRT	28598-28620	23	NZ_CP013594	Rhizobium sp. N871 plasmid pRspN871d, complete sequence	436946-436968	2	0.913
NZ_CP006369_1	1.3\|28682\|23\|NZ_CP006369\|CRT	28682-28704	23	NZ_CP033873	Caulobacter sp. FWC26 plasmid p1, complete sequence	1236-1258	2	0.913
NZ_CP006369_1	1.3\|28682\|23\|NZ_CP006369\|CRT	28682-28704	23	MF377442	Arthrobacter phage Franzy, complete genome	14610-14632	2	0.913
NZ_CP006369_1	1.3\|28682\|23\|NZ_CP006369\|CRT	28682-28704	23	NC_041930	Arthrobacter phage Brent, complete genome	14610-14632	2	0.913
NZ_CP006369_1	1.2\|28640\|23\|NZ_CP006369\|CRT	28640-28662	23	NC_017327	Sinorhizobium meliloti SM11 plasmid pSmeSM11c, complete sequence	665073-665095	3	0.87
NZ_CP006369_1	1.2\|28640\|23\|NZ_CP006369\|CRT	28640-28662	23	NC_017324	Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence	1332133-1332155	3	0.87
NZ_CP006369_1	1.2\|28640\|23\|NZ_CP006369\|CRT	28640-28662	23	NZ_CP009145	Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence	678934-678956	3	0.87
NZ_CP006369_1	1.2\|28640\|23\|NZ_CP006369\|CRT	28640-28662	23	NZ_CP021801	Sinorhizobium meliloti strain USDA1021 plasmid psymA, complete sequence	605218-605240	3	0.87
NZ_CP006369_1	1.2\|28640\|23\|NZ_CP006369\|CRT	28640-28662	23	NZ_CP021824	Sinorhizobium meliloti strain KH46 plasmid psymA, complete sequence	556651-556673	3	0.87
NZ_CP006369_1	1.2\|28640\|23\|NZ_CP006369\|CRT	28640-28662	23	NC_018683	Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence	1125771-1125793	3	0.87
NZ_CP006369_1	1.2\|28640\|23\|NZ_CP006369\|CRT	28640-28662	23	NZ_CP021794	Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence	1173556-1173578	3	0.87
NZ_CP006369_1	1.2\|28640\|23\|NZ_CP006369\|CRT	28640-28662	23	NZ_CP021809	Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence	1061413-1061435	3	0.87
NZ_CP006369_1	1.2\|28640\|23\|NZ_CP006369\|CRT	28640-28662	23	NZ_CP021217	Sinorhizobium meliloti RU11/001 plasmid pSymA, complete sequence	250785-250807	3	0.87
NZ_CP006369_1	1.2\|28640\|23\|NZ_CP006369\|CRT	28640-28662	23	NZ_CP026526	Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence	1211966-1211988	3	0.87
NZ_CP006369_1	1.3\|28682\|23\|NZ_CP006369\|CRT	28682-28704	23	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3496854-3496876	3	0.87

1. spacer 1.1|28598|23|NZ_CP006369|CRT matches to NZ_CP006369 (Aureimonas sp. AU20 plasmid pAU20b, complete sequence) position: , mismatch: 0, identity: 1.0

agctggggcagggaacggtcgag	CRISPR spacer
agctggggcagggaacggtcgag	Protospacer
***********************

2. spacer 1.2|28640|23|NZ_CP006369|CRT matches to NZ_CP006369 (Aureimonas sp. AU20 plasmid pAU20b, complete sequence) position: , mismatch: 0, identity: 1.0

ttctgagccgcggcatttccgaa	CRISPR spacer
ttctgagccgcggcatttccgaa	Protospacer
***********************

3. spacer 1.3|28682|23|NZ_CP006369|CRT matches to NZ_CP006369 (Aureimonas sp. AU20 plasmid pAU20b, complete sequence) position: , mismatch: 0, identity: 1.0

ggctcagccagggcgccacggaa	CRISPR spacer
ggctcagccagggcgccacggaa	Protospacer
***********************

4. spacer 1.1|28598|23|NZ_CP006369|CRT matches to NZ_CP013600 (Rhizobium sp. N741 plasmid pRspN741e, complete sequence) position: , mismatch: 2, identity: 0.913

agctggggcagggaacggtcgag	CRISPR spacer
agcttgggcagggaaaggtcgag	Protospacer
**** ********** *******

5. spacer 1.1|28598|23|NZ_CP006369|CRT matches to NZ_CP013504 (Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence) position: , mismatch: 2, identity: 0.913

agctggggcagggaacggtcgag	CRISPR spacer
agcttgggcagggaaaggtcgag	Protospacer
**** ********** *******

6. spacer 1.1|28598|23|NZ_CP006369|CRT matches to NZ_CP013510 (Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence) position: , mismatch: 2, identity: 0.913

agctggggcagggaacggtcgag	CRISPR spacer
agcttgggcagggaaaggtcgag	Protospacer
**** ********** *******

7. spacer 1.1|28598|23|NZ_CP006369|CRT matches to NZ_CP013521 (Rhizobium sp. N113 plasmid pRspN113d, complete sequence) position: , mismatch: 2, identity: 0.913

agctggggcagggaacggtcgag	CRISPR spacer
agcttgggcagggaaaggtcgag	Protospacer
**** ********** *******

