CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP013103	Paraburkholderia caribensis strain MWAP64 chromosome 2, complete sequence	2 crisprs	csa3,WYL,cas3,DinG	1	1	0
NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	1 crisprs	csa3,cas3	0	1	136
NZ_CP013105	Paraburkholderia caribensis strain MWAP64 plasmid 2, complete sequence	0 crisprs	NA	0	0	1
NZ_CP013102	Paraburkholderia caribensis strain MWAP64 chromosome 1, complete sequence	4 crisprs	cas3,WYL,cas14j,c2c9_V-U4,PD-DExK,RT,DinG,DEDDh,csa3	0	3	5

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013103_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013103_1

537362-537443

Orphan

Consensus_repeat	Method
GCTTTAGGCGTCGCCCCTGTGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013103_1

>merge|NZ_CP013103|1|537362-537443|CRISPRCasFinder
GCTTTAGGCGTCGCCCCTGTGCGTTTGCCTTTTCGCTGGCGTCCGCGAATTGTTAGCGTGCTTCAGGCGTCGCCCCTGTGCG

>NZ_CP013103|1|1|537362-537443|CRISPRCasFinder
GCTTTAGGCGTCGCCCCTGTGCG	TTTGCCTTTTCGCTGGCGTCCGCGAATTGTTAGCGT
GCTTCAGGCGTCGCCCCTGTGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013103.1\|WP_082670455.1\|544079_545735_+\|nodulation-protein-NfeD	unknown	unknown	gnl\|CDD\|223961
NZ_CP013103.1\|WP_054932523.1\|547440_548742_+\|NCS2-family-permease	unknown	unknown	gnl\|CDD\|225161
NZ_CP013103.1\|WP_060603497.1\|541533_542667_-\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173847
NZ_CP013103.1\|WP_060603496.1\|538135_539665_-\|CoA-acylating-methylmalonate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143404
NZ_CP013103.1\|WP_054932528.1\|550832_551549_+\|LmbE-family-protein	unknown	unknown	gnl\|CDD\|376836
NZ_CP013103.1\|WP_036001121.1\|545731_546511_+\|slipin-family-protein	unknown	unknown	gnl\|CDD\|259808
NZ_CP013103.1\|WP_060603477.1\|527430_528354_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176117
NZ_CP013103.1\|WP_054932527.1\|549996_550584_+\|nucleotidyltransferase-family-protein	unknown	unknown	gnl\|CDD\|133025
NZ_CP013103.1\|WP_060603471.1\|525114_525894_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|378924
NZ_CP013103.1\|WP_060606855.1\|539759_541466_-\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|341278
NZ_CP013103.1\|WP_082670454.1\|533371_534385_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013103.1\|WP_060603493.1\|536363_537257_-\|3-hydroxyisobutyrate-dehydrogenase	unknown	unknown	gnl\|CDD\|130753
NZ_CP013103.1\|WP_060603487.1\|534399_535569_-\|enoyl-CoA-hydratase/isomerase-family-protein	unknown	unknown	gnl\|CDD\|379770
NZ_CP013103.1\|WP_060603480.1\|529205_531440_-\|xanthine-dehydrogenase-family-protein-molybdopterin-binding-subunit	unknown	unknown	gnl\|CDD\|224446
NZ_CP013103.1\|WP_060603474.1\|526322_527093_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP013103.1\|WP_060606858.1\|542932_543994_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378890
NZ_CP013103.1\|WP_036001118.1\|546710_546962_+\|DUF4148-domain-containing-protein	unknown	unknown	gnl\|CDD\|379321
NZ_CP013103.1\|WP_060603484.1\|532474_533011_-\|(2Fe-2S)-binding-protein	unknown	unknown	gnl\|CDD\|224991
NZ_CP013103.1\|WP_060603490.1\|535565_536363_-\|enoyl-CoA-hydratase	unknown	unknown	gnl\|CDD\|236373
NZ_CP013103.1\|WP_060603482.1\|531463_532465_-\|xanthine-dehydrogenase-family-protein-subunit-M	unknown	unknown	gnl\|CDD\|224238

Protein	Function_ID	Function_description	E-value
NZ_CP013103.1\|WP_082670455.1\|544079_545735_+\|nodulation-protein-NfeD	gnl\|CDD\|223961	COG1030, NfeD, Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones].	1.47603e-139
NZ_CP013103.1\|WP_054932523.1\|547440_548742_+\|NCS2-family-permease	gnl\|CDD\|225161	COG2252, COG2252, Xanthine/uracil/vitamin C permease [Nucleotide transport and metabolism].	4.27916e-166
NZ_CP013103.1\|WP_060603497.1\|541533_542667_-\|acyl-CoA-dehydrogenase	gnl\|CDD\|173847	cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases. Short chain acyl-CoA dehydrogenase (SCAD). SCAD is a mitochondrial beta-oxidation enzyme. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of SCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. This subgroup also contains the eukaryotic short/branched chain acyl-CoA dehydrogenase(SBCAD), the bacterial butyryl-CoA dehydorgenase(BCAD) and 2-methylbutyryl-CoA dehydrogenase, which is involved in isoleucine catabolism. These enzymes are homotetramers.	0
NZ_CP013103.1\|WP_060603496.1\|538135_539665_-\|CoA-acylating-methylmalonate-semialdehyde-dehydrogenase	gnl\|CDD\|143404	cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2. Methylmalonate semialdehyde dehydrogenase (MMSDH, EC=1.2.1.27) [acylating] from Bacillus subtilis is involved in valine metabolism and catalyses the NAD+- and CoA-dependent oxidation of methylmalonate semialdehyde into propionyl-CoA. Mitochondrial human MMSDH ALDH6A1 and Arabidopsis MMSDH ALDH6B2 are also present in this CD.	0
NZ_CP013103.1\|WP_054932528.1\|550832_551549_+\|LmbE-family-protein	gnl\|CDD\|376836	pfam02585, PIG-L, GlcNAc-PI de-N-acetylase. Members of this family are related to PIG-L an N-acetylglucosaminylphosphatidylinositol de-N-acetylase (EC:3.5.1.89) that catalyzes the second step in GPI biosynthesis.	0.000223011
NZ_CP013103.1\|WP_036001121.1\|545731_546511_+\|slipin-family-protein	gnl\|CDD\|259808	cd08826, SPFH_eoslipins_u1, Uncharacterized prokaryotic subgroup of the stomatin-like proteins (slipins) family; belonging to the SPFH (stomatin, prohibitin, flotillin, and HflK/C) superfamily. This model summarizes a subgroup of the stomatin-like protein family (SLPs or slipins) that is found in bacteria and archaebacteria. The conserved domain common to the SPFH superfamily has also been referred to as the Band 7 domain. Individual proteins of the SPFH superfamily may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Bacterial and archaebacterial SLPs remain uncharacterized. This subgroup contains PH1511 from the hyperthermophilic archaeon Pyrococcus horikoshi.	3.09316e-108
NZ_CP013103.1\|WP_060603477.1\|527430_528354_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176117	cd08426, PBP2_LTTR_like_5, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor. The genes controlled by the LTTRs have diverse functional roles including amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to a name a few. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	6.15355e-36
NZ_CP013103.1\|WP_054932527.1\|549996_550584_+\|nucleotidyltransferase-family-protein	gnl\|CDD\|133025	cd04182, GT_2_like_f, GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	2.00058e-54
NZ_CP013103.1\|WP_060606855.1\|539759_541466_-\|AMP-binding-protein	gnl\|CDD\|341278	cd05974, MACS_like_1, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS). MACS catalyzes the two-step activation of medium chain fatty acids (containing 4-12 carbons). The carboxylate substrate first reacts with ATP to form an acyl-adenylate intermediate, which then reacts with CoA to produce an acyl-CoA ester. MACS enzymes are localized to mitochondria.	0
NZ_CP013103.1\|WP_060603493.1\|536363_537257_-\|3-hydroxyisobutyrate-dehydrogenase	gnl\|CDD\|130753	TIGR01692, 3-hydroxyisobutyrate_dehydrogenase_mitochondrial, 3-hydroxyisobutyrate dehydrogenase. 3-hydroxyisobutyrate dehydrogenase is an enzyme that catalyzes the NAD+-dependent oxidation of 3-hydroxyisobutyrate to methylmalonate semialdehyde of the valine catabolism pathway. In Pseudomonas aeruginosa, 3-hydroxyisobutyrate dehydrogenase (mmsB) is co-induced with methylmalonate-semialdehyde dehydrogenase (mmsA) when grown on medium containing valine as the sole carbon source. The positive transcriptional regulator of this operon (mmsR) is located upstream of these genes and has been identified as a member of the XylS/AraC family of transcriptional regulators. 3-hydroxyisobutyrate dehydrogenase shares high sequence homology to the characterized 3-hydroxyisobutyrate dehydrogenase from rat liver with conservation of proposed NAD+ binding residues at the N-terminus (G-8,10,13,24 and D-31). This enzyme belongs to the 3-hydroxyacid dehydrogenase family, sharing a common evolutionary origin and enzymatic mechanism with 6-phosphogluconate. HIBADH exhibits sequence similarity to the NAD binding domain of 6-phosphogluconate dehydrogenase above trusted (pfam03446). [Energy metabolism, Amino acids and amines].	4.87137e-149
NZ_CP013103.1\|WP_060603471.1\|525114_525894_+\|alpha/beta-hydrolase	gnl\|CDD\|378924	pfam12697, Abhydrolase_6, Alpha/beta hydrolase family. This family contains alpha/beta hydrolase enzymes of diverse specificity.	2.15298e-14
NZ_CP013103.1\|WP_060603480.1\|529205_531440_-\|xanthine-dehydrogenase-family-protein-molybdopterin-binding-subunit	gnl\|CDD\|224446	COG1529, CoxL, Aerobic-type carbon monoxide dehydrogenase, large subunit CoxL/CutL homologs [Energy production and conversion].	7.54349e-178
NZ_CP013103.1\|WP_060603474.1\|526322_527093_-\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	2.81953e-71
NZ_CP013103.1\|WP_060606858.1\|542932_543994_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|378890	pfam12625, Arabinose_bd, Arabinose-binding domain of AraC transcription regulator, N-term. AraC is a bacterial transcriptional regulatory protein with a DNA-binding domain at the C-terminus, HTH_AraC, pfam00165, and this dimerization domain which harbours the arabinose-binding pocket at the N-terminus. AraC positively and negatively regulates expression of the proteins required for the uptake and catabolism of the sugar L-arabinose 1,2,3].	4.38359e-36
NZ_CP013103.1\|WP_036001118.1\|546710_546962_+\|DUF4148-domain-containing-protein	gnl\|CDD\|379321	pfam13663, DUF4148, Domain of unknown function (DUF4148).	6.18806e-10
NZ_CP013103.1\|WP_060603484.1\|532474_533011_-\|(2Fe-2S)-binding-protein	gnl\|CDD\|224991	COG2080, CoxS, Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion].	4.30745e-82
NZ_CP013103.1\|WP_060603490.1\|535565_536363_-\|enoyl-CoA-hydratase	gnl\|CDD\|236373	PRK09076, PRK09076, enoyl-CoA hydratase; Provisional.	6.97348e-174
NZ_CP013103.1\|WP_060603482.1\|531463_532465_-\|xanthine-dehydrogenase-family-protein-subunit-M	gnl\|CDD\|224238	COG1319, CoxM, Aerobic-type carbon monoxide dehydrogenase, middle subunit CoxM/CutM homologs [Energy production and conversion].	6.5176e-70
NZ_CP013103.1\|WP_060603487.1\|534399_535569_-\|enoyl-CoA-hydratase/isomerase-family-protein	gnl\|CDD\|379770	pfam16113, ECH_2, Enoyl-CoA hydratase/isomerase. This family contains a diverse set of enzymes including: enoyl-CoA hydratase, napthoate synthase, carnitate racemase, 3-hydroxybutyryl-CoA dehydratase and dodecanoyl-CoA delta-isomerase. This family differs from pfam00378 in the structure of it's C-terminus.	4.44349e-150

>NZ_CP013103.1|WP_060603493.1|536363_537257_-|3-hydroxyisobutyrate-dehydrogenase
MKIGFIGLGNMGAPMALNLLKAGHTVTVFDLNPHAVQSLTEAGATAKRTPKEASTDVEYVITMLPAAAHVKAVLTGEEGILAGIAKNVTIIDSSTIDPASVKAFAALATQNGNTFVDAPVSGGTGGATAGTLTFMVGSTAETYEQVKPVLSAMGKNIVHCGETSTGQVAKICNNLVLGITMAGVSEAMALGEKLGIDPQVLGKIINTSTGRCWSSDTYNPFPGVIDTAPSTRGYTGGFGTDLMLKDLGLATDAAKLARQPVYLGALAQQLYQTMSTNGAGKLDFSAVIKLYRKDGDA
>NZ_CP013103.1|WP_060603490.1|535565_536363_-|enoyl-CoA-hydratase
MIELDYAHDGSVALLTLKRPPANAFTPDGLLQLQHTIERLNGDAQVRAIVITGDGPKFFSAGADLNTFADGNKEIARQAASRFGSAFEALQNARPVVIAAINGYAMGGGLECALACDIRIAEQHAVMALPETAVGLLPCGCGTQTLPWLVGEGWAKRIVLTGERVDTATALRIGLVEEVVEKGAAREFALQMAARVAGLSPQAVTFSKDLIQQARNGVPRTAALAVERERFVDLFDGADQREGVNAFLEKRAPQWQGVQSKESQR
>NZ_CP013103.1|WP_060603487.1|534399_535569_-|enoyl-CoA-hydratase/isomerase-family-protein
MNAVLNEASAHEPDVLFRVVNRVAIVTLNRPAALNALSHEMVRELAVLVERCRTDSEIVAIVLRGAGAKGFCAGGDVRALYGMRQRNETDWQQFFIDEYRLDYALHTFPKPVVALLDGIAMGGGMGLGQAARLRIVTERTKIAMPETRIGFLPDVGATRFLSVMPAEIELYVGLTGVTLTGAEALCFQLADLCVPSEWLDTFEERLLRIATADVAADELLRALRTVFEPPCNIVPHAGLGAFTQLILRHFDRRSGVERIVATLRQDLEREHVPQMGQREVRQWLQATYDALTSHSPTMLYVTRDALLRGRQMTLAECFRMELGIVTRAIEEGDFSEGVRAHLVDKDRKPRWAPATLAEVRPERVRHFLSSPWRTQAHPLADLGVEQALA
>NZ_CP013103.1|WP_082670454.1|533371_534385_+|hypothetical-protein
MTVKNMKRKRRRRLKPLLLMGAACALLSARSASAQEIALYGGWLRGAGTNTYSWAIDYTEGFGRYLAGSITWLNEGHMPDHHRDGQAVQIWGRLPLAQNRFVIAVGVGPYRYFDTEAAEQGQGYSNTHGWGGLFSARATWYTSRRWTTSLQLNRVQVSNGPSTTAVLLGAGYQLDAPDEPGPRAWALPRTHDVTNNEVTVLVGQTILNSLESQTSIAESIEYRRGLTHWLDGTFGYLHEGGGLKARRDGLTAQLWLTRAFLDDQLTLGIGAGAYAAIHHGEDPDERSTGDGILSGLVSVSASYRFTQHWAARVTWNRVVTRYSRDTDVLMGGIGYRF
>NZ_CP013103.1|WP_060603484.1|532474_533011_-|(2Fe-2S)-binding-protein
MPHTIARPEVTPPGDTPHAQPSSSVTIPVELNVNGTAYALALDPRTTLLDALREHLHLTGTKKGCDHGQCGACTVHVNGRRENACLSFAATHEGDTITTIEGIGEPDALHPMQAAFVECDGYQCGYCTSGQIMSAVALLDEAIGPDDADVREAMSGNLCRCGAYQNIVTAIQTVRGKR
>NZ_CP013103.1|WP_060603482.1|531463_532465_-|xanthine-dehydrogenase-family-protein-subunit-M
MELFQLSRANDVRDAIVAGAASQTAQQGAQVRFLAGGTTLLDLMKLDVEKPARVVDIRRLPLDRVEVTDDGGVKIGALVRNADLALHPLIHEPYAVLSQALLAGASAQLRNMATTGGNLLQRTRCVYFRDTAMPCNKRAPGSGCAAITGFNRTMAILGTSDACIATNPSDMNVALAALGATVQIQGTKGARSVPIDDFYLLPGDTPERETVLEPGDLVTHVTLPPIPGSRSLYLKLRDRASYEFALASAAVVVNVVDGRITRARVALGGVGTKPWHAREAEAELAGAVPDAASFARAADAALANAKAQSQNGFKIELSRRCLIHALTQVMQSV
>NZ_CP013103.1|WP_060603480.1|529205_531440_-|xanthine-dehydrogenase-family-protein-molybdopterin-binding-subunit
MSTVSDSLLSVIGQPQSRVDGPLKVSGRAQYTSDIDLPDMLYAVPVCATIASGRVTSLEFAAAQAMPGVRVILHRGNIGRFYRISGNSMETGFVDEARPPFDDDVIRYYGQYVAAVVAETFEAASNAAAAVKVGYDRTAHDVSDELEAKGEPHVQSERGDAASAFEAGEVTLDETYVTPVETHNPIELHATVAQWDGEGYTFYETTQAVSNHQGTLMQMLGLPKEKVRVISRYLGSGFGGKLWMWPHSLLAAAASRHTGQPVKLVVSRKMMFQNVGHRPTTQQRMRLSADRSGKLTSLRHDYLNHTAMADDYEESCGEITPFLYSVPNLRVTSGLVRRNVGSPTAMRGPGAVPGLYALESAMNELARKLDIDPVEFRLRNEPKVDESTGLPFSSRHFVECLTTGAEKFGWAQRTAEVGSMTRDGLTLGWGVGACGWPGLRFSAEASVDLRADGTARVVCGTQDIGTGTYTILAQLVAGHTGIPLDKIEVVLGDTMLPVGPISGGSAATASVIPAVLQAARAATEMVLARAAAVDESPFKGVDKDSLAFGAGRVHRKTEAAEKGVPFAQILQAAKMHAASGKGSAQGGFDDPLKKHYSIYSYGAHFAEVTWQPETARLRVNRVVTVIDAGRILNPRAGRNQIEGAVVMGVGMALFEHTMYDAQSGAPINSNLADYIVASHADTPALDVTFLDYPDPVFNELGARGIAEIGLAGVAAAITDAVHHATGVRVRRLPVMIEDLLLGSM
>NZ_CP013103.1|WP_060603477.1|527430_528354_+|LysR-family-transcriptional-regulator
MRTINHQRLRYFYAVLTQGSIRGAADDMNTSPSVITRQIRLLEEELGVTLFERGARGARPTEPAAHLLEFWEGCQSQQEKLEDQLHAFRGLRHGRVQLAVSEGFVDTLTEEVLAPFCAKYPALTIEMSMLARDGIVEEVAESRAHIGLAYNPPPHPRLQCLASSVQRAVLLLRREHPLAMRKRAATIDDLRAFPLAMMPQTFGIGHAVKMLEIAEGMQIEPAMTTNSLAVLKRMVAVENFVTLIGEFAARREVASGELTTVPVDHPVLQSTHARLLVKTSRLLSPGPMELLDWIRRRLSVFGDGVHG
>NZ_CP013103.1|WP_060603474.1|526322_527093_-|response-regulator-transcription-factor
MKKLEHVLIVDDDSETRELVAIHLQRNGMRVSRASSGREMRAALGRDTPDLIVLELRLPDTDGLSLCRELRAGEFHAIPVVMLSARHDEADRIVALELGADDYMSKPFAIRELLARIRAVLRRTNMLPPGMRVAEAATVLRFGEWRLDTAARRLLDPEGTVVALSGAEYRLLRVFLDHPNRVLTRDQLLNLTQGRHADLLDRSIDLLVSRVRQRLHDGVRDGRYIKTLRNEGYLFSATVMRVESDVAHAPAMTCIA
>NZ_CP013103.1|WP_060603471.1|525114_525894_+|alpha/beta-hydrolase
MTRSFRAILAFATMLCGLFALQTADAATPADLKGTNIVLVHGAFADGSSWNRVIPLLEAYGLHVVPVQNPLSSLADDVAATKRVIDQQTGPVVLVGHSWGGVVISQAGNDDKVKSLVYVAAFAPDANQSIADITQGMKPPAWANELRKDSARYLTLSDKAVRDDFALDLPAGQQRIVAATQGPWFSGCANDKVTQAAWHEKPSYFVIPGRDKMIDPHLQAKMATQIHAQVTRVDASHVAMLSQPEAVANAIIAAARHAH
>NZ_CP013103.1|WP_060603496.1|538135_539665_-|CoA-acylating-methylmalonate-semialdehyde-dehydrogenase
MSAIPSTLADRKVDTVKLLINGEFVESSATEWRDIVNPATQEVLARVPFATKAEVDAAIRSAHAAFATWKNTPIGARMRIMLKYQALIREHMPRIAKTLTAEQGKTLPDAEGDIFRGLEVVEHACSIGTLQQGEFAENVAGSVDTYTLRQPIGVCAGITPFNFPAMIPLWMFPMAIVCGNTFVLKPSEQDPLSTMQLVELAIEAGVPKGVLNVVHGGKEVVDGLCTHDLVKAISFVGSTAVGTHVYNLGSQHGKRVQSMMGAKNHAVVLPDANREQTLNALVGAGFGAAGQRCMATSVVVLVGASKEWLPELVAKARTLKVNAGHEAGTDIGPVVSRSAKERILGLIEAGVKEGATLALDGRGVDVPGYEAGNFIGPTVFSDVSVEMDVYKTEIFGPVLCVMSVPTLDDAIALVNSNPMGNGVGLFTQSGAAARKFQSEIDVGQVGINIPIPVPVPFFSFTGSRGSKLGDLGPYGKQVVQFYTQTKTVTARWFDDVTVSDGVNTTISLR
>NZ_CP013103.1|WP_060606855.1|539759_541466_-|AMP-binding-protein
MTAAQSFFDARDLLLRHRTDYERAYREFRWPELGEFNWALDYFDVVAKGNDNPALWIVDDPAQEGLKLSYAQMSERSSRMANFLRGLGVARGDRLLLMLPNRVELWDVMLAAMKLGAIVLPATTQLSPDDVRDRVQIGGANFVVVDSAETGKFDALDTPLQRISVGAPREGWTDIAAAYAASPVFTPDGATRAADPMLLYFTSGTTSKPKLVEHTHESYPVGHLSTMYWIGLQPGDIHWNISSPGWAKHAWSCFFAPWNAQACVFVYNFARFAPKDTLDVLVRYQVTTLCAPPTVWRMLVQEPLASYPVKLREIVGAGEPLNPEIIERVRHAWNIVIRDGYGQTETTCQIGNPPGQPVVPGSMGRPLPGYRVELVDADDHPVTEGEIALPLGSRPLGLMTGYANNAKATEHAMRNGYYHTSDVAMRRDDGYLVYVGRSDDVFKSSDYRLSPFELESVLIEHEAIAEAAVVPSNDPLRLSVPKAFVTVRHGFEAGPELARDVFRFSREKLAPYKRIRRLQFSDLPKTISGKIRRVELRRRELERTAEPARLQDEYWEEDFPELRNGNGN
>NZ_CP013103.1|WP_060603497.1|541533_542667_-|acyl-CoA-dehydrogenase
MDEFYTDEQRMIRDAARDFAVERLAPNAAQWDREGQLPADVVGQMGELGFLGMIVPPEWGGSYTDYIAYALALEEIAAGCAACATMMSVHNSVGCGPILNFGSDAQKDRYLADLATGKRIGAFCLTEPHAGSEANNIRTRAVLRDGQWVINGSKQFVTNGARASIAIVFAVTDPDAGKRGISAFIVPTDTPGFNVGRPESKLGIRASDTCPIALDDCAVPEANLLGAPGEGLRIALSNLEGGRIGIAAQAIGIARAAFDAARAYANERVQFGKALKEHQTIANMLADMATRLNAARLLVHHAARLRSAGRPCLSEASQAKLYASEMAEEICSKAIQIHGGYGYLEDYAVERHYRDARITQIYEGTSEVQRMVIARHV
>NZ_CP013103.1|WP_060606858.1|542932_543994_+|AraC-family-transcriptional-regulator
MKTERGTISVSLVEETLALARARGVDVQPIVEAAGIAPQVLASAKSRVTPAQYGALWANIARTLDDEFFGQDAHAMKSGSFIAMTQMALTARNGGQALTRAVNFMRLVLDDMCAQIVTRDDRVRLQFAHRDGAPQPAMFAYATYFILVYGLVCWLVGRRIPLIEARFRCAEPPAAHEYRLMFCDDLSFGQSESYVDLAPDFLELPVVQTTKSIKPFLRDAPASFIIKYRNPGSLAARVRKTLRALPMPAWPGSDEMAQRLHVAEATMRRHLKQEGYTYQSIKDDLRRDIAISQLQRGGQSVADIAATLGFAEPSAFHRAFRKWTGMRPADYRAVNAHAAGAGISRRAERAESD
>NZ_CP013103.1|WP_082670455.1|544079_545735_+|nodulation-protein-NfeD
MGTYRLLPIRQAGSRRTPRRTRGAFVAAAPRAAWARTPRVIPGAAARLLQRAWLLVLAFCAAAAFAHSARAAQPPVTPGSVVVIPVAGAISPATADFIVRGLARAADDRAQLAVLQLDTPGGLDTSMRQIIKAILASPVPVATYIAPGGARAASAGTYITYASHIAAMAPGTNLGAASPVQLGIGGQDAPKPGQPPGLPGATPASGPAQKDNAASGALPLDSQSTELRKQLQDAQAYIRGLAQLRGRNVEWAERAVREAVSLSARDALEQKVVDLIARDIPDLLRQLDGRTYDTAAGAKHLTTAHAPVVTLEADWRSHFLAVITDPNVALILLMIGMYGLFFEFANPGFVLPGVAGAISLLLGLFALQLLPVNYVGLGLIFLGLAFLIAEAFLPTFGTLGFGGIVAFAIGALMLIDTDVPGYGVPLPMIAAVIVFSVLFIFGVSGMVLRSRRRPVVTGAEAMIGSVGVVLDDGLVADTAPGRADGSRDGPPDSLLHGEPDRVGWARVHGERWRVRSTSPLAAGHAVRVTGRRGLMLTVVPASNPSQEGEHT
>NZ_CP013103.1|WP_036001121.1|545731_546511_+|slipin-family-protein
MIGFTFGFGSILILLAIVLIASAVRVFREYERGVVFMLGRFWKVKGPGLVLIIPVVQQVVRMDLRTVVFDVPPQDVITRDNVSVKVNAVVYFRVVDPERAVIQVARYFEATSQLSQTTLRAVLGKHELDELLSEREQLNTDIQRVLDAQTDAWGIKVSNVEIKHVDINETMIRAIARQAEAERERRAKVIHAEGELQASEKLLQAAQMLAQQPQAMTLRYLQTLTTIAADKNSTIVFPLPVDLLTAVIDRMSKPSQHMG
>NZ_CP013103.1|WP_036001118.1|546710_546962_+|DUF4148-domain-containing-protein
MKLIPRMVLGALIGVAAVSSAFAQTSRVYDQNTPKTRAEVKADLVEWRKAGYDPLDWINYPANAIAAGRVVAQRRAQAQGTQQ
>NZ_CP013103.1|WP_054932523.1|547440_548742_+|NCS2-family-permease
MDSVKRYFGFDEAGTTLRVEVLAGVTTFLTMAYIIFVNPAILGDAGMPKDSVFVATCLVAALASLIMGFYANYPIACAPGMGLNAYFAYTVVKGMGFTWQAALGAVFISGCLFLIVTLFRVREVIVNGIPHSIRVAITGGIGLFLAIISLKTAGIVTGSPATLVTLGNLHDPHVVLAIIGFFVIVMLDVLRVRGAILIGIVGVTILSFFFGGNQFHGIVSMPPSISPTLFQLDVKAALSTGVLNVILVFFLVELFDATGTLMGVANRAGLLVHGKMHRLNRALLADSTAILAGSVLGTSSTTAYIESASGVQAGGRTGVTAITVAVLFLLALFFAPLAGVVPGYATAPALLYVSCLMLREMADLPWDDATEVVPAALTALMMPFTYSIANGVAFGFISYAGLKLLTGRARQVKLVVWVIAAVFLFRFFYLGAE
>NZ_CP013103.1|WP_054932527.1|549996_550584_+|nucleotidyltransferase-family-protein
MAYASLATGVLLAAGYGSRFDPEGIHNKLLARLPDGTPVAFESAHRLLLVVPHVIAIVRPGSEMLARVLNDAGCHVIFSADAERGMGASLAAGIEASDDADGWIVALADMPRIATSSIEAVARAVDDGAPIVAPYYQGQRGHPVGFGIEHRDALLALDGDTGARALFATHPVKRIEVDDPGVLSDIDTPEDLRNV
>NZ_CP013103.1|WP_054932528.1|550832_551549_+|LmbE-family-protein
MSETSPRLFIVSPHFDDAVFGCGALLAAHPDAAVCTVFAAPPAQDMRTDWDEKAGFASAYESVHARTLEDNDALAVLDAIPLRLPFRDAQYRDSPSIGQLAAALEEAIYGSTSNTLLMPLGLFHDDHGRVFEACCEILPRMSHLEWFAYEEAIYRPMPGLVQQRLVDLAGRGIVATPASPAAGHTLDRERQALLKREAVSAYESQLRAFGPHGYDDVYAEERYWRLTVDRQGARRARH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP013103_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013103_2

2211161-2211244

Orphan

Consensus_repeat	Method
AATCGCGGATGCCAGCGCAAAAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013103_2

>merge|NZ_CP013103|2|2211161-2211244|CRISPRCasFinder
AATCGCGGATGCCAGCGCAAAACCCGGAACACCGAACGGCGAAGCATAAACCACGAAACCAAACCGCGGATGCCAGCGCAAAAC

>NZ_CP013103|2|2|2211161-2211244|CRISPRCasFinder
AATCGCGGATGCCAGCGCAAAAC	CCGGAACACCGAACGGCGAAGCATAAACCACGAAACCA
AACCGCGGATGCCAGCGCAAAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013103.1\|WP_054930762.1\|2217435_2218824_+\|L-serine-ammonia-lyase	unknown	unknown	gnl\|CDD\|273233
NZ_CP013103.1\|WP_054930775.1\|2204437_2204836_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013103.1\|WP_054930759.1\|2223404_2224055_+\|sarcosine-oxidase-subunit-gamma	unknown	unknown	gnl\|CDD\|226949
NZ_CP013103.1\|WP_054930767.1\|2211284_2212022_-\|FadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225097
NZ_CP013103.1\|WP_054930761.1\|2220119_2220419_+\|sarcosine-oxidase-subunit-delta	unknown	unknown	gnl\|CDD\|377276
NZ_CP013103.1\|WP_054930764.1\|2214383_2215868_+\|glucose-6-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|235579
NZ_CP013103.1\|WP_060605757.1\|2213248_2214166_+\|delta(1)-pyrroline-2-carboxylate-reductase-family-protein	unknown	unknown	gnl\|CDD\|235996
NZ_CP013103.1\|WP_060605751.1\|2208869_2210417_+\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|185008
NZ_CP013103.1\|WP_060605748.1\|2207738_2208689_+\|AEC-family-transporter	unknown	unknown	gnl\|CDD\|223751
NZ_CP013103.1\|WP_054930763.1\|2215980_2217066_-\|GlxA-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|227311
NZ_CP013103.1\|WP_060605745.1\|2206680_2207631_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176106
NZ_CP013103.1\|WP_060605742.1\|2205919_2206690_+\|CbtA-family-protein	unknown	unknown	gnl\|CDD\|378192
NZ_CP013103.1\|WP_035988551.1\|2203204_2203492_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013103.1\|WP_042313915.1\|2218852_2220097_+\|sarcosine-oxidase-subunit-beta-family-protein	unknown	unknown	gnl\|CDD\|273585
NZ_CP013103.1\|WP_060605739.1\|2204851_2205427_-\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366010
NZ_CP013103.1\|WP_060605758.1\|2220415_2223415_+\|sarcosine-oxidase-subunit-alpha-family-protein	unknown	unknown	gnl\|CDD\|273584
NZ_CP013103.1\|WP_060605754.1\|2212218_2213226_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|368491
NZ_CP013103.1\|WP_060607189.1\|2205673_2205898_+\|CbtB-domain-containing-protein	unknown	unknown	gnl\|CDD\|370526
NZ_CP013103.1\|WP_060605736.1\|2204005_2204224_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013103.1\|WP_007743365.1\|2202809_2203073_-\|translation-initiation-factor-IF-1	unknown	unknown	gnl\|CDD\|237102

Protein	Function_ID	Function_description	E-value
NZ_CP013103.1\|WP_054930762.1\|2217435_2218824_+\|L-serine-ammonia-lyase	gnl\|CDD\|273233	TIGR00720, hypothetical_protein_NEICINOT_00681, L-serine dehydratase, iron-sulfur-dependent, single chain form. This enzyme is also called serine deaminase and L-serine dehydratase 1. L-serine ammonia-lyase converts serine into pyruvate in the gluconeogenesis pathway from serine. This enzyme is comprised of a single chain in Escherichia coli, Mycobacterium tuberculosis, and several other species, but has separate alpha and beta chains in Bacillus subtilis and related species. The beta and alpha chains are homologous to the N-terminal and C-terminal regions, respectively, but are rather deeply branched in a UPGMA tree. This enzyme requires iron and dithiothreitol for activation in vitro, and is a predicted 4Fe-4S protein. Escherichia coli Pseudomonas aeruginosa have two copies of this protein. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	0
NZ_CP013103.1\|WP_060605757.1\|2213248_2214166_+\|delta(1)-pyrroline-2-carboxylate-reductase-family-protein	gnl\|CDD\|235996	PRK07340, PRK07340, delta(1)-pyrroline-2-carboxylate reductase family protein.	1.04803e-132
NZ_CP013103.1\|WP_054930759.1\|2223404_2224055_+\|sarcosine-oxidase-subunit-gamma	gnl\|CDD\|226949	COG4583, COG4583, Sarcosine oxidase gamma subunit [Amino acid transport and metabolism].	3.51776e-53
NZ_CP013103.1\|WP_054930767.1\|2211284_2212022_-\|FadR-family-transcriptional-regulator	gnl\|CDD\|225097	COG2186, FadR, Transcriptional regulators [Transcription].	1.21283e-37
NZ_CP013103.1\|WP_054930761.1\|2220119_2220419_+\|sarcosine-oxidase-subunit-delta	gnl\|CDD\|377276	pfam04267, SoxD, Sarcosine oxidase, delta subunit family. Sarcosine oxidase is a hetero-tetrameric enzyme that contains both covalently bound FMN and non-covalently bound FAD and NAD(+). This enzyme catalyzes the oxidative demethylation of sarcosine to yield glycine, H2O2, and 5,10-CH2-tetrahydrofolate (H4folate) in a reaction requiring H4folate and O2.	2.41059e-48
NZ_CP013103.1\|WP_060605751.1\|2208869_2210417_+\|HAMP-domain-containing-protein	gnl\|CDD\|185008	PRK15048, PRK15048, methyl-accepting chemotaxis protein II; Provisional.	4.98848e-104
NZ_CP013103.1\|WP_060605748.1\|2207738_2208689_+\|AEC-family-transporter	gnl\|CDD\|223751	COG0679, COG0679, Predicted permeases [General function prediction only].	1.42483e-46
NZ_CP013103.1\|WP_054930763.1\|2215980_2217066_-\|GlxA-family-transcriptional-regulator	gnl\|CDD\|227311	COG4977, COG4977, Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription].	1.39242e-123
NZ_CP013103.1\|WP_060605745.1\|2206680_2207631_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176106	cd08414, PBP2_LTTR_aromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LTTRs involved in degradation of aromatic compounds, such as CbnR, BenM, CatM, ClcR and TfdR, as well as that of other transcriptional regulators clustered together in phylogenetic trees, including XapR, HcaR, MprR, IlvR, BudR, AlsR, LysR, and OccR. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the substrate-binding domains from ionotropic glutamate receptors, LysR-like transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	3.90481e-61
NZ_CP013103.1\|WP_060605742.1\|2205919_2206690_+\|CbtA-family-protein	gnl\|CDD\|378192	pfam09490, CbtA, Probable cobalt transporter subunit (CbtA). This entry represents a family of proteins which have been proposed to act as cobalt transporters acting in concert with vitamin B12 biosynthesis systems. Evidence for this assignment includes 1) prediction of five transmembrane segments, 2) positional gene linkage with known B12 biosynthesis genes, 3) upstream proximity of B12 transcriptional regulatory sites, 4) the absence of other known cobalt import systems and 5) the obligate co-localization with a small protein (CbtB) having a single additional transmembrane segment and a C-terminal histidine-rich motif likely to be a metal-binding site.	3.39208e-67
NZ_CP013103.1\|WP_007743365.1\|2202809_2203073_-\|translation-initiation-factor-IF-1	gnl\|CDD\|237102	PRK12442, PRK12442, translation initiation factor IF-1; Reviewed.	3.55737e-50
NZ_CP013103.1\|WP_042313915.1\|2218852_2220097_+\|sarcosine-oxidase-subunit-beta-family-protein	gnl\|CDD\|273585	TIGR01373, Sarcosine_oxidase_subunit_beta, sarcosine oxidase, beta subunit family, heterotetrameric form. This model describes the beta subunit of a family of known and putative heterotetrameric sarcosine oxidases. Five operons of such oxidases are found in Mesorhizobium loti and three in Agrobacterium tumefaciens, a high enough copy number to suggest that not all members are share the same function. The model is designated as subfamily rather than equivalog for this reason. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) forms. [Energy metabolism, Amino acids and amines].	0
NZ_CP013103.1\|WP_060605739.1\|2204851_2205427_-\|histidine-phosphatase-family-protein	gnl\|CDD\|366010	pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members.	8.83463e-25
NZ_CP013103.1\|WP_060605758.1\|2220415_2223415_+\|sarcosine-oxidase-subunit-alpha-family-protein	gnl\|CDD\|273584	TIGR01372, sarcosine_oxidase_alpha_subunit, sarcosine oxidase, alpha subunit family, heterotetrameric form. This model describes the alpha subunit of a family of known and putative heterotetrameric sarcosine oxidases. Five operons of such oxidases are found in Mesorhizobium loti and three in Agrobacterium tumefaciens, a high enough copy number to suggest that not all members are share the same function. The model is designated as subfamily rather than equivalog for this reason.Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) forms [Energy metabolism, Amino acids and amines].	0
NZ_CP013103.1\|WP_060605754.1\|2212218_2213226_+\|hypothetical-protein	gnl\|CDD\|368491	pfam05544, Pro_racemase, Proline racemase. This family consists of proline racemase (EC 5.1.1.4) proteins which catalyze the interconversion of L- and D-proline in bacteria. This family also contains several similar eukaryotic proteins including Trypanosoma cruzi PA45-A, a protein with B-cell mitogenic properties which has been characterized as a co-factor-independent proline racemase.	5.35039e-124
NZ_CP013103.1\|WP_054930764.1\|2214383_2215868_+\|glucose-6-phosphate-dehydrogenase	gnl\|CDD\|235579	PRK05722, PRK05722, glucose-6-phosphate 1-dehydrogenase; Validated.	0
NZ_CP013103.1\|WP_060607189.1\|2205673_2205898_+\|CbtB-domain-containing-protein	gnl\|CDD\|370526	pfam09489, CbtB, Probable cobalt transporter subunit (CbtB). This entry represents a family of proteins which have been proposed to act as cobalt transporters acting in concert with vitamin B12 biosynthesis systems. Evidence for this assignment includes 1) prediction of a single transmembrane segment and a C-terminal histidine-rich motif likely to be a metal-binding site, 2) positional gene linkage with known B12 biosynthesis genes, 3) upstream proximity of B12 transcriptional regulatory sites, 4) the absence of other known cobalt import systems and 5) the obligate co-localization with a protein (CbtA) predicted to have five additional transmembrane segments.	4.69124e-08

>NZ_CP013103.1|WP_060605751.1|2208869_2210417_+|HAMP-domain-containing-protein
MKSLTINARIATTIAFLGVLLIATGALGIFGMAKSNRAQRDGYEVNFASVVALGRSGTAMSRARFGLDWAMSNPHSPQLGEQLNRAKRLLGDADRAWAEFRALPKTPALQSLTDDLDAKRTAVLRDGIDQLIQAIGSGDTNWMDESRANHLIGLYSAMNASQGALEKYLDDAAQAAADHSSATFRTLLTACIASIAVGLGVAYLSWRALRRAIMSPMRDALGQFDAIASGELRTRVEIRSEDEMGTLLHGLATMQDKLGATITTVRKGSDSIAAATQQIAAGNLDLSQRTEEQAASLEQTAAAMDELTSTVQLNAENAQHASKLAEDASSMTAHGREAVGSLVETMHLIDAGSSKMTGIITAIEGIAFQTNILALNAAVEAARAGEEGRGFAVVAGEVRSLAQRSAAAAKEIGILIADSTSRVAHGAQIATGAGDTIRDIETAISRVAKIVGEIATASQQQSDGIKEVSLAVTQMDEVTQQNAALVEENAATAAALADEAKRLSELTAAFRVGVG
>NZ_CP013103.1|WP_060605748.1|2207738_2208689_+|AEC-family-transporter
MLSTLEILLPVFALIFAGFFCRRRNLLGPTAASELNRFVVWLALPALLFDTMAHSTWHQLDQPAFIATFSIACAGVFVVVLLARLASGRHLADASVDAIAASYPNTGYIGFPLGLLAFGRASLTPTTIATIIVACVLFALAIVLIEIGLQTERTPHKLGAKVVWRLLRNPLIASPILGVLAASADVALPHSVETFLKLLSGAASPCALVSLGLFLAEKRTPAEQAAEPVTSFVLTAIKLIAQPALAWWIAARVFALPAPMVDMAVLLAALPTGTGPYMLAEFYEREAHITSQTILLSTLGSLVSLSLLLFYMHAPG
>NZ_CP013103.1|WP_060605745.1|2206680_2207631_-|LysR-family-transcriptional-regulator
MLDVKPLRYFVTLAETRHFGRAAARLNLSQPPLSRQLAALEAALGVTLIERSPRSVTLTAAGERFYEDAKAILASIEQAARHARAAAAGDTGQLTVGFTMCAAYSVLPSYARAYGDAWPGVTLNLREVVSNDLAPQVLSGQIDAAIMFPGAQSKDLDTRAIFTEPLCVALSREHPLACAHQLKIAQLAREPFVMASEAVSPSLRATIVDHCAQGGFAPDVRFEVQLQQTVLSLVDEGVGIALVPESMRKAQLVGVVFRPLDDAPTISQMLVWSPSNRNPCLARFLEIAWKRRAERNGEESRASAHSGADAEKQRYR
>NZ_CP013103.1|WP_060605742.1|2205919_2206690_+|CbtA-family-protein
MVGKLLMRGMLAGIVAGLLTFAFARVAGEPLVDTAISFEEKMQTAHDHGDASGAHDHEEELVSRGTQAGLGLLTGVVAYGMAFGGLFALTFAYLHGRVGRLGARALSAWLAVGAYVAVVLVPTIKYPANPPSVGDPETIGMRTGLFFLMIVTSLVVAVFSMKVRKHLVSRLGVWNASIVGGIVFVAIIAAIQIALPTVNEVPEAFPAVVLWKFRFTALGMQAIMWATIGLLFGALVERSERIARASAASARNSAYL
>NZ_CP013103.1|WP_060607189.1|2205673_2205898_+|CbtB-domain-containing-protein
MNDAVLDHAGQTDQPVITPIPLRELLPWILFGGLLMLLALYFVGAEQGATSLIPGMYVHEFVHDGRHLLGFPCH
>NZ_CP013103.1|WP_060605739.1|2204851_2205427_-|histidine-phosphatase-family-protein
MRTRLLLISHPATAAQRKGTFPADDPLDTRAVEEATSFRASHAGLLNADAALSSPAACALDTARALGLAATIVPDLADADFGRWRGRRLLDVANEDTNALDTWTRDPSSAPHGGESFDALTLRVGGWLDAFEQRGTVIAVTHAGVIRAALMHVLQAPSARFARIEVPPLSVVELQRDQRGWTWWPAPDRRS
>NZ_CP013103.1|WP_054930775.1|2204437_2204836_+|hypothetical-protein
MTIRAIAPLALWTVAQLAVAATGDASCGVLAGAGASGASSVSAASGFALRDGEPVDFIAGGKTVPGTLHVLKDGGIYRAYWQPQGRPERYVLANAGTDAVRLIATPAQGKPATDGMPGTTLNPQQVLSCPTL
>NZ_CP013103.1|WP_060605736.1|2204005_2204224_-|hypothetical-protein
MATLEAFRSVLDDARTPEIIRNHIIDSLQYALRNHGQVFTSKEVEWLAKWDDARIPLAASRELQKRLTQTAD
>NZ_CP013103.1|WP_035988551.1|2203204_2203492_-|hypothetical-protein
MTTQGIKTYKGYEIHPLIYPRRTANGVAHRNSIDSGYDASVRICRVGANAAADGRVFRLSYFRPFEGAGKARIACMEHAAQVIDGRVDGQTVSDL
>NZ_CP013103.1|WP_007743365.1|2202809_2203073_-|translation-initiation-factor-IF-1
MAKEELLELDGIVDEVLPDSRYRVTLDNGVVVGAYASGRMRKNHIRILAGDRVTLELSVYDLTKGRINFRHKDERSSGPRSAPMRRR
>NZ_CP013103.1|WP_054930767.1|2211284_2212022_-|FadR-family-transcriptional-regulator
MASTSFALERAFRPKQIYEQVAERMRGEIRSGQFAPEARLPSERDLAARFGVGRPAVREALGALQNEGLVVTRRNSGTYVCADALQRLAAAPAAGEMPGDADFSPTSALDVRLILEPAIARRAAANAQRDELAEHYLAQMDSIDDVSDGVQRALWNDSDRLFHRQLAVMTGDALLVKIADEVAKAMDQPLWKRLKDDGIHDPGRIRLYVSEHRLIYEAIVDGDAEAAAFYVEQHIRRVRRDIAPK
>NZ_CP013103.1|WP_060605754.1|2212218_2213226_+|hypothetical-protein
MKLNRMISTVEVHTGGEPFRIVTSGLPKMPGKTIVERRAWLKEHADHLRRALMLEPRGHADMYGGYLTDPVTEGADFGIIFVHNEGYSDHCGHGVIALATTAVSLGWVERTEPETRVGIDAPCGFIEAFVKWDGDHAGSVRFVNVPSFIWLRDVSVETPSFGTVRGDIAFGGAFYFYTSGEPFGLDVREDHVDRLIQFGAEVKRAANEAFKVQHPQIPEINHIYGTIIDNAPRHAGSTQANCCVFADREVDRSPTGSGTAGRVAQLYLRGQLRKDETLVNESIIGTVFRGRVLSETKLDRFDAVIPEIEGDAHICGFANWLVDERDPLTYGFLVR
>NZ_CP013103.1|WP_060605757.1|2213248_2214166_+|delta(1)-pyrroline-2-carboxylate-reductase-family-protein
MSSTPIFDAAGTARLIPFRALVDALKTAAADYAAGRVASPERLVVPLNDDGIMLSMPAAARDLAIHKLVNVCPRNGERALPTIHGQVMAFDPDTGKTLFILDGPTVTGRRTAAMSMLGIETLSRGAPNDILLIGTGTQAASHLRAIGELYPQARVRVLGTSAARAQAFCDAQRDTVRDLQALSGAAIPDSVDTVIALTTSRQAVYDEAPRAGRLVIGVGAFTPQMCEIGARTLAGSTLYADDLAGARHEAGDFIQAGIDWSTVTGIEGALASQPSFDTPIVFKTVGCAAWDLAAGRVARAALGAG
>NZ_CP013103.1|WP_054930764.1|2214383_2215868_+|glucose-6-phosphate-dehydrogenase
MTTSTAPASPDRPLDMIIFGGAGDLSARKLLPALYMAHTHGNLPPETRILAIGRREWGRDDYLKWMDEQSRPFIESGAFDASAWDRFLSLFEYVRVDVDQAGDYERLAEASRPNALRVFYLSTSPELFTTICDNLSSHGLLDEHSRVVLEKPLGHDLASAQAINDSVGKHFSEHQIYRIDHYLGKETVQNLMVLRFGNAIFGPLWQAPYIRSVQITVAESVGVGTRAGFYDHTGAMRDMVQNHLLQLLCIVAMEPPVSLDADAVRDEKLKVLRSLRPMTAEDISRDTVRGQYTAGAVGGEPVKGYLEEANVPADSRAETFVALRAHINNWRWANVPFYLRTGKRMAKKLSEIVIEFADLPFSIMPNSPCGPRNCGNRLVIQLQPNESIQLQMLAKEPGSGMRTLPVNLNLDLEQAFTSRRAEAYERLLIDVVRGRLTHFMRRDELEAAWTWVDPIIEAWKRNGDKPRAYTAGTFGPGASTAMMARDNMVWSEES
>NZ_CP013103.1|WP_054930763.1|2215980_2217066_-|GlxA-family-transcriptional-regulator
MTIVDSLPLTSIDALPKERIRFGIVLLPNFTLTAFSGFVDMLRLSADEGDYSKPVRCSWSVIGDTLAPVRASCGIQITPWETFADAEPFDYVVVVGGLLHSGPQANDETLQFIRAAARGNTTLVGICTGVFALMRAGVLDEHRICVSWFHYWDFVERFPSVNPDALIADRLFVIDRRRITCSGGRASIDVAAAILLRHFETATVQKALRILLVGEMQKGNAPQPHPPGLEPATHPKVKRAILLMEQHVGRTLPLEELACKLDLSPRQLERLFKAETGKSPQAFAKQVRLRTAAWLLTSSDRTVADIASSCGFSDASHLGREFRKEFGMPPVMFREQRGGTPVEGDAAVAYEETFPGRVDVF
>NZ_CP013103.1|WP_054930762.1|2217435_2218824_+|L-serine-ammonia-lyase
MNVSVFDLFKIGIGPSSSHTVGPMIAACRFASHIEDANLLAFVRRVKVELYGSLGATGKGHGTDKAVLLGLEGHLPDTIDPDLIEPRLADIRKGKRLALLGKHEIAFDEKEHIAFFRRLMSGTGSVVHPNGMRFQAFDENGQLLVEKEYYSVGGGFVVNREGDRVNGVRAGGEVPYPFRTGDDLMRVCRESGLSVAQVTFANECASRAPEDVREGLLTIWRTMAACVERGCKMHGELPGPMRVKRRAADLTVQLRTRSEESLRDPLSMLDWVNLYAMAVNEENAAGGRVVTAPTNGAAGVIPAVLHYYVKFVPGSNENGIVDFLLTAAAIGIIYKETASISGAEVGCQGEVGVACSMAAAALAAVMGGTPTQVENAAEIGMEHNLGMTCDPVGGLVQIPCIERNAMGAIKALNASRMALKGDGQHYVTLDNVIKTMRETGADMKTKYKETSRGGLAVNVIEC
>NZ_CP013103.1|WP_042313915.1|2218852_2220097_+|sarcosine-oxidase-subunit-beta-family-protein
MSRYSIFSLFRNGLSYHENWERQWRSPEPKKEYDVVIVGGGGHGLATAYYLAKEHGVKNVAILEKGWIGGGNTARNTTIVRSNYLWDESAALYEKAMKLWEGLSQDLNYNVMFSQRGVLNLAHTLQDVRDTERRVNANRLNGVDAEFLTPEQIKEIEPTINLNSRYPVLGASIQRRAGVARHDAVAWGFARGADQAGVDIIQNCQVTGIRRDGGRVTGVDTVKGFIKAKKVAVVAAGNTTTLADMAGIRLPLESHPLQALVSEPIKPVVNSVIMSNAVHAYISQSDKGDLVIGAGVDQYTGFGQRGSFHIIEGTLQAIVEMFPVFSRVRMNRQWGGIVDVSPDACPIISKTDVKGLYFNCGWGTGGFKATPGSGWVFAHTIANDEPHPLNAAFSLDRFYTGHLIDEHGAAAVAH
>NZ_CP013103.1|WP_054930761.1|2220119_2220419_+|sarcosine-oxidase-subunit-delta
MLTIECPWCGPRAESEFSCGGEADIARPLDTDKLTDKEWGDYLFMRKNPRGVHREQWLHTQGCRRWFMATRDTVSYEIQGYDTFKTGNTSADAQGGNKQ
>NZ_CP013103.1|WP_060605758.1|2220415_2223415_+|sarcosine-oxidase-subunit-alpha-family-protein
MSQKNRLGAGGRINRAIPLTFTFNGRTYQGFQGDTLASALLANGVHFVARSFKYHRPRGIVTADVAEPNAVVQLERGAYTVPNARATEIELYQGLVATSVNAEPNLEHDRMAINQKFSRFMPAGFYYKTFMWPAKFWPKYEEKIREAAGLGKAPEVLDADRYDKCYAHCDVLVVGGGPTGLAAAHAAAVSGARVILVDDQRELGGSLLSSKTEIDGRAALSWVEKIEAELSRMADVTILSRSTAFGYQDHNLVTVTQRLTDHLPVSMRKGTRELLWKIRAKRVILATGAHERPIVFGNNDLPGVMMASAVSTYIHRFGVLPGRNAVVFTNNDAGYQCALDMKACGASVTVVDPRAQGNGALQAAARRHGVKIMNNAAVMTAHGKLRVTSVEVVAYANGKTGAKQADLPCDLVAMSGGYSPVLHLFAQSGGKAHWNDTKACFVPGKGMQPETSIGAAAGEFSLARGLRLAVDAGVEAVKSIGYAVTRVQVPQAAEVAESPLQPLWLVGSRTEAARGPKQFVDFQNDVSAADILLAAREGFESVEHVKRYTAMGFGTDQGKLGNINGMAILADALGKTIPETGTTTFRPNYTPVSFGTFAGRELGDLLDPIRKTAVHEWHVENGAMFEDVGNWKRPWYFPKSGEDLHAAVKRECLAVRNSVGILDASTLGKIDIQGPDAAKLLNWMYTNPWSKLEVGKCRYGLMLDENGMVFDDGVTVRLADQHFMMTTTTGGAARVLTWMERWLQTEWPDMKVRLASVTDHWATFAVVGPKSRKVVQKICSDIDFANEAFPFMSYRNGTVAGVKARVMRISFSGELAYEVNVPANMGRAVWEALMAAGAEFDITPYGTETMHVLRAEKGYIIVGQDTDGSITPHDLGMGGLVAKTKDFLGRRSLARSDTAKDGRKQFVGLLTDDPQLVLPEGSQIVAGPFQGETAPMLGHVTSSYYSPILNRSIALAVVKGGLNKMGQNVTIPLASGKQIAAKIASPVFYDTEGVRQHVE
>NZ_CP013103.1|WP_054930759.1|2223404_2224055_+|sarcosine-oxidase-subunit-gamma
MWNEARNNAPGATSAVANRVAGQPWQESPLAGVGELVKKHAAAPSKKFHLREKAFCDLVNLRGDVSDAAFLGAVESVTGCRPPARPNTVVRGNGYDVLWLGPDEWLVRSQQPQAPVAEDKLVEALQGQFASAVDIGSGWTVLEVSGEKVRDVISRGCPLDLHPRVLAAGQCAQSHYFKASIVLVPIADDTYEIVVRRSFADYFVRIMLDAAEPLLS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP013103_1	1.1\|537385\|36\|NZ_CP013103\|CRISPRCasFinder	537385-537420	36	NZ_CP013103.1	973167-973202	1	0.972
NZ_CP013103_1	1.1\|537385\|36\|NZ_CP013103\|CRISPRCasFinder	537385-537420	36	NZ_CP013103.1	972523-972558	1	0.972
NZ_CP013103_1	1.1\|537385\|36\|NZ_CP013103\|CRISPRCasFinder	537385-537420	36	NZ_CP013103.1	1802166-1802201	2	0.944
NZ_CP013103_1	1.1\|537385\|36\|NZ_CP013103\|CRISPRCasFinder	537385-537420	36	NZ_CP013102.1	913900-913935	2	0.944

1. spacer 1.1|537385|36|NZ_CP013103|CRISPRCasFinder matches to position: 973167-973202, mismatch: 1, identity: 0.972

tttgccttttcgctggcgtccgcgaattgttagcgt	CRISPR spacer
tttgcctcttcgctggcgtccgcgaattgttagcgt	Protospacer
*******.****************************

2. spacer 1.1|537385|36|NZ_CP013103|CRISPRCasFinder matches to position: 972523-972558, mismatch: 1, identity: 0.972

tttgccttttcgctggcgtccgcgaattgttagcgt	CRISPR spacer
tttgccttttcgctggcatccgcgaattgttagcgt	Protospacer
*****************.******************

3. spacer 1.1|537385|36|NZ_CP013103|CRISPRCasFinder matches to position: 1802166-1802201, mismatch: 2, identity: 0.944

tttgccttttcgctggcgtccgcgaattgttagcgt	CRISPR spacer
tttgctttttcgctggcatccgcgaattgttagcgt	Protospacer
*****.***********.******************

4. spacer 1.1|537385|36|NZ_CP013103|CRISPRCasFinder matches to position: 913900-913935, mismatch: 2, identity: 0.944

tttgccttttcgctggcgtccgcgaattgttagcgt	CRISPR spacer
tttgccttttcgctggcatccgcgagttgttagcgt	Protospacer
*****************.*******.**********

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP013103_1	1.1\|537385\|36\|NZ_CP013103\|CRISPRCasFinder	537385-537420	36	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	251067-251102	2	0.944
NZ_CP013103_1	1.1\|537385\|36\|NZ_CP013103\|CRISPRCasFinder	537385-537420	36	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1313582-1313617	2	0.944
NZ_CP013103_1	1.1\|537385\|36\|NZ_CP013103\|CRISPRCasFinder	537385-537420	36	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	514354-514389	3	0.917
NZ_CP013103_1	1.1\|537385\|36\|NZ_CP013103\|CRISPRCasFinder	537385-537420	36	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	427887-427922	3	0.917
NZ_CP013103_1	1.1\|537385\|36\|NZ_CP013103\|CRISPRCasFinder	537385-537420	36	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1856706-1856741	3	0.917
NZ_CP013103_1	1.1\|537385\|36\|NZ_CP013103\|CRISPRCasFinder	537385-537420	36	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	360003-360038	4	0.889
NZ_CP013103_1	1.1\|537385\|36\|NZ_CP013103\|CRISPRCasFinder	537385-537420	36	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1551778-1551813	4	0.889
NZ_CP013103_1	1.1\|537385\|36\|NZ_CP013103\|CRISPRCasFinder	537385-537420	36	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	223-258	4	0.889
NZ_CP013103_1	1.1\|537385\|36\|NZ_CP013103\|CRISPRCasFinder	537385-537420	36	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	271159-271194	5	0.861
NZ_CP013103_1	1.1\|537385\|36\|NZ_CP013103\|CRISPRCasFinder	537385-537420	36	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	123273-123308	5	0.861
NZ_CP013103_1	1.1\|537385\|36\|NZ_CP013103\|CRISPRCasFinder	537385-537420	36	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	2242572-2242607	6	0.833
NZ_CP013103_1	1.1\|537385\|36\|NZ_CP013103\|CRISPRCasFinder	537385-537420	36	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	2241930-2241965	6	0.833
NZ_CP013103_1	1.1\|537385\|36\|NZ_CP013103\|CRISPRCasFinder	537385-537420	36	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1036838-1036873	6	0.833
NZ_CP013103_1	1.1\|537385\|36\|NZ_CP013103\|CRISPRCasFinder	537385-537420	36	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	1049514-1049549	6	0.833
NZ_CP013103_1	1.1\|537385\|36\|NZ_CP013103\|CRISPRCasFinder	537385-537420	36	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	82434-82469	6	0.833
NZ_CP013103_1	1.1\|537385\|36\|NZ_CP013103\|CRISPRCasFinder	537385-537420	36	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	1622761-1622796	6	0.833
NZ_CP013103_1	1.1\|537385\|36\|NZ_CP013103\|CRISPRCasFinder	537385-537420	36	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	2239817-2239852	7	0.806
NZ_CP013103_1	1.1\|537385\|36\|NZ_CP013103\|CRISPRCasFinder	537385-537420	36	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	526122-526157	7	0.806
NZ_CP013103_1	1.1\|537385\|36\|NZ_CP013103\|CRISPRCasFinder	537385-537420	36	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1314653-1314688	8	0.778
NZ_CP013103_1	1.1\|537385\|36\|NZ_CP013103\|CRISPRCasFinder	537385-537420	36	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	214994-215029	8	0.778
NZ_CP013103_1	1.1\|537385\|36\|NZ_CP013103\|CRISPRCasFinder	537385-537420	36	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	767357-767392	8	0.778
NZ_CP013103_1	1.1\|537385\|36\|NZ_CP013103\|CRISPRCasFinder	537385-537420	36	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	83079-83114	8	0.778
NZ_CP013103_1	1.1\|537385\|36\|NZ_CP013103\|CRISPRCasFinder	537385-537420	36	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	123918-123953	8	0.778
NZ_CP013103_1	1.1\|537385\|36\|NZ_CP013103\|CRISPRCasFinder	537385-537420	36	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	1561890-1561925	8	0.778

1. spacer 1.1|537385|36|NZ_CP013103|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.944

tttgccttttcgctggcgtccgcgaattgttagcgt	CRISPR spacer
tttgccttttcgctggcatccgcgaattgttagcct	Protospacer
*****************.**************** *

2. spacer 1.1|537385|36|NZ_CP013103|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.944

tttgccttttcgctggcgtccgcgaattgttagcgt	CRISPR spacer
tttgctttttcgctggcatccgcgaattgttagcgt	Protospacer
*****.***********.******************

3. spacer 1.1|537385|36|NZ_CP013103|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.917

tttgccttttcgctggcgtccgcgaattgttagcgt	CRISPR spacer
cttgtcttttcgctggcatccgcgaattgttagcgt	Protospacer
.***.************.******************

4. spacer 1.1|537385|36|NZ_CP013103|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.917

tttgccttttcgctggcgtccgcgaattgttagcgt	CRISPR spacer
tatgcttttgcgctggcgtccgcgaattgttagcgt	Protospacer
* ***.*** **************************

5. spacer 1.1|537385|36|NZ_CP013103|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.917

--tttgccttttcgctggcgtccgcgaattgttagcgt	CRISPR spacer
gctttgc--tttcgctggcatccgcgaattgttagcgt	Protospacer
  *****  **********.******************

6. spacer 1.1|537385|36|NZ_CP013103|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.889

tttgccttttcgctggcgtccgcgaattgttagcgt	CRISPR spacer
tttgcgttttcgctggcatccgcgaattgttagctc	Protospacer
***** ***********.**************** .

7. spacer 1.1|537385|36|NZ_CP013103|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.889

tttgccttttcgctggcgtccgcgaattgttagcgt	CRISPR spacer
atggcctttgcgctggcatccgcgaattgttagcgt	Protospacer
 * ****** *******.******************

8. spacer 1.1|537385|36|NZ_CP013103|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.889

tttgccttt-tcgctggcgtccgcgaattgttagcgt	CRISPR spacer
-gggcctttgtcgctggcatccgcgaattgttagcgt	Protospacer
   ****** ********.******************

9. spacer 1.1|537385|36|NZ_CP013103|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.861

tttgccttttcgctggcgtccgcgaattgttagcgt	CRISPR spacer
gtttgctttgcgctggcatccgcgaattgttagcgt	Protospacer
 **  **** *******.******************

10. spacer 1.1|537385|36|NZ_CP013103|CRISPRCasFinder matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.861

tttgccttttcgctggcgtccgcgaattgttagcgt	CRISPR spacer
ctttcgctttcgctggcatccgcgaattgttagcgt	Protospacer
.** * .**********.******************

11. spacer 1.1|537385|36|NZ_CP013103|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.833

tttgccttttcgctggcgtccgcgaattgttagcgt	CRISPR spacer
ctcgtgtttgcgctggcatccgcgaattgttagcgt	Protospacer
.*.*. *** *******.******************

12. spacer 1.1|537385|36|NZ_CP013103|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.833

tttgccttttcgctggcgtccgcgaattgttagcgt	CRISPR spacer
ctcgtgtttgcgctggcatccgcgaattgttagcgt	Protospacer
.*.*. *** *******.******************

13. spacer 1.1|537385|36|NZ_CP013103|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.833

tttgccttttcgctggcgtccgcgaattgttagcgt	CRISPR spacer
tttatttttgcgctggcatccgcgaattgttagcat	Protospacer
***...*** *******.****************.*

14. spacer 1.1|537385|36|NZ_CP013103|CRISPRCasFinder matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

tttgccttttcgctggcgtccgcgaattgttagcgt	CRISPR spacer
cttttgctttcgctggcatccgcgaattgttagcgt	Protospacer
.** . .**********.******************

15. spacer 1.1|537385|36|NZ_CP013103|CRISPRCasFinder matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

tttgccttttcgctggcgtccgcgaattgttagcgt	CRISPR spacer
cttttgctttcgctggcatccgcgaattgttagcgt	Protospacer
.** . .**********.******************

16. spacer 1.1|537385|36|NZ_CP013103|CRISPRCasFinder matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.833

tttgccttttcgctggcgtccgcgaattgttagcgt	CRISPR spacer
cttttgctttcgctggcatccgcgaattgttagcgt	Protospacer
.** . .**********.******************

17. spacer 1.1|537385|36|NZ_CP013103|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.806

tttgccttttcgctggcgtccgcgaattgttagcgt	CRISPR spacer
cctttgctttcgctggcatccgcgaattgttagcgt	Protospacer
..* . .**********.******************

18. spacer 1.1|537385|36|NZ_CP013103|CRISPRCasFinder matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.806

tttgccttttcgctggcgtccgcgaattgttagcgt	CRISPR spacer
gtggttctttcgctggcatccgcgaattgttagcct	Protospacer
 * *...**********.**************** *

19. spacer 1.1|537385|36|NZ_CP013103|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.778

tttgccttttcgctggcgtccgcgaattgttagcgt	CRISPR spacer
tctgccttttcgctggcatccgcgatttgccctcgc	Protospacer
*.***************.******* ***..  **.

20. spacer 1.1|537385|36|NZ_CP013103|CRISPRCasFinder matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.778

tttgccttttcgctggcgtccgcgaattgttagcgt	CRISPR spacer
tttgcctttgcgctggcatccgcgaattggctttgc	Protospacer
********* *******.*********** .  .*.

21. spacer 1.1|537385|36|NZ_CP013103|CRISPRCasFinder matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.778

tttgccttttcgctggcgtccgcgaattgttagcgt	CRISPR spacer
tatttgctttcgctggcatccgcgaattgttagctc	Protospacer
* * . .**********.**************** .

22. spacer 1.1|537385|36|NZ_CP013103|CRISPRCasFinder matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.778

tttgccttttcgctggcgtccgcgaattgttagcgt	CRISPR spacer
gtttggttttcgctggcatccgcgatttgttagcta	Protospacer
 **   ***********.******* ********

23. spacer 1.1|537385|36|NZ_CP013103|CRISPRCasFinder matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.778

tttgccttttcgctggcgtccgcgaattgttagcgt	CRISPR spacer
cttttgcttttgctggcatccgcgaattgttagcgc	Protospacer
.** . .***.******.*****************.

24. spacer 1.1|537385|36|NZ_CP013103|CRISPRCasFinder matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.778

tttgccttttcgctggcgtccgcgaattgttagcgt	CRISPR spacer
ctttcgctttcgttggcatccgcgaattgttagctc	Protospacer
.** * .*****.****.**************** .

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013104_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013104_1

768003-768088

Orphan

Consensus_repeat	Method
GCTAACGTCACGCGGATGCCAGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013104_1

>merge|NZ_CP013104|1|768003-768088|CRISPRCasFinder
GCTAACGTCACGCGGATGCCAGCGAAAAGGCCGATAACACCGAACGGCGACGCGTGAAGCACGCTAACGTAACGCGGATGCCAGCG

>NZ_CP013104|1|1|768003-768088|CRISPRCasFinder
GCTAACGTCACGCGGATGCCAGCG	AAAAGGCCGATAACACCGAACGGCGACGCGTGAAGCAC
GCTAACGTAACGCGGATGCCAGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013104.1\|WP_054930793.1\|776938_777886_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP013104.1\|WP_060608543.1\|751949_754145_-\|FUSC-family-protein	unknown	unknown	gnl\|CDD\|377393
NZ_CP013104.1\|WP_060610479.1\|761604_761952_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013104.1\|WP_060608556.1\|764577_765978_+\|cytochrome-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|376587
NZ_CP013104.1\|WP_054930791.1\|773965_774346_-\|response-regulator	unknown	unknown	gnl\|CDD\|226932
NZ_CP013104.1\|WP_054932423.1\|754380_755301_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176122
NZ_CP013104.1\|WP_054932432.1\|768270_768657_-\|DUF3331-domain-containing-protein	unknown	unknown	gnl\|CDD\|288644
NZ_CP013104.1\|WP_098021693.1\|774641_774929_+\|H-NS-histone-family-protein	unknown	unknown	gnl\|CDD\|225468
NZ_CP013104.1\|WP_054932433.1\|768727_769693_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_CP013104.1\|WP_054932425.1\|759399_760041_-\|HD-domain-containing-protein	unknown	unknown	gnl\|CDD\|188314
NZ_CP013104.1\|WP_060608546.1\|757610_759356_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223566
NZ_CP013104.1\|WP_060608561.1\|775117_776029_-\|PilZ-domain-containing-protein	unknown	unknown	gnl\|CDD\|377796
NZ_CP013104.1\|WP_060608549.1\|760630_761605_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP013104.1\|WP_054930790.1\|770774_771449_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|226932
NZ_CP013104.1\|WP_060608559.1\|766008_766998_+\|cytochrome-d-ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|376764
NZ_CP013104.1\|WP_054930794.1\|777895_778783_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176133
NZ_CP013104.1\|WP_082433927.1\|755334_757200_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|226418
NZ_CP013104.1\|WP_060608552.1\|762227_764585_+\|FdhF/YdeP-family-oxidoreductase	unknown	unknown	gnl\|CDD\|273765
NZ_CP013104.1\|WP_060608564.1\|776343_776769_+\|glyoxalase	unknown	unknown	gnl\|CDD\|319906
NZ_CP013104.1\|WP_082670503.1\|771438_773640_-\|PAS-domain-S-box-protein	unknown	unknown	gnl\|CDD\|340397

Protein	Function_ID	Function_description	E-value
NZ_CP013104.1\|WP_054930793.1\|776938_777886_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	3.84636e-37
NZ_CP013104.1\|WP_060608543.1\|751949_754145_-\|FUSC-family-protein	gnl\|CDD\|377393	pfam04632, FUSC, Fusaric acid resistance protein family. This family includes a conserved region found in two proteins associated with fusaric acid resistance, FusC from Burkholderia cepacia and fdt-2 from Klebsiella oxytoca. These proteins are likely to be membrane transporter proteins.	1.20149e-105
NZ_CP013104.1\|WP_060608556.1\|764577_765978_+\|cytochrome-ubiquinol-oxidase-subunit-I	gnl\|CDD\|376587	pfam01654, Cyt_bd_oxida_I, Cytochrome bd terminal oxidase subunit I. This family are the alternative oxidases found in many bacteria which oxidize ubiquinol and reduce oxygen as part of the electron transport chain. This family is the subunit I of the oxidase E. coli has two copies of the oxidase, bo and bd', both of which are represented here In some nitrogen fixing bacteria, e.g. Klebsiella pneumoniae this oxidase is responsible for removing oxygen in microaerobic conditions, making the oxidase required for nitrogen fixation. This subunit binds a single b-haem, through ligands at His186 and Met393 (using SW:P11026 numbering). In addition His19 is a ligand for the haem b found in subunit II.	0
NZ_CP013104.1\|WP_054930791.1\|773965_774346_-\|response-regulator	gnl\|CDD\|226932	COG4566, TtrR, Response regulator [Signal transduction mechanisms].	5.98143e-28
NZ_CP013104.1\|WP_054932423.1\|754380_755301_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176122	cd08431, PBP2_HupR, The C-terminal substrate binding domain of LysR-type transcriptional regulator, HupR, which regulates expression of the heme uptake receptor HupA; contains the type 2 periplasmic binding fold. HupR, a member of the LysR family, activates hupA transcription under low-iron conditions in the presence of hemin. The expression of many iron-uptake genes, such as hupA, is regulated at the transcriptional level by iron and an iron-binding repressor protein called Fur (ferric uptake regulation). Under iron-abundant conditions with heme, the active Fur repressor protein represses transcription of the iron-uptake gene hupA, and prevents transcriptional activation via HupR. Under low-iron conditions with heme, the Fur repressor is inactive and transcription of the hupA is allowed. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.30411e-69
NZ_CP013104.1\|WP_054932432.1\|768270_768657_-\|DUF3331-domain-containing-protein	gnl\|CDD\|288644	pfam11811, DUF3331, Domain of unknown function (DUF3331). This family of proteins are functionally uncharacterized. This family is only found in bacteria. Proteins in this family vary in length from 96 to 160 amino acids.	2.17638e-31
NZ_CP013104.1\|WP_098021693.1\|774641_774929_+\|H-NS-histone-family-protein	gnl\|CDD\|225468	COG2916, Hns, DNA-binding protein H-NS [General function prediction only].	3.03707e-07
NZ_CP013104.1\|WP_054932433.1\|768727_769693_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	2.75674e-28
NZ_CP013104.1\|WP_054932425.1\|759399_760041_-\|HD-domain-containing-protein	gnl\|CDD\|188314	TIGR03401, Uncharacterized_protein_YFL061W/YNL335W, HD domain protein, cyanamide hydratase family. Members of this protein family are known, so far, in the Ascomycota, a branch of the Fungi, and contain an HD domain (pfam01966), found typically in various metal-dependent phosphohydrolases. The only characterized member of this family, from the soil fungus Myrothecium verrucaria, is cyanamide hydratase (EC 4.2.1.69), a zinc-containing homohexamer that adds water to the fertilizer cyanamide (NCNH2), a nitrile compound, to produce urea (NH2-CO-NH2). Homologs are likely to be nitrile hydratases.	6.19599e-08
NZ_CP013104.1\|WP_060608546.1\|757610_759356_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|223566	COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones].	2.83103e-69
NZ_CP013104.1\|WP_060608561.1\|775117_776029_-\|PilZ-domain-containing-protein	gnl\|CDD\|377796	pfam07238, PilZ, PilZ domain. PilZ is a c-di-GMP binding domain which is found C terminal to pfam07317. Proteins which contain PilZ are known to interact with the flagellar switch-complex proteins FliG and FliM. This interaction results in a reduction of torque generation and induces CCW motor bias. This domain forms a beta barrel structure.	2.7478e-05
NZ_CP013104.1\|WP_060608549.1\|760630_761605_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	6.0623e-45
NZ_CP013104.1\|WP_054930790.1\|770774_771449_-\|response-regulator-transcription-factor	gnl\|CDD\|226932	COG4566, TtrR, Response regulator [Signal transduction mechanisms].	1.33012e-84
NZ_CP013104.1\|WP_060608559.1\|766008_766998_+\|cytochrome-d-ubiquinol-oxidase-subunit-II	gnl\|CDD\|376764	pfam02322, Cyt_bd_oxida_II, Cytochrome bd terminal oxidase subunit II. This family consists of cytochrome bd type terminal oxidases that catalyze quinol-dependent, Na+-independent oxygen uptake. Members of this family are integral membrane proteins and contain a protohaem IX centre B558. One member of the family, Klebsiella pneumoniae CydB, is implicated in having an important role in micro-aerobic nitrogen fixation in the enteric bacterium Klebsiella pneumoniae. The family forms an integral functional unit with subunit I, family Bac_Ubq_Cox, pfam01654.	8.09424e-73
NZ_CP013104.1\|WP_054930794.1\|777895_778783_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176133	cd08442, PBP2_YofA_SoxR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold. YofA is a LysR-like transcriptional regulator of cell growth in Bacillus subtillis. YofA controls cell viability and the formation of constrictions during cell division. YofaA positively regulates expression of the cell division gene ftsW, and thus is essential for cell viability during stationary-phase growth of Bacillus substilis. YofA shows significant homology to SoxR from Arthrobacter sp. TE1826. SoxR is a negative regulator for the sarcosine oxidase gene soxA. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine, which is involved in the metabolism of creatine and choline. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.9459e-68
NZ_CP013104.1\|WP_082433927.1\|755334_757200_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|226418	COG3903, COG3903, Predicted ATPase [General function prediction only].	2.75385e-58
NZ_CP013104.1\|WP_060608552.1\|762227_764585_+\|FdhF/YdeP-family-oxidoreductase	gnl\|CDD\|273765	TIGR01701, Hypothetical_protein_Rv2900c/MT2968/Mb2924c., oxidoreductase alpha (molybdopterin) subunit. This model represents a well-defined clade of oxidoreductase alpha subunits most closely related to a group of formate dehydrogenases including the E. coli FdhH protein (TIGR01591). These alpha subunits contain a molybdopterin cofactor and generally associate with two other subunits which contain iron-sulfur clusters and cytochromes. The particular subunits with which this enzyme interacts and the substrate which is reduced is unknown at this time. In Ralstonia, the gene is associated with the cbb operon, but is not essential for CO2 fixation.	0
NZ_CP013104.1\|WP_060608564.1\|776343_776769_+\|glyoxalase	gnl\|CDD\|319906	cd07242, VOC_BsYqjT, vicinal oxygen chelate (VOC) family protein similar to Bacillus subtilis YqjT. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	7.56588e-14
NZ_CP013104.1\|WP_082670503.1\|771438_773640_-\|PAS-domain-S-box-protein	gnl\|CDD\|340397	cd16920, HATPase_TmoS-FixL-DctS-like, Histidine kinase-like ATPase domain of two-component sensor histidine kinases similar to Rhizobium meliloti FixL, and Rhodobacter capsulatus DctS; includes hybrid sensor histidine kinase similar to Pseudomonas mendocina TmoS. This family includes the histidine kinase-like ATPase (HATPase) domains of various histidine kinases (HKs) of two-component signal transduction systems (TCSs), such as Pseudomonas mendocina TmoS HK of the TmoS-TmoT TCS, which controls the expression of the toluene-4-monooxygenase pathway, Rhizobium meliloti FixL HK of the FixL-FixJ TCS, which regulates the expression of the genes related to nitrogen fixation in the root nodule in response to O(2) levels, and Rhodobacter capsulatus DctS of the DctS-DctR TCS, which controls synthesis of the high-affinity C4-dicarboxylate transport system. Proteins having this HATPase domain also contain a histidine kinase dimerization and phosphoacceptor domain (HisKA) and PAS sensor domain(s); many are hybrid sensor histidine kinases as they also contain a REC signal receiver domain.	1.79177e-42

>NZ_CP013104.1|WP_060608559.1|766008_766998_+|cytochrome-d-ubiquinol-oxidase-subunit-II
MDSSTHSLLAYVWFGLLGLMLVFYVVTDGFDLGVGILSLLRSRREDRDVMVESIGHVWDANETWLVVLGGGLFGAFPLAYAQLMQDLYLPIMALIAGLIMRGAAIEFRHSVEHGPLWDKVFGIGSLVAALAQGVVLGKIVTGLVPGEMSQGFVVVAAIGVVAGYALLGATYLVKKTVGMIEQWSRRLALLSAVLTVAAALLLTIATWFFSDVGLERWSQPGVMHVLIALGLAAALAFAFIMASLYMGASRGPFRGAVTLFIVSFAGLAVSLFPDFVPGKLGIVEAASDSHTLAFMLAGIGLIFPVMIGYNLYQYYIFRGKVVGEAHAGE
>NZ_CP013104.1|WP_060608556.1|764577_765978_+|cytochrome-ubiquinol-oxidase-subunit-I
MLDHVANLSRAQFAMTAIFHILWPILTISLSAFLVLVEALWIKTGDVMYYRQARFWSKLLVLNFAVGVVSGIPMEFQFGTNWAGFSQYSGQFIGNILGFEGAMAFMLEAGFVGVMLLGWGRVPRGVHLFATGMVALGSSISAFWIMVANSWMQTPAGYAVVDGKIEVTNYLAAIFNPDMVWGVSHMWVAAIETGMFVIAGISAYNLFRKRHPEFFARSFKIALTVLVIAAPLQVWLGDSSGVSVFETQPAKGAAIEGHWHTNAPGTGASWSLLAWPDKQAQRNDWSLEVPGMLSVLGTHSLHGQVKGLTDFKPEDQPPMIPLLYYAFRVMAGIGFCFMLLAFWTVYALRKARGSLDALLARRKLLLAWVLCIPLPYVAVEAGWIVREVGRQPWVVYGLLRTSQAASTVAPSSVSLSMAMFFAFYVVLLVTFFVLARRWLRTGPDLTSVPPAIVTARAASTKSISGY
>NZ_CP013104.1|WP_060608552.1|762227_764585_+|FdhF/YdeP-family-oxidoreductase
MGKKKVIRIYSDPAGGWGALKATGEALTLQGIPVSGAKTLLHMNQPQGFDCPGCAWPDPKHTSSFEFCENGAKAVAWEATVNRCTPEFFAAHSVSELTAWDDYDLEMAGRLTHPMVYDASTDRYAPISWDDAFALVGRHLNALDHPDQADFYTSGRASNEAAFLYQLFVREFGSNNFPDCSNMCHEATSVGLPQSIGVGKGTVLLEDFEHADAIFIFGQNPGTNSPRMMSDLHSASRRGAKIVSFNPFRERALERFASPQNPVEMATLGYTPISTFLYQVKVGGDVAVLKGMMKAIVEADDAALAADKPRILDIEFIQGHTHGIDALLDDLRATSWDAIERHSGLSRADIENAANIYMQADNAILVYGMGITQHHRGTENVQQIANLALLRGNVGREGAGICPVRGHSNVQGNRTVGITEKPNKGLIEGIERAFGFRPPANHGNDVIATLEAMMRGDAKVFIGLGGNFAAAIPDWVRMQEAIRKLNLTVHIATKLNRSHLVHGKEALILPCLGRTEIDIQAGGPQSITVEDSMSMVHASAGRNEPASPHLMSEPAIVAGIARATLGEKSRVPWEQMVANYDHIRDAIEIVFPIFQAYNERIRVPGGFHLTSNARERVWDTPTGRANFLVFKGLDENPWHDDPDALWLTTMRSHDQYNTTLYSHSDRYRGVFGQRDVVFMNQHELHKRGLHPGERVDIVALSTDGIERVIRSFKVVEYSLPDGCCGAYYPEVNPLVPLYAFDPQSRTPSYKSVPVKIGRAAAVGPDSATRAIVMQAASHAGENSHA
>NZ_CP013104.1|WP_060610479.1|761604_761952_+|hypothetical-protein
MRTIAFPFFRPSYAIAACSVALAATCAYQAPGVMQAILVVGANAQLPLERLAAEAGKPTPVSATDVSSPWKEHVPARARPAMLKLGSFGEPVRERHTHRGMGGYQRSVTDYKYWT
>NZ_CP013104.1|WP_060608549.1|760630_761605_+|LysR-family-transcriptional-regulator
MDKILSMRIFSRVVESGSFSAVADHMNCSTGSVSRAVSSLEDHLHARLLQRTTRKVSLTEPGERYYRKCKKILADLEDAEAEAGDAHTSARGTLRIHCVTDLGLAQLTHSILEYRKRFPSVAVQVKFLPRMANLLEDDVDVSIVAAPALPDSRNVCKLIGHCERVLVASPAFLQTHRVETANDLDEHALTPMPFRVEPNGHPVKLSLVKPAGQSTGPEGARQFAINDTEATRIATLAGAGVAALPVHCVIDDLRNGRLLQLFPESRLQNTSVFAVYSSRHHIDAKIKTFIDFMTSHLKEALDTRVLTGHQPQTFSHVARVMENA
>NZ_CP013104.1|WP_054932425.1|759399_760041_-|HD-domain-containing-protein
MNKNVAGVDIPDGVLARAAFEHVRGIEPELLLHHALRVFLFAALIGCKEALAFDMELLYVSALFHNAGLNERYAHSPNRFEIDSANAAREFLRCHRADESATAQVWTAIALHTTPGIPEHMPPLVALLSAGVQMDVRGARYHEFIAQQRNDIVQAFPRERGFKTKLIEAYARGMEHRPETTFGTVNADVLDRWDPDYRRLNFCGLVLGSEWPH
>NZ_CP013104.1|WP_060608546.1|757610_759356_-|FAD-dependent-oxidoreductase
MNTPAINPPDLLSAQPDAGAPDLAMPYSSLEFRQHQMFPRLSAAQIASLRRFAQPMSFRAGELIFETGRIALGLFVLLHGRVRISSRDSFGRSTLVTEHDDGHFMAEMAQLSGKPALIDGVALTDCDTLVVSPDKLRALIVADAQLGEHIMRALILRRLGLIEQGLGPIIVGNGDDARLVRLQGFLRRNAYPATVIDARHDAEAATLLAGITTGPDDFPLVFCPNGSVLRAPDEAQLASCLGLVPTFERSHVYDVAIVGAGPAGLAAAVYAATEGLSVAVFDQRAPGGQAGASSRIENYLGFPTGISGQALAARAFQQALKFGAHLAIPGKVTCVDSEDGIHGLTLLDGQRVNARTVVVASGAAYRKPGIAGFDRFEGSGIYYWASPIEAKLVKGQDIVLIGGGNSAGQATVFLANFARSIRVLIRGADLNASMSKYLIDRIGSLPNVSLCTRCTLQALEGDEAGLTHVRVRREDEGDETIETRHLFLFIGADPKTDWLMSSGVELDSHGFVVTGFARRSQTPGGSGIHYPLETSLPGMFAVGDVRSESTKRVASAVGDGAAVVSQIHAYLAHCHAAAQNS
>NZ_CP013104.1|WP_082433927.1|755334_757200_-|helix-turn-helix-transcriptional-regulator
MTRVGPLDIDLTRREARVDGMTVRIGNRAFDILELLIEAQGGLVSKETILERVWPDSVVGDNNLQVHMSALRKLLGDSRDLIKTIAGRGYRLVGSGACVQHEAGASLHDAPHGLVQSAVPNNLPACGSVLVGRDEATAHVSTVLRNARHVTLVGSGGIGKTRVAIEVARRLLEHAPGGVYFVSLGSASDMSCVLAMMASVIGVPPESGCSTRERIVEAIGGRRMLIVLDGCEHVIDGAAQLANHLLNACPHLRVLSTSREPLRIPSETLYWVPALDVPEPNDDTPRVRRCSAVSLFLIRARAIDARFATDDASLHVTGMVCRRLDGIPLAIELAAARAALLGIDTLAAHLDDRFGMLTGGTRTALPRHQTLKATLDWSHALLDEAERKTLRRVGIFADRFPLEAAVAVASDHETRELDVVAAMAALVEKSLVVASTGPGIASFRLLETTRMYARQKLDDNGERRVVALNHARYLSTVIDSNARAAGQCGGERWRSGMPALLDEVRAALGWVLSEDGDAALRETLPANAVFLFYELSLIDECCTWARRALAAIAPADESAHALPRQRARLRLLAALGAALVRVRGPNPETHAIWNEVLASAIASGDRPHADAGSRLISATPL
>NZ_CP013104.1|WP_054932423.1|754380_755301_+|LysR-family-transcriptional-regulator
MNLSFEVLQALDAIDRTGTFAAAAEELHKVPSSLTYLVQKLEVDLGVKLFERTGRRAKLTHAGRVIVEEGRRLLEAARELELKAKRIEHGWESELRVAIDEIIPFDLIWPHVTEFYKLNLGTRLLLSKETLGGTWDALITRRADLVVGAAGEPPPIANLVAKPIGSLQHAFVMAPGHPLASAAEPLTMDAVARHRAVAISDTSRKLTPRTIALAANQEVLTVPTLETKLAAQIRGLGIGTVPECIAAGPLNRGQLVRKEVSGMRSVTHFYLAWRDDEAGKALRWWVDQLDRPDLIDDVAHRLVAMS
>NZ_CP013104.1|WP_060608543.1|751949_754145_-|FUSC-family-protein
MNFDAGVAAWPRWRDELRQYWSDDYPRFRHVAKVAIAATLAMGLCMRLELRGPGTAMVSCIVVMMFQQSGMVIARGFYRGLGMVCGSLAGLVLVSLFSQASWLFLLALAAWIGVCVFGSSYFRNFQSYGFLLTGYATAITSLPTLSNPYGVFDNIVYTISEVVIGVTCASLVSALILPRRVAPDLYAASRNNLGHLFAAIHTLPGATLPQDGFGTMLDLLRERANVQSLRVGAVFEDPSIRLQNHAFIKLDTSFVDTLASAHALHQVIARASAKAGSRTTRAAHELIGSLLAIVPAGLAPDASPELQVDALSAPLAGFERSLQGRVDAALKALEDVPACERVFIDMTGAALHGFAGNLRELCRGFVDARRADQRPWAQSVLRLITHIDSTRATSNRAAAILDGMRAAAAVLSVGAMWLASGWVGGSSALVSVAIVSALFTLAPDPVVASWQMFCGCLAGAIAGFFIAFFVFPLFDCFPLLAACMAFPIVVSSYLNTFPKTATLGLGFGVFFCYTVNIANPVMYHPAEFLDTAFGLSLGIAAAAVAFSTIVPLAGDWISRQYLKQIRSLVTRSTRDDDLEDLSHRFESGMRGFIMRIASAPAGERVDQTRLVASAFAALEVGRAMIVIRQDTARMAAHLPNHWLTLQHAWLDAMAELFSIATPAARDRAMNATQRARRALSRIEPGDSDYATADAQSVKRMRRLMYFTELMLKDDTLPLWQTSAAAAIGASA
>NZ_CP013104.1|WP_054932432.1|768270_768657_-|DUF3331-domain-containing-protein
MLANANVMDPWTQTIGLLGTASRLMAVAEAAAQPRHKTRSADEPVGAQVTLIDRPTPSTATIAWRDSTRGCFGDQVWRMARARMPGFCAMSGQAIRPGDAVYKPNPRPTPVNGDAMILASVLRDAATL
>NZ_CP013104.1|WP_054932433.1|768727_769693_-|helix-turn-helix-transcriptional-regulator
MTTTMLDLHAPLADVVSRRQASPIVAEQQWRRMTASASAHDAATQRDNVVVMRWTHNGDAPLEVSNEGSADDHCIGLNLKCAAMTFDHAGRRLVHGRLTAGAVQVTAPAVPTKAVFASSADVLHLFVSQQVLAECYQDLFQHSRDTGIVLDDPELIRDPVLERLGQALAVSQSNDAALGKMFTDSVSLAIVSHIVARHFAGATRRSREAAPLPQWRMNRVIEFVDAHLAEPIGLADIAASAGLTRMHFAAQFRRATGVRPHEYLLRRRVEHAQHLLVTSKHNVMDVALSCGFRSQAHFTTVFKKFVGETPHRWKEKTNDAR
>NZ_CP013104.1|WP_054930790.1|770774_771449_-|response-regulator-transcription-factor
MSSDEMNDPNQSIVYVVDDDDSMRAAVTMLLRSVGLRVEAFASAQEFLSLDKPDIPSCLILDVRLKGQSGLAVQEQIAAGNVHVPIIFMTAHGDIAMSVKAMKAGAMDFLAKPFRDQDMLDAVATALAKDEERRKSERSVSDLRKRYESLTPREREVMAFVASGLMNKQIAAEMNLSEITVKIHRGQAMKKMESRSLADFVLKAEALGVKSLEGGASARTQRGV
>NZ_CP013104.1|WP_082670503.1|771438_773640_-|PAS-domain-S-box-protein
MMFRQAAGMTSARDARVLFSLAGIVGVIVFVIDALTPLDIAIAVLYVVVVMLVASTGLRHATIATACACAALTVIAFLMSHDENYSGGSIARGIVSLLAIGTTSFLSLRNQANTARLQEQIQLLNLTHDAIVAYDMSDRITFWNQGAEELYGWTAEQAIGQRIHELTRTSSSIPVHELRDEVVRKGRWEGELERVRSDGSSVIVSSRFALWRDDKGRPRAILATNNDITMRKRMEAELQRQQEDLRATIDAIPGMVWSSSRDGELSYINRRWNELGITLTGGSGDVWTSIVHPDDWPAMHAAWRGAIATGKPFENVARIRQSNGSYRWMHIGADPLRDQNGQILRWYGVNTDIEERKQAEQALERSEAFLSDAQRLSRTGSIATRLPAGAMWWSDETYRIFEYSPDYTPGMELILARTHPDDLALVREAYESGRSGAPYVDVEHRLQMPDGRIKYVHYVAHLAVPQSASIEYVGALMDVTERHLAQDALDRSTAELAHVTRVTMLGELAASIAHEVTQPLAAIVTAGDAATRWLNRAKPDLGEVGQSISQMVRDAKRASDVIRQIRSMAQKRDPSQAVLDLNGIVRESIELVRRELDAARVELEASYAEPPPLVCGDRVQLQQVVINLVMNGVQAMAGITGQARRMCIATSRVDGHYGQVAVEDSGTGISEENVGRLFNAFFTTKADGMGMGLSICRSIVEAHGGRIWAESEEGRGATMQFVLPIDKGTCDEQ
>NZ_CP013104.1|WP_054930791.1|773965_774346_-|response-regulator
MHNHPIASVIDDDESVRTAMSSLVRSLDWDVRLYASAEAFLASDVDQVACIISDVQMPGMSGLDMYRHLLDKGVTQPIIFISAFASDAVRRQALDLGAMCVLTKPVDGAEVSRCLARLEPDGSQGE
>NZ_CP013104.1|WP_098021693.1|774641_774929_+|H-NS-histone-family-protein
MHRLFANEENNVSAVIEHLEGEARERLIVWLKRRMQECNITLEALQHALQQDIDEAKRVRYRDASGNTWTGDGEHPEWLRRAVAAGQSVDHFLCE
>NZ_CP013104.1|WP_060608561.1|775117_776029_-|PilZ-domain-containing-protein
MPLVPLSQREVTIGVPLPFSVYTADGRLLMARGHIIHSAAQCERLFVQGPFRQPFPGERREDARPEDADITPPSAGRARRGHEDQTLVGPFPVSGCIPEDFVITLANGPAISSRTRFVGALDDVSLLLAGAGVDPAFAPGEAVEGQFIAGRYRHAFESEVVGRHTSPFDVLYLRYPTEVRSRALRRHVRVGIDVTARLSQNDRPMAGTEVRAVDLSAAGVGLLVNANSNSLAPGEHFKLSLPLARAGRVRTAPLNCIARNRRTKDGETLVGAEFGNTSGDVRALVKEYVLDVLTGAVPPERHA
>NZ_CP013104.1|WP_060608564.1|776343_776769_+|glyoxalase
MTTQALTSGIDHVGLAVRDLNLTRDFFVECLQWKQVGEKPDYPAAFVSDGHVMLTLWQVTNQANLVAFDRKTNVGLHHLALRVGSEEALSEIFRRVSQWPGVKVEFAPENLGAGPKRHTMIYEPGGIRLEFDFDPRLKAAG
>NZ_CP013104.1|WP_054930793.1|776938_777886_+|LysR-family-transcriptional-regulator
MDQLYMLRAFVSAAQHQSFSKAAASLGVTTGSISKAIAKLETSIQTRVLHRTTRSVTLTEEAQSYYLSCCRLLEELDEANRRIMREREVDSGKLRLVIHPMLVSETFSQFLSSYRAVAPNVNLVVSVDEGAVNLYDGQFDMAMLPPHQVEQSAVIRRTLFKSSRSLVASADYLAQRGTPHRAADLAGHFLLLPSQSRQRSTNYVQVIENGQPVQVIPMSSMDGNDVLLRAAALAGAGIAELPEAMAREDVAMGKLVPVLPGCSISDSEVEICLFYSHRELLPARFRTFVDFCTEFFRLNSARRRAPLPDAQAQAA
>NZ_CP013104.1|WP_054930794.1|777895_778783_-|LysR-family-transcriptional-regulator
MDVADLKVFEAVARHGSMNRAAAELHTVQSNVTARIRSLEREIGVALFQRHVRGVSLTPAGQRMLPYAARIAKLLADARLAALDDGPPAGALALGTLETTAALRLSPILSNFARIYPQVRLSLTTGTSCSLTEDVAACRLDGAFVAGPVEHPELHAEMIFQEELVLVTPRNLRAMDALRAVPELKTIVFRLGCSYRQRLEALLAEMGIVTATPLEFGSLDAIIACVAAGIGVTLLPRGVVSGAAEQDIVALHSLPPEKAQVATLFIRRHDAYVSSAMQAFVEVTRSRLGPVMAAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP013104_1	1.1\|768027\|38\|NZ_CP013104\|CRISPRCasFinder	768027-768064	38	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	768027-768064	0	1.0
NZ_CP013104_1	1.1\|768027\|38\|NZ_CP013104\|CRISPRCasFinder	768027-768064	38	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	508524-508561	3	0.921
NZ_CP013104_1	1.1\|768027\|38\|NZ_CP013104\|CRISPRCasFinder	768027-768064	38	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1036100-1036137	5	0.868

1. spacer 1.1|768027|38|NZ_CP013104|CRISPRCasFinder matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 0, identity: 1.0

aaaaggccgataacaccgaacggcgacgcgtgaagcac	CRISPR spacer
aaaaggccgataacaccgaacggcgacgcgtgaagcac	Protospacer
**************************************

2. spacer 1.1|768027|38|NZ_CP013104|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.921

aaaaggccgataacaccgaacggcgacgcgtgaagcac	CRISPR spacer
caaaggccgataacaccgaacggcgacgcgtgaagcga	Protospacer
 ***********************************.

3. spacer 1.1|768027|38|NZ_CP013104|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.868

--aaaaggccgataacaccgaacggcgacgcgtgaagcac	CRISPR spacer
ccaaaacacca--aacaccgaacggcgacgcgtgaagcac	Protospacer
  **** .**.  ***************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 11066

Klosneuvirus(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054931806.1\|929_1940_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_054931807.1\|2190_2535_-	DUF861 domain-containing protein	NA	NA	NA	NA
WP_060607325.1\|2579_3557_-	succinylglutamate desuccinylase	NA	NA	NA	NA
WP_060607328.1\|3553_5026_-	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_060607331.1\|5043_6123_-	tartrate dehydrogenase	NA	NA	NA	NA
WP_060607334.1\|6264_7182_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_054931812.1\|7175_7673_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_054931813.1\|7717_9130_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	4.5e-12	24.3
WP_054931815.1\|10139_11066_-	glyoxylate/hydroxypyruvate reductase A	M1HUW8	Acanthocystis_turfacea_Chlorella_virus	2.0e-05	23.3

DBSCAN-SWA_2

14235 : 18023

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060607343.1\|14235_16392_+	hybrid sensor histidine kinase/response regulator	A0A1V0SGX0	Hokovirus	1.4e-41	32.5
WP_060607346.1\|16388_18023_+	response regulator	W8CYM9	Bacillus_phage	7.5e-11	33.6

DBSCAN-SWA_3

39358 : 40225

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060607396.1\|39358_40225_-	formate/nitrite transporter family protein	E7DYY8	Enterobacteria_phage	7.6e-39	37.8

DBSCAN-SWA_4

63065 : 64088

Gordonia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082670479.1\|63065_64088_-	M23 family metallopeptidase	A0A2P1JY73	Gordonia_phage	4.4e-17	48.0

DBSCAN-SWA_5

74187 : 75806

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060607469.1\|74187_74943_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.8e-29	34.8
WP_060607472.1\|74939_75806_-	ABC transporter permease	G3M9Y4	Bacillus_virus	8.8e-19	25.6

DBSCAN-SWA_6

102749 : 103562

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060607532.1\|102749_103562_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.6e-28	33.8

DBSCAN-SWA_7

107191 : 108013

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054931903.1\|107191_108013_+	alpha/beta hydrolase	A0A2P1JTI7	Mycobacterium_phage	1.4e-18	27.8

DBSCAN-SWA_8

117042 : 117834

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054931912.1\|117042_117834_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.8e-34	38.9

DBSCAN-SWA_9

133765 : 137283

uncultured_Caudovirales_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060607584.1\|133765_134929_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	8.5e-17	34.7
WP_082670481.1\|135203_135695_+	hypothetical protein	A0A2H4JHK7	uncultured_Caudovirales_phage	3.0e-08	69.7
WP_082670554.1\|135846_136242_-	type I addiction module toxin, SymE family	NA	NA	NA	NA
WP_082670555.1\|136140_137283_+	RHS repeat-associated core domain-containing protein	A0A2H4JFP5	uncultured_Caudovirales_phage	8.8e-43	49.2

DBSCAN-SWA_10

140975 : 154395

Indivirus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060607592.1\|140975_142904_+	branched-chain amino acid ABC transporter ATP-binding protein/permease	A0A1V0SE00	Indivirus	4.1e-08	21.8
WP_054931936.1\|142950_143679_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.4e-14	25.4
WP_060607596.1\|143882_145205_+	TIGR00366 family protein	NA	NA	NA	NA
WP_060607598.1\|145268_146300_+	histone deacetylase family protein	A0A2K9L0J7	Tupanvirus	6.1e-35	38.2
WP_054931939.1\|146449_146728_+	hypothetical protein	NA	NA	NA	NA
WP_060610367.1\|146750_147359_-	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
WP_060607603.1\|147648_150882_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	3.1e-61	23.9
WP_060610370.1\|150883_152122_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_054931941.1\|152118_153630_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_007576885.1\|153708_154395_+	heavy metal response regulator transcription factor	Q6XM27	Feldmannia_irregularis_virus	4.2e-08	25.6

DBSCAN-SWA_11

192265 : 193237

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060607642.1\|192265_193237_+	CbbX protein	V5UQM2	Mycobacterium_phage	1.5e-35	38.0

DBSCAN-SWA_12

233820 : 235283

Brazilian_cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060607728.1\|233820_234576_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	5.5e-09	29.0
WP_060607732.1\|234572_235283_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.1e-14	25.2

DBSCAN-SWA_13

244100 : 248462

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060607749.1\|244100_245126_-	decarboxylating 6-phosphogluconate dehydrogenase	E3SKF4	Synechococcus_phage	2.7e-91	51.6
WP_060607753.1\|245608_246688_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_082670485.1\|246684_247683_+	ABC transporter permease	NA	NA	NA	NA
WP_060607755.1\|247682_248462_+	sugar ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.8e-16	30.8

DBSCAN-SWA_14

253748 : 254696

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060607763.1\|253748_254696_+	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	1.9e-06	37.0

DBSCAN-SWA_15

269897 : 270914

Moumouvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054932037.1\|269897_270914_+	alcohol dehydrogenase catalytic domain-containing protein	M1PHA2	Moumouvirus	4.9e-21	26.8

DBSCAN-SWA_16

287746 : 289246

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060610392.1\|287746_289246_+	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	1.3e-22	37.9

DBSCAN-SWA_17

295421 : 296492

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060607829.1\|295421_296492_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.3e-29	34.9

DBSCAN-SWA_18

304697 : 313294

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060607844.1\|304697_307409_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	8.5e-52	25.8
WP_060607847.1\|307411_308821_+	hypothetical protein	NA	NA	NA	NA
WP_060607850.1\|308849_309629_+	hypothetical protein	NA	NA	NA	NA
WP_060607853.1\|309634_311548_-	MBL fold metallo-hydrolase	A0A2P0VMX1	Tetraselmis_virus	5.8e-132	38.8
WP_060607856.1\|311626_313294_-	GMC family oxidoreductase	A0A1V0SI18	Klosneuvirus	1.1e-57	30.6

DBSCAN-SWA_19

316419 : 316881

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054932076.1\|316419_316881_-	RidA family protein	M1I5B0	Acanthocystis_turfacea_Chlorella_virus	1.0e-21	40.3

DBSCAN-SWA_20

323253 : 326199

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060607877.1\|323253_326199_-	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	1.3e-08	29.4

DBSCAN-SWA_21

335950 : 337429

Micromonas_pusilla_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060607901.1\|335950_337429_+	mannitol dehydrogenase family protein	G9E6E2	Micromonas_pusilla_virus	7.1e-45	31.8

DBSCAN-SWA_22

351041 : 352574

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060610404.1\|351041_352574_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	9.1e-11	37.6

DBSCAN-SWA_23

364428 : 369803

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060607944.1\|364428_366102_+	alanine-phosphoribitol ligase	A0A1V0SI18	Klosneuvirus	2.9e-58	33.0
WP_054932104.1\|366190_367270_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_082670490.1\|367266_368286_+	ABC transporter permease	NA	NA	NA	NA
WP_054932105.1\|368303_369803_+	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	9.9e-18	30.3

DBSCAN-SWA_24

376828 : 378316

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_063803392.1\|376828_378316_+	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.3e-13	28.4

DBSCAN-SWA_25

403364 : 406142

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060610415.1\|403364_406142_+	ribosome-associated ATPase/putative transporter RbbA	A0A2H4PQG7	Staphylococcus_phage	1.0e-20	28.6

DBSCAN-SWA_26

411494 : 413324

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060608011.1\|411494_413324_+	carbamoyltransferase	A0A1B1IVF2	uncultured_Mediterranean_phage	1.0e-64	32.3

DBSCAN-SWA_27

418269 : 419781

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054932148.1\|418269_419781_-	PAS domain-containing sensor histidine kinase	A0A1V0SGX0	Hokovirus	9.3e-24	21.1

DBSCAN-SWA_28

425952 : 426651

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054932155.1\|425952_426651_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.5e-40	41.0

DBSCAN-SWA_29

433263 : 437679

uncultured_virus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054932159.1\|433263_434886_-	chaperonin GroEL	A0A240F779	uncultured_virus	4.2e-131	47.2
WP_060608045.1\|435063_437025_+	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	E5EQU5	Bathycoccus_sp._RCC1105_virus	6.0e-100	42.6
WP_060608048.1\|437241_437679_+	Hsp20/alpha crystallin family protein	A0A218MMV3	uncultured_virus	2.8e-05	30.0

DBSCAN-SWA_30

445104 : 452292

Hokovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054932168.1\|445104_447543_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	9.7e-156	34.1
WP_060608067.1\|447552_448557_+	1-phosphofructokinase family hexose kinase	NA	NA	NA	NA
WP_060608070.1\|448826_449135_-	hypothetical protein	NA	NA	NA	NA
WP_060608076.1\|449879_450749_-	LOG family protein	A0A1D8KU27	Synechococcus_phage	2.2e-09	33.8
WP_148654641.1\|450952_451369_+	hypothetical protein	NA	NA	NA	NA
WP_054932177.1\|451599_452292_+	CBS domain-containing protein	A0A2I6B2H4	Macacine_betaherpesvirus	8.9e-06	25.4

DBSCAN-SWA_31

478324 : 482045

Macacine_betaherpesvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060608108.1\|478324_479020_-	CBS domain-containing protein	A0A2I6B2H4	Macacine_betaherpesvirus	2.3e-06	25.4
WP_060608111.1\|479201_482045_-	AMP-binding protein	A0A1V0SBX8	Catovirus	2.6e-19	23.6

DBSCAN-SWA_32

486619 : 487324

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060608121.1\|486619_487324_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.6e-34	35.1

DBSCAN-SWA_33

491113 : 493405

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060608130.1\|491113_493405_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.9e-57	29.4

DBSCAN-SWA_34

506745 : 507408

Feldmannia_species_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054932217.1\|506745_507408_+	response regulator transcription factor	B5LWA6	Feldmannia_species_virus	1.3e-06	28.2

DBSCAN-SWA_35

517221 : 518373

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060608177.1\|517221_518373_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	6.6e-22	31.7

DBSCAN-SWA_36

529292 : 530018

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060608195.1\|529292_530018_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-30	39.4

DBSCAN-SWA_37

535589 : 546050

uncultured_Caudovirales_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060608210.1\|535589_537158_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	9.3e-11	31.6
WP_054932241.1\|537546_538404_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_054932242.1\|538422_539085_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_060608213.1\|539100_539778_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_060608214.1\|539774_540617_+	amino acid ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.0e-11	23.7
WP_060608215.1\|540613_541879_+	M20 family metallo-hydrolase	NA	NA	NA	NA
WP_060608221.1\|541891_542614_+	urea carboxylase-associated family protein	NA	NA	NA	NA
WP_082433916.1\|542659_543364_+	cupin domain-containing protein	NA	NA	NA	NA
WP_082670559.1\|543408_544359_+	agmatinase	A0A1V0SJM8	Klosneuvirus	7.4e-11	27.1
WP_060608222.1\|544374_545271_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_054932249.1\|545270_546050_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	9.9e-30	40.3

DBSCAN-SWA_38

551195 : 555275

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060608228.1\|551195_555275_-	transporter substrate-binding domain-containing protein	A0A1V0SGX0	Hokovirus	2.8e-38	41.0

DBSCAN-SWA_39

568477 : 568966

Ralstonia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054932268.1\|568477_568966_+	lytic transglycosylase domain-containing protein	A0A0A8J856	Ralstonia_phage	2.3e-08	43.2

DBSCAN-SWA_40

576738 : 579285

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060608271.1\|576738_579285_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	9.4e-53	27.4

DBSCAN-SWA_41

585554 : 586853

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054932277.1\|585554_586853_+	MFS transporter	Q6JIH2	Burkholderia_virus	3.4e-59	35.8

DBSCAN-SWA_42

591545 : 592604

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082670497.1\|591545_592604_-	acyltransferase	A0A2H4JA46	uncultured_Caudovirales_phage	2.6e-17	29.1

DBSCAN-SWA_43

633348 : 634641

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060608376.1\|633348_634641_-	MSMEG_0569 family flavin-dependent oxidoreductase	A0A2H4J2Q2	uncultured_Caudovirales_phage	1.5e-06	30.7

DBSCAN-SWA_44

646576 : 647416

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054932331.1\|646576_647416_+	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	1.2e-07	30.0

DBSCAN-SWA_45

656970 : 661136

Hepacivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060608409.1\|656970_658641_-	AMP-binding protein	Q75ZG1	Hepacivirus	7.3e-38	26.7
WP_060608417.1\|658934_660032_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_060608420.1\|660200_661136_+	histone deacetylase family protein	A0A2K9L2T7	Tupanvirus	1.2e-34	29.5

DBSCAN-SWA_46

670675 : 672025

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054932352.1\|670675_672025_-	MFS transporter	Q6JIH2	Burkholderia_virus	1.6e-14	25.0

DBSCAN-SWA_47

686917 : 688462

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054932371.1\|686917_688462_-	PDZ domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	1.4e-11	25.6

DBSCAN-SWA_48

696309 : 703925

uncultured_virus(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060608462.1\|696309_697296_+	zinc-dependent alcohol dehydrogenase family protein	A0A2K9L7I1	Tupanvirus	1.3e-23	35.9
WP_054932376.1\|697662_698118_+	RidA family protein	M1I5B0	Acanthocystis_turfacea_Chlorella_virus	1.1e-17	35.3
WP_148654644.1\|698488_698809_-	hypothetical protein	NA	NA	NA	NA
WP_060608468.1\|698896_699271_-	hypothetical protein	NA	NA	NA	NA
WP_060608471.1\|700073_700514_+	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_054932380.1\|700528_700936_+	Hsp20/alpha crystallin family protein	A0A1B2LRT2	Wolbachia_phage	5.0e-09	31.6
WP_148654645.1\|701193_701394_+	hypothetical protein	NA	NA	NA	NA
WP_054932382.1\|701565_701820_-	hypothetical protein	NA	NA	NA	NA
WP_060608477.1\|701922_703545_-	chaperonin GroEL	A0A240F779	uncultured_virus	5.8e-173	59.5
WP_054932386.1\|703610_703925_-	co-chaperone GroES	A0A221S322	uncultured_virus	3.3e-16	45.7

DBSCAN-SWA_49

709123 : 711037

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060608485.1\|709123_711037_-	AAA family ATPase	A0A0P0BXI2	Ostreococcus_lucimarinus_virus	2.4e-69	31.1

DBSCAN-SWA_50

715265 : 715997

Mollivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054932394.1\|715265_715997_-	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	3.4e-08	38.0

DBSCAN-SWA_51

724305 : 725085

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060608500.1\|724305_725085_+	2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD	Q06VL0	Trichoplusia_ni_ascovirus	1.9e-17	31.5

DBSCAN-SWA_52

743779 : 744622

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060608534.1\|743779_744622_-	alpha/beta hydrolase	G1BRG0	Mycobacterium_phage	5.7e-15	29.7

DBSCAN-SWA_53

768727 : 773640

Bordetella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054932433.1\|768727_769693_-	helix-turn-helix transcriptional regulator	A0A291LAM3	Bordetella_phage	2.8e-13	30.7
WP_054930790.1\|770774_771449_-	response regulator transcription factor	NA	NA	NA	NA
WP_082670503.1\|771438_773640_-	PAS domain S-box protein	Q8QNA2	Ectocarpus_siliculosus_virus	1.7e-05	32.5

DBSCAN-SWA_54

798526 : 802683

Tetraselmis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054930813.1\|798526_799384_-	SDR family NAD(P)-dependent oxidoreductase	A0A2P0VP75	Tetraselmis_virus	3.2e-05	28.3
WP_060608576.1\|799503_800433_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_054930815.1\|800511_802683_-	peptidase M1	A0A0P0IY26	Acinetobacter_phage	6.2e-45	24.4

DBSCAN-SWA_55

806843 : 807737

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054930819.1\|806843_807737_+	transcriptional regulator CynR	A0A2P0ZL89	Lactobacillus_phage	3.2e-16	26.3

DBSCAN-SWA_56

812099 : 812849

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060608590.1\|812099_812849_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	8.1e-21	33.3

DBSCAN-SWA_57

829308 : 837443

Erysipelothrix_phage(33.33%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060608615.1\|829308_830709_+	mercuric reductase	A0A2K5B2C5	Erysipelothrix_phage	1.5e-60	31.4
WP_060608618.1\|830903_831146_-	hypothetical protein	NA	NA	NA	NA
WP_082670331.1\|831933_833199_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	7.7e-40	42.8
WP_158512192.1\|833143_833452_-	hypothetical protein	NA	NA	NA	NA
WP_054930863.1\|833747_834146_-	host attachment protein	NA	NA	NA	NA
WP_060608621.1\|834614_837443_+\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A223W0B1	Agrobacterium_phage	4.2e-126	36.6

DBSCAN-SWA_58

847419 : 850894

Moraxella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060608639.1\|847419_849813_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	2.1e-155	40.7
WP_060608642.1\|849835_850894_-	Dyp-type peroxidase	A0A0M5KAH8	Mollivirus	4.8e-19	28.1

DBSCAN-SWA_59

856217 : 858242

Yellowstone_lake_phycodnavirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060608653.1\|856217_856784_-	type 1 glutamine amidotransferase	A0A0N7KVR4	Yellowstone_lake_phycodnavirus	5.9e-16	34.4
WP_082670564.1\|857069_858242_-	alcohol dehydrogenase catalytic domain-containing protein	A0A2K9L7I1	Tupanvirus	3.2e-08	25.7

DBSCAN-SWA_60

884001 : 887968

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060610504.1\|884001_887187_-	EAL domain-containing protein	G3MA91	Bacillus_virus	9.7e-23	37.8
WP_060608695.1\|887389_887968_-	AAA family ATPase	A0A219VHB7	Ochrobactrum_phage	4.8e-05	40.6

DBSCAN-SWA_61

896366 : 900786

uncultured_virus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082670303.1\|896366_897632_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.6e-40	43.3
WP_060608711.1\|898018_899368_-	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_054930920.1\|899370_899619_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_060608714.1\|899835_900786_+	chemotaxis protein CheV	Q56AR1	Bacillus_thuringiensis_phage	1.2e-29	30.1

DBSCAN-SWA_62

909266 : 910702

Organic_Lake_phycodnavirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060608729.1\|909266_909971_-	ATP-binding cassette domain-containing protein	F2Y2R6	Organic_Lake_phycodnavirus	5.8e-13	28.4
WP_054930929.1\|909982_910702_-	ABC transporter ATP-binding protein	A0A2K9L0W2	Tupanvirus	3.1e-09	24.7

DBSCAN-SWA_63

921071 : 922486

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035993549.1\|921071_921779_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.9e-17	30.3
WP_054930935.1\|921775_922486_-	ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	1.8e-09	25.1

DBSCAN-SWA_64

946150 : 947557

Tupanvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060608774.1\|946150_947557_-\|tRNA	cysteine--tRNA ligase	A0A2K9L6B7	Tupanvirus	4.0e-29	34.0

DBSCAN-SWA_65

969846 : 971034

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060610517.1\|969846_971034_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.3e-28	35.1

DBSCAN-SWA_66

990771 : 991452

Cronobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054931041.1\|990771_991452_+	glycoside hydrolase family 19 protein	F1C5D2	Cronobacter_phage	2.7e-39	44.4

DBSCAN-SWA_67

998303 : 999815

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060608869.1\|998303_999815_-	amino acid ABC transporter permease/ATP-binding protein	A0A1V0SE00	Indivirus	8.1e-12	26.6

DBSCAN-SWA_68

1011878 : 1012622

Mollivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054931002.1\|1011878_1012622_+	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	8.6e-23	32.8

DBSCAN-SWA_69

1020826 : 1022440

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060608901.1\|1020826_1022440_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-17	30.2

DBSCAN-SWA_70

1029453 : 1034631

Acinetobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060610542.1\|1029453_1032132_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	3.0e-33	24.4
WP_054931014.1\|1032795_1034631_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.3e-31	25.0

DBSCAN-SWA_71

1038381 : 1039227

Micromonas_pusilla_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060608915.1\|1038381_1039227_+	transketolase	G9E5U1	Micromonas_pusilla_virus	5.6e-10	33.1

DBSCAN-SWA_72

1043086 : 1043827

Mollivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060608923.1\|1043086_1043827_-	3-oxoacyl-ACP reductase FabG	A0A0M4JSW6	Mollivirus	1.5e-06	27.6

DBSCAN-SWA_73

1047603 : 1048869

uncultured_virus(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082670331.1\|1047603_1048869_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	7.7e-40	42.8

DBSCAN-SWA_74

1064411 : 1065440

Moumouvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054931061.1\|1064411_1065440_+	alpha/beta hydrolase	A0A2P1EM31	Moumouvirus	8.7e-58	40.5

DBSCAN-SWA_75

1068505 : 1070017

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060608958.1\|1068505_1070017_+	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.3e-21	29.5

DBSCAN-SWA_76

1089008 : 1090712

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060608996.1\|1089008_1090712_-	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	5.6e-09	54.9

DBSCAN-SWA_77

1101908 : 1102997

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609011.1\|1101908_1102997_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.6e-28	35.3

DBSCAN-SWA_78

1109759 : 1110671

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609021.1\|1109759_1110671_-	alpha/beta fold hydrolase	A0A2K9L3Q7	Tupanvirus	6.2e-07	30.6

DBSCAN-SWA_79

1116311 : 1122665

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082670512.1\|1116311_1118657_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	2.2e-08	34.7
WP_148654651.1\|1118986_1119364_-	hypothetical protein	NA	NA	NA	NA
WP_082670567.1\|1120377_1121055_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_054931106.1\|1121282_1122665_-	ammonium transporter	H8ZJB2	Ostreococcus_tauri_virus	2.2e-32	31.2

DBSCAN-SWA_80

1144259 : 1145411

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609078.1\|1144259_1145411_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.3e-29	33.8

DBSCAN-SWA_81

1162764 : 1176251

Tupanvirus(16.67%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082670569.1\|1162764_1163937_+	alcohol dehydrogenase catalytic domain-containing protein	A0A2K9L7I1	Tupanvirus	3.2e-08	25.2
WP_054931159.1\|1164628_1165639_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_060609100.1\|1166079_1166382_+	hypothetical protein	NA	NA	NA	NA
WP_060609103.1\|1166411_1169069_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	8.3e-153	34.4
WP_060609106.1\|1169359_1170061_-	fatty acid hydroxylase	NA	NA	NA	NA
WP_054931230.1\|1170123_1171500_-	MFS transporter	Q6JIH2	Burkholderia_virus	6.9e-26	27.0
WP_060609109.1\|1171567_1173289_-\|holin	glucose-methanol-choline oxidoreductase	A0A2P1EMT4	Moumouvirus	1.3e-26	25.0
WP_054931164.1\|1173334_1174141_-	crotonase	NA	NA	NA	NA
WP_060609111.1\|1174147_1175722_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	9.0e-30	25.2
WP_060609114.1\|1175714_1176251_-	(2Fe-2S)-binding protein	A0A0P0IVM8	Acinetobacter_phage	5.6e-16	40.5

DBSCAN-SWA_82

1191726 : 1192473

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060610591.1\|1191726_1192473_+	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	1.4e-20	36.8

DBSCAN-SWA_83

1221010 : 1226965

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609170.1\|1221010_1226965_-	AAA family ATPase	A0A1V0SDC3	Indivirus	3.3e-08	25.4

DBSCAN-SWA_84

1232052 : 1233228

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609183.1\|1232052_1233228_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.4e-11	28.7

DBSCAN-SWA_85

1237802 : 1239425

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609192.1\|1237802_1239425_-	AAA family ATPase	A0A223LDM4	Bacillus_phage	5.9e-109	43.5

DBSCAN-SWA_86

1249780 : 1250548

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054931237.1\|1249780_1250548_+	3-oxoacyl-ACP reductase FabG	A0A0K0KVL6	Prochlorococcus_phage	8.3e-05	24.4

DBSCAN-SWA_87

1266572 : 1267382

Diadromus_pulchellus_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609232.1\|1266572_1267382_-	SDR family oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	4.7e-14	30.9

DBSCAN-SWA_88

1273766 : 1275515

Aeromonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609242.1\|1273766_1275515_-	solute:sodium symporter family transporter	A0A240F3J2	Aeromonas_phage	9.3e-44	28.7

DBSCAN-SWA_89

1284381 : 1286666

uncultured_virus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082670521.1\|1284381_1285647_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	7.7e-40	42.8
WP_054931361.1\|1285844_1286666_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	2.0e-28	31.7

DBSCAN-SWA_90

1294898 : 1295888

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609290.1\|1294898_1295888_+	alpha/beta hydrolase	W8EKH7	Mycobacterium_phage	4.8e-13	28.2

DBSCAN-SWA_91

1301193 : 1302000

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609298.1\|1301193_1302000_+	2,5-didehydrogluconate reductase DkgB	A0A2H4PQR8	Staphylococcus_phage	2.5e-36	34.5

DBSCAN-SWA_92

1306039 : 1307374

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609309.1\|1306039_1307374_-	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	1.7e-08	21.1

DBSCAN-SWA_93

1335344 : 1343051

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609344.1\|1335344_1336334_+	2-hydroxyacid dehydrogenase	A0A1V0SBV6	Catovirus	3.6e-16	27.2
WP_060609347.1\|1336409_1336682_+	DUF2934 domain-containing protein	NA	NA	NA	NA
WP_060609352.1\|1336769_1337531_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	6.8e-92	71.6
WP_060609355.1\|1337533_1338625_-	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
WP_060609358.1\|1338611_1339133_-	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	2.0e-26	43.2
WP_060609361.1\|1339129_1339597_-	hypothetical protein	NA	NA	NA	NA
WP_009771446.1\|1339593_1339926_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_060609364.1\|1340526_1341504_+	chromate resistance protein	NA	NA	NA	NA
WP_060610618.1\|1341707_1343051_+	chromate efflux transporter	A0A219VHC2	Ochrobactrum_phage	2.9e-29	67.4

DBSCAN-SWA_94

1358654 : 1359512

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609385.1\|1358654_1359512_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.8e-30	34.4

DBSCAN-SWA_95

1366709 : 1369814

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609406.1\|1366709_1369814_-	multidrug transporter	S5VTK5	Leptospira_phage	5.1e-61	21.8

DBSCAN-SWA_96

1381311 : 1382073

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609423.1\|1381311_1382073_+	response regulator	W8CYM9	Bacillus_phage	4.5e-27	32.0

DBSCAN-SWA_97

1398971 : 1400102

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609469.1\|1398971_1400102_-	HAMP domain-containing histidine kinase	A0A1B0VMK3	Pseudomonas_phage	4.0e-56	38.3

DBSCAN-SWA_98

1408778 : 1410125

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060610627.1\|1408778_1410125_+	DUF1254 domain-containing protein	M1I2Z8	Paramecium_bursaria_Chlorella_virus	1.6e-30	27.3

DBSCAN-SWA_99

1438714 : 1444963

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609529.1\|1438714_1440298_+	Na+/H+ antiporter	A0A2H4J178	uncultured_Caudovirales_phage	2.7e-10	31.0
WP_098021728.1\|1440782_1442024_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_060609537.1\|1442020_1444963_+	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	6.9e-15	34.4

DBSCAN-SWA_100

1449386 : 1452593

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054931350.1\|1449386_1452593_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	8.7e-64	22.9

DBSCAN-SWA_101

1456308 : 1458192

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609549.1\|1456308_1458192_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.9e-13	30.8

DBSCAN-SWA_102

1462750 : 1464097

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054931357.1\|1462750_1464097_-	MFS transporter	Q6JIH2	Burkholderia_virus	5.0e-45	31.4

DBSCAN-SWA_103

1472820 : 1474407

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609561.1\|1472820_1474407_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	4.4e-16	25.3

DBSCAN-SWA_104

1485810 : 1487376

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609591.1\|1485810_1487376_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	7.6e-13	37.2

DBSCAN-SWA_105

1496869 : 1499971

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609601.1\|1496869_1498675_+	ABC transporter ATP-binding protein/permease	G3M9Y6	Bacillus_virus	1.5e-12	32.6
WP_063803405.1\|1498744_1499971_+	thioredoxin	A0A1J0GW78	Streptomyces_phage	9.2e-14	37.6

DBSCAN-SWA_106

1504477 : 1505647

Faustovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609611.1\|1504477_1505647_+	aminotransferase class V-fold PLP-dependent enzyme	A0A1X7C038	Faustovirus	1.8e-27	28.2

DBSCAN-SWA_107

1508771 : 1512289

Escherichia_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609616.1\|1508771_1509965_+	AAA family ATPase	A0A077SLJ9	Escherichia_phage	7.0e-67	39.9
WP_060609619.1\|1510354_1511266_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	2.4e-06	24.6
WP_054931411.1\|1511419_1512289_+	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	1.2e-23	29.0

DBSCAN-SWA_108

1516591 : 1517812

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609626.1\|1516591_1517812_-	acetylornithine/succinyldiaminopimelate transaminase	A0A1V0SKB7	Klosneuvirus	1.4e-22	26.5

DBSCAN-SWA_109

1528032 : 1532738

EBPR_podovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609648.1\|1528032_1528473_-	hypothetical protein	F8TUL1	EBPR_podovirus	4.0e-12	36.0
WP_060609651.1\|1528588_1529473_-	hypothetical protein	NA	NA	NA	NA
WP_060609654.1\|1529758_1530994_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_060609658.1\|1531013_1532738_-	PQQ-dependent dehydrogenase, methanol/ethanol family	S4VRB1	Pandoravirus	2.3e-10	21.5

DBSCAN-SWA_110

1547498 : 1549583

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054931441.1\|1547498_1549583_+	bifunctional diguanylate cyclase/phosphodiesterase	G3MA91	Bacillus_virus	8.0e-26	39.9

DBSCAN-SWA_111

1573380 : 1579375

Lactobacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609723.1\|1573380_1575150_-	FAD-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	2.7e-14	25.6
WP_082670573.1\|1575216_1575978_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.0e-14	29.9
WP_060609728.1\|1575983_1576826_-	shikimate dehydrogenase	NA	NA	NA	NA
WP_060609731.1\|1576822_1579375_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.7e-09	26.0

DBSCAN-SWA_112

1582869 : 1585629

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609737.1\|1582869_1583778_-	NAD(P)-dependent oxidoreductase	A0A1V0SKV4	Klosneuvirus	4.3e-08	25.3
WP_060609740.1\|1583883_1585629_+	FAD-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	3.1e-15	28.9

DBSCAN-SWA_113

1595594 : 1597304

uncultured_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609756.1\|1595594_1597304_-	glycosyltransferase family protein	D6PFH9	uncultured_phage	1.8e-07	32.9

DBSCAN-SWA_114

1606437 : 1608240

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609773.1\|1606437_1608240_+	biosynthetic-type acetolactate synthase large subunit	A0A0P0CDR3	Ostreococcus_lucimarinus_virus	1.4e-58	30.1

DBSCAN-SWA_115

1622847 : 1624113

uncultured_virus(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082670331.1\|1622847_1624113_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	7.7e-40	42.8

DBSCAN-SWA_116

1661805 : 1667866

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609866.1\|1661805_1663359_-	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.5e-13	37.1
WP_060609869.1\|1664123_1666286_+	hybrid sensor histidine kinase/response regulator	A0A1V0SGX0	Hokovirus	3.7e-42	32.2
WP_060609873.1\|1666282_1667866_+	response regulator	W8CYM9	Bacillus_phage	7.2e-11	33.6

DBSCAN-SWA_117

1672979 : 1679035

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_063803407.1\|1672979_1674704_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.4e-12	32.3
WP_060610694.1\|1675259_1676780_+	sensor domain-containing diguanylate cyclase	NA	NA	NA	NA
WP_060609882.1\|1677427_1679035_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.1e-10	65.6

DBSCAN-SWA_118

1684420 : 1689720

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082670540.1\|1684420_1686142_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.1e-11	62.5
WP_146174440.1\|1686406_1686712_-	hypothetical protein	NA	NA	NA	NA
WP_060610699.1\|1687076_1687421_-	DoxX family protein	NA	NA	NA	NA
WP_060609889.1\|1687749_1689720_-	lytic transglycosylase domain-containing protein	A0A0S2SXL7	Bacillus_phage	1.3e-09	39.0

DBSCAN-SWA_119

1693618 : 1694362

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609898.1\|1693618_1694362_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.3e-23	32.7

DBSCAN-SWA_120

1701773 : 1703387

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609913.1\|1701773_1703387_+	benzoylformate decarboxylase	G9E4W7	Ostreococcus_lucimarinus_virus	5.5e-06	26.1

DBSCAN-SWA_121

1709922 : 1718503

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609932.1\|1709922_1712127_+	PAS domain S-box protein	A0A1V0SGX0	Hokovirus	5.7e-06	32.4
WP_054931574.1\|1712365_1712665_-	hypothetical protein	NA	NA	NA	NA
WP_167352386.1\|1713111_1713750_-	recombinase family protein	NA	NA	NA	NA
WP_060609935.1\|1713742_1714324_-	hypothetical protein	NA	NA	NA	NA
WP_060609938.1\|1714420_1718503_-	PAS domain S-box protein	Q6XLV6	Feldmannia_irregularis_virus	1.2e-20	26.0

DBSCAN-SWA_122

1729405 : 1730986

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060609962.1\|1729405_1730986_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.8e-06	26.3

DBSCAN-SWA_123

1737037 : 1738093

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054931600.1\|1737037_1738093_-	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	8.5e-16	46.2

DBSCAN-SWA_124

1745986 : 1747798

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082670543.1\|1745986_1747798_+	amino acid ABC transporter permease/ATP-binding protein	G3M9Y6	Bacillus_virus	5.0e-24	34.1

DBSCAN-SWA_125

1755107 : 1758464

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054931611.1\|1755107_1758464_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	1.1e-48	21.0

DBSCAN-SWA_126

1807211 : 1808945

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060610051.1\|1807211_1808945_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	5.3e-15	32.5

DBSCAN-SWA_127

1813651 : 1815973

Ralstonia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060610066.1\|1813651_1815973_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	6.2e-11	20.7

DBSCAN-SWA_128

1832787 : 1844110

Chrysochromulina_ericina_virus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060610092.1\|1832787_1833915_+	alanine--glyoxylate aminotransferase family protein	A0A0N9QIZ2	Chrysochromulina_ericina_virus	1.5e-82	42.4
WP_062917657.1\|1834087_1834351_-	hypothetical protein	NA	NA	NA	NA
WP_060610095.1\|1834909_1836355_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	8.2e-54	34.4
WP_060610098.1\|1836502_1839850_-	AAA family ATPase	A0A218MLZ2	uncultured_virus	4.6e-15	38.1
WP_082670545.1\|1840149_1840770_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	4.8e-19	35.1
WP_060610101.1\|1841096_1842164_+	cytochrome c oxidase subunit II	NA	NA	NA	NA
WP_098021719.1\|1842160_1844110_+	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	8.9e-11	37.9

DBSCAN-SWA_129

1849800 : 1852642

Diadromus_pulchellus_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060610122.1\|1849800_1851558_-	ATP-dependent DNA helicase RecQ	Q9DSV4	Diadromus_pulchellus_ascovirus	1.6e-59	38.0
WP_060610125.1\|1851775_1852642_+	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	4.7e-65	48.6

DBSCAN-SWA_130

1861476 : 1869570

Hokovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060610137.1\|1861476_1865436_+	response regulator	A0A1V0SGX0	Hokovirus	4.7e-59	29.5
WP_060610138.1\|1865429_1866383_+	diguanylate cyclase	NA	NA	NA	NA
WP_054931700.1\|1866402_1867284_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_060610747.1\|1867447_1868470_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-17	33.8
WP_060610141.1\|1868466_1869570_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	3.4e-15	30.6

DBSCAN-SWA_131

1892223 : 1897787

Lactococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054931720.1\|1892223_1893963_-	FAD-dependent oxidoreductase	A0A1W6JK46	Lactococcus_phage	2.2e-08	23.3
WP_060610171.1\|1894263_1894713_+	Ohr family peroxiredoxin	NA	NA	NA	NA
WP_060610174.1\|1894815_1895541_+	hypothetical protein	NA	NA	NA	NA
WP_060610177.1\|1895549_1896395_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_054931726.1\|1896695_1897787_+	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	5.9e-28	35.0

DBSCAN-SWA_132

1922646 : 1925301

Agrobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060610212.1\|1922646_1925301_+	type VI secretion system ATPase TssH	A0A223W0B1	Agrobacterium_phage	5.9e-90	32.1

DBSCAN-SWA_133

1939810 : 1941985

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082670553.1\|1939810_1941985_+	filamentous hemagglutinin N-terminal domain-containing protein	A0A0R6PJK4	Moraxella_phage	3.4e-35	36.3

DBSCAN-SWA_134

1977864 : 1983206

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060610304.1\|1977864_1981338_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	3.7e-52	23.1
WP_054931785.1\|1981417_1981753_+	hypothetical protein	NA	NA	NA	NA
WP_054931786.1\|1981790_1983206_+	DUF3380 domain-containing protein	B3FJ91	Pseudomonas_phage	6.7e-24	31.8

DBSCAN-SWA_135

1996256 : 1998086

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060610327.1\|1996256_1998086_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.6e-16	29.5

DBSCAN-SWA_136

2009595 : 2010015

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054931814.1\|2009595_2010015_-	type II toxin-antitoxin system HicB family antitoxin	A0A2H4JFV9	uncultured_Caudovirales_phage	1.7e-28	48.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP013105

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

112893 : 192307

Burkholderia_virus(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082670588.1\|112893_113181_+\|transposase	transposase	NA	NA	NA	NA
WP_060610980.1\|116749_126775_+	hypothetical protein	NA	NA	NA	NA
WP_063803420.1\|129922_130825_-	transcriptional regulator GcvA	Q6JIH3	Burkholderia_virus	6.8e-22	28.3
WP_060610985.1\|130929_132075_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_060610987.1\|132091_134218_+	acetate--CoA ligase family protein	NA	NA	NA	NA
WP_060610989.1\|136301_137051_+	electron transfer flavoprotein subunit beta/FixA family protein	NA	NA	NA	NA
WP_060610991.1\|137072_138005_+	electron transfer flavoprotein subunit alpha	NA	NA	NA	NA
WP_063803430.1\|139696_140602_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_158512205.1\|141916_142117_-	hypothetical protein	NA	NA	NA	NA
WP_060610998.1\|143096_144257_+	hypothetical protein	NA	NA	NA	NA
WP_060611338.1\|144443_145802_+	MFS transporter	NA	NA	NA	NA
WP_158512206.1\|145997_146780_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_082670591.1\|146786_147218_+	hypothetical protein	NA	NA	NA	NA
WP_060611002.1\|147258_147690_+	hypothetical protein	NA	NA	NA	NA
WP_060611003.1\|147961_149308_+	MmgE/PrpD family protein	NA	NA	NA	NA
WP_148654673.1\|149338_150214_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_060611006.1\|150216_150999_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_082670593.1\|151286_153380_+	CoA transferase	NA	NA	NA	NA
WP_060611010.1\|153442_154243_+	hypothetical protein	NA	NA	NA	NA
WP_082670624.1\|154385_155549_+	porin	NA	NA	NA	NA
WP_158512207.1\|155933_156098_+	hypothetical protein	NA	NA	NA	NA
WP_158512208.1\|156155_156311_-	hypothetical protein	NA	NA	NA	NA
WP_046565320.1\|156725_157154_+	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_060611013.1\|157150_157624_+	RES domain-containing protein	NA	NA	NA	NA
WP_060611015.1\|158367_158739_+	hypothetical protein	NA	NA	NA	NA
WP_148654674.1\|158842_159283_+	hypothetical protein	NA	NA	NA	NA
WP_082670303.1\|159862_161128_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.6e-40	43.3
WP_060611017.1\|163311_164229_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_060611019.1\|164347_165511_+	alpha/beta fold hydrolase	A0A0M3UKI8	Mycobacterium_phage	2.9e-09	34.5
WP_060611021.1\|165558_166350_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_060611023.1\|166435_167455_+	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
WP_148654675.1\|167995_168604_-	hypothetical protein	NA	NA	NA	NA
WP_060611027.1\|168578_169406_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_060611029.1\|170354_170765_-	hypothetical protein	NA	NA	NA	NA
WP_060611031.1\|170801_171272_-	hypothetical protein	NA	NA	NA	NA
WP_158512209.1\|171335_172769_-	DUF746 domain-containing protein	NA	NA	NA	NA
WP_060611035.1\|173282_173696_-	helix-turn-helix transcriptional regulator	Q8W6N2	Burkholderia_virus	9.6e-16	40.0
WP_060611037.1\|173842_174712_-	DUF4238 domain-containing protein	NA	NA	NA	NA
WP_060611039.1\|174934_175987_+	hypothetical protein	NA	NA	NA	NA
WP_060611041.1\|176283_177711_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_158512210.1\|178006_178195_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_060611044.1\|178478_180197_+	hypothetical protein	NA	NA	NA	NA
WP_060611046.1\|180487_181219_+\|transposase	IS6 family transposase	A0A0N9RU54	Staphylococcus_phage	3.3e-19	30.3
WP_060611048.1\|181946_182957_+	dienelactone hydrolase	NA	NA	NA	NA
WP_060611051.1\|183789_184689_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	8.8e-06	30.3
WP_060611052.1\|184854_186399_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_060611054.1\|186419_187337_+	ABC transporter permease	NA	NA	NA	NA
WP_060611056.1\|187351_188281_+	ABC transporter permease	NA	NA	NA	NA
WP_060611058.1\|188280_189276_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.5e-09	23.8
WP_060611060.1\|189275_190103_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.4e-21	36.5
WP_060611062.1\|190134_191544_+	M20 family metallopeptidase	NA	NA	NA	NA
WP_060611064.1\|191959_192307_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	5.6e-09	72.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP013102

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013102_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013102_1

839565-839648

Orphan

Consensus_repeat	Method
GGCGACGCGTGAAGCGAGCTAAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013102_1

>merge|NZ_CP013102|1|839565-839648|CRISPRCasFinder
GGCGACGCGTGAAGCGAGCTAACAATTCGCGGATGCCAGCGCAAAGGCCAAACCACCAAACGGCGACGCGTGAAGCGAGCTAAC

>NZ_CP013102|1|1|839565-839648|CRISPRCasFinder
GGCGACGCGTGAAGCGAGCTAAC	AATTCGCGGATGCCAGCGCAAAGGCCAAACCACCAAAC
GGCGACGCGTGAAGCGAGCTAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013102.1\|WP_060602439.1\|844531_845836_-\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|236531
NZ_CP013102.1\|WP_060599603.1\|839797_840415_+\|RNA-2',3'-cyclic-phosphodiesterase	unknown	unknown	gnl\|CDD\|224431
NZ_CP013102.1\|WP_060599606.1\|848237_848924_+\|flagellar-basal-body-L-ring-protein-FlgH	unknown	unknown	gnl\|CDD\|376732
NZ_CP013102.1\|WP_054929143.1\|829202_829925_-\|OmpW-family-protein	unknown	unknown	gnl\|CDD\|225589
NZ_CP013102.1\|WP_054929142.1\|831130_835834_+\|glutamate-synthase-subunit-alpha	unknown	unknown	gnl\|CDD\|236968
NZ_CP013102.1\|WP_035988887.1\|830112_830820_+\|transposase	unknown	unknown	gnl\|CDD\|376616
NZ_CP013102.1\|WP_054929144.1\|828486_828870_-\|DUF883-domain-containing-protein	unknown	unknown	gnl\|CDD\|377576
NZ_CP013102.1\|WP_054929137.1\|840453_841722_-\|D-amino-acid-dehydrogenase	unknown	unknown	gnl\|CDD\|234819
NZ_CP013102.1\|WP_054929135.1\|845852_846590_-\|response-regulator	unknown	unknown	gnl\|CDD\|181883
NZ_CP013102.1\|WP_060599600.1\|827076_828297_+\|deoxyguanosinetriphosphate-triphosphohydrolase	unknown	unknown	gnl\|CDD\|234934
NZ_CP013102.1\|WP_060602442.1\|847217_847427_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013102.1\|WP_098021503.1\|843257_844322_+\|tyrosine-protein-phosphatase	unknown	unknown	gnl\|CDD\|379135
NZ_CP013102.1\|WP_060602433.1\|825936_827019_+\|3-dehydroquinate-synthase	unknown	unknown	gnl\|CDD\|234565
NZ_CP013102.1\|WP_035988874.1\|825368_825920_+\|shikimate-kinase	unknown	unknown	gnl\|CDD\|234654
NZ_CP013102.1\|WP_060599602.1\|838101_839523_+\|IS66-family-transposase	unknown	unknown	gnl\|CDD\|376980
NZ_CP013102.1\|WP_060599605.1\|847457_848183_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013102.1\|WP_060599599.1\|823647_825231_+\|type-IV-pilus-secretin-PilQ	unknown	unknown	gnl\|CDD\|274173
NZ_CP013102.1\|WP_060599604.1\|841730_843002_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340929
NZ_CP013102.1\|WP_060599601.1\|835935_837402_+\|glutamate-synthase-subunit-beta	unknown	unknown	gnl\|CDD\|237213
NZ_CP013102.1\|WP_054929134.1\|846997_847201_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP013102.1\|WP_060602439.1\|844531_845836_-\|HAMP-domain-containing-protein	gnl\|CDD\|236531	PRK09467, envZ, osmolarity sensor protein; Provisional.	3.95949e-57
NZ_CP013102.1\|WP_060599603.1\|839797_840415_+\|RNA-2',3'-cyclic-phosphodiesterase	gnl\|CDD\|224431	COG1514, LigT, 2'-5' RNA ligase [Translation, ribosomal structure and biogenesis].	1.28636e-24
NZ_CP013102.1\|WP_060599606.1\|848237_848924_+\|flagellar-basal-body-L-ring-protein-FlgH	gnl\|CDD\|376732	pfam02107, FlgH, Flagellar L-ring protein.	2.79471e-56
NZ_CP013102.1\|WP_054929143.1\|829202_829925_-\|OmpW-family-protein	gnl\|CDD\|225589	COG3047, OmpW, Outer membrane protein W [Cell envelope biogenesis, outer membrane].	3.55914e-45
NZ_CP013102.1\|WP_054929142.1\|831130_835834_+\|glutamate-synthase-subunit-alpha	gnl\|CDD\|236968	PRK11750, gltB, glutamate synthase subunit alpha; Provisional.	0
NZ_CP013102.1\|WP_035988887.1\|830112_830820_+\|transposase	gnl\|CDD\|376616	pfam01797, Y1_Tnp, Transposase IS200 like. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS200 from E. coli.	1.64312e-09
NZ_CP013102.1\|WP_054929144.1\|828486_828870_-\|DUF883-domain-containing-protein	gnl\|CDD\|377576	pfam05957, DUF883, Bacterial protein of unknown function (DUF883). This family consists of several hypothetical bacterial proteins of unknown function.	7.37003e-21
NZ_CP013102.1\|WP_054929137.1\|840453_841722_-\|D-amino-acid-dehydrogenase	gnl\|CDD\|234819	PRK00711, PRK00711, D-amino acid dehydrogenase.	0
NZ_CP013102.1\|WP_054929135.1\|845852_846590_-\|response-regulator	gnl\|CDD\|181883	PRK09468, ompR, osmolarity response regulator; Provisional.	1.26994e-84
NZ_CP013102.1\|WP_060599600.1\|827076_828297_+\|deoxyguanosinetriphosphate-triphosphohydrolase	gnl\|CDD\|234934	PRK01286, PRK01286, deoxyguanosinetriphosphate triphosphohydrolase-like protein; Provisional.	0
NZ_CP013102.1\|WP_098021503.1\|843257_844322_+\|tyrosine-protein-phosphatase	gnl\|CDD\|379135	pfam13350, Y_phosphatase3, Tyrosine phosphatase family. This family is closely related to the pfam00102 and pfam00782 families.	1.76062e-72
NZ_CP013102.1\|WP_060602433.1\|825936_827019_+\|3-dehydroquinate-synthase	gnl\|CDD\|234565	PRK00002, aroB, 3-dehydroquinate synthase; Reviewed.	0
NZ_CP013102.1\|WP_035988874.1\|825368_825920_+\|shikimate-kinase	gnl\|CDD\|234654	PRK00131, aroK, shikimate kinase; Reviewed.	6.45925e-94
NZ_CP013102.1\|WP_060599602.1\|838101_839523_+\|IS66-family-transposase	gnl\|CDD\|376980	pfam03050, DDE_Tnp_IS66, Transposase IS66 family. Transposase proteins are necessary for efficient DNA transposition. This family includes IS66 from Agrobacterium tumefaciens.	1.08895e-58
NZ_CP013102.1\|WP_060599599.1\|823647_825231_+\|type-IV-pilus-secretin-PilQ	gnl\|CDD\|274173	TIGR02515, Putative_DNA_transport_protein_HofQ, type IV pilus secretin (or competence protein) PilQ. A number of proteins homologous to PilQ are involved in type IV pilus formation, competence for transformation, type III secretion, and type II secretion (also called the main terminal branch of the general secretion pathway). Members of this family include PilQ itself, which is a component of the type IV pilus structure, from a number of species. In Haemophilus influenzae, the member of this family is associated with competence for transformation with exogenous DNA rather than with formation of a type IV pilus; the surface structure required for competence may be considered an unusual, incomplete type IV pilus structure. [Cell envelope, Surface structures].	1.76422e-148
NZ_CP013102.1\|WP_060599604.1\|841730_843002_-\|MFS-transporter	gnl\|CDD\|340929	cd17371, MFS_MucK, Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.30055e-135
NZ_CP013102.1\|WP_060599601.1\|835935_837402_+\|glutamate-synthase-subunit-beta	gnl\|CDD\|237213	PRK12810, gltD, glutamate synthase subunit beta; Reviewed.