8. spacer 1.1|28598|23|NZ_CP006369|CRT matches to NZ_CP013494 (Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence) position: , mismatch: 2, identity: 0.913

agctggggcagggaacggtcgag	CRISPR spacer
agcttgggcagggaaaggtcgag	Protospacer
**** ********** *******

9. spacer 1.1|28598|23|NZ_CP006369|CRT matches to NZ_CP013594 (Rhizobium sp. N871 plasmid pRspN871d, complete sequence) position: , mismatch: 2, identity: 0.913

agctggggcagggaacggtcgag	CRISPR spacer
agcttgggcagggaaaggtcgag	Protospacer
**** ********** *******

10. spacer 1.3|28682|23|NZ_CP006369|CRT matches to NZ_CP033873 (Caulobacter sp. FWC26 plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.913

ggctcagccagggcgccacggaa	CRISPR spacer
ggctcggccagggcgccatggaa	Protospacer
*****.************.****

11. spacer 1.3|28682|23|NZ_CP006369|CRT matches to MF377442 (Arthrobacter phage Franzy, complete genome) position: , mismatch: 2, identity: 0.913

ggctcagccagggcgccacggaa	CRISPR spacer
ggctcggccatggcgccacggaa	Protospacer
*****.**** ************

12. spacer 1.3|28682|23|NZ_CP006369|CRT matches to NC_041930 (Arthrobacter phage Brent, complete genome) position: , mismatch: 2, identity: 0.913

ggctcagccagggcgccacggaa	CRISPR spacer
ggctcggccatggcgccacggaa	Protospacer
*****.**** ************

13. spacer 1.2|28640|23|NZ_CP006369|CRT matches to NC_017327 (Sinorhizobium meliloti SM11 plasmid pSmeSM11c, complete sequence) position: , mismatch: 3, identity: 0.87

ttctgagccgcggcatttccgaa	CRISPR spacer
ttctgcgccgcggcatttccgct	Protospacer
***** ***************

14. spacer 1.2|28640|23|NZ_CP006369|CRT matches to NC_017324 (Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence) position: , mismatch: 3, identity: 0.87

ttctgagccgcggcatttccgaa	CRISPR spacer
ttctgcgccgcggcatttccgct	Protospacer
***** ***************

15. spacer 1.2|28640|23|NZ_CP006369|CRT matches to NZ_CP009145 (Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence) position: , mismatch: 3, identity: 0.87

ttctgagccgcggcatttccgaa	CRISPR spacer
ttctgcgccgcggcatttccgct	Protospacer
***** ***************

16. spacer 1.2|28640|23|NZ_CP006369|CRT matches to NZ_CP021801 (Sinorhizobium meliloti strain USDA1021 plasmid psymA, complete sequence) position: , mismatch: 3, identity: 0.87

ttctgagccgcggcatttccgaa	CRISPR spacer
ttctgcgccgcggcatttccgct	Protospacer
***** ***************

17. spacer 1.2|28640|23|NZ_CP006369|CRT matches to NZ_CP021824 (Sinorhizobium meliloti strain KH46 plasmid psymA, complete sequence) position: , mismatch: 3, identity: 0.87

ttctgagccgcggcatttccgaa	CRISPR spacer
ttctgggccgcggcatttccgct	Protospacer
*****.***************

18. spacer 1.2|28640|23|NZ_CP006369|CRT matches to NC_018683 (Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence) position: , mismatch: 3, identity: 0.87

ttctgagccgcggcatttccgaa	CRISPR spacer
ttctgggccgcggcatttccgct	Protospacer
*****.***************

19. spacer 1.2|28640|23|NZ_CP006369|CRT matches to NZ_CP021794 (Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence) position: , mismatch: 3, identity: 0.87

ttctgagccgcggcatttccgaa	CRISPR spacer
ttctgcgccgcggcatttccgct	Protospacer
***** ***************

20. spacer 1.2|28640|23|NZ_CP006369|CRT matches to NZ_CP021809 (Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence) position: , mismatch: 3, identity: 0.87

ttctgagccgcggcatttccgaa	CRISPR spacer
ttctgggccgcggcatttccgct	Protospacer
*****.***************

21. spacer 1.2|28640|23|NZ_CP006369|CRT matches to NZ_CP021217 (Sinorhizobium meliloti RU11/001 plasmid pSymA, complete sequence) position: , mismatch: 3, identity: 0.87

ttctgagccgcggcatttccgaa	CRISPR spacer
ttctgcgccgcggcatttccgct	Protospacer
***** ***************

22. spacer 1.2|28640|23|NZ_CP006369|CRT matches to NZ_CP026526 (Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence) position: , mismatch: 3, identity: 0.87

ttctgagccgcggcatttccgaa	CRISPR spacer
ttctgggccgcggcatttccgct	Protospacer
*****.***************

23. spacer 1.3|28682|23|NZ_CP006369|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 3, identity: 0.87

ggctcagccagggcgccacggaa	CRISPR spacer
ggctcaggcagggcgccacggcc	Protospacer
******* *************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP006371

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP006368

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP006367

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP006369

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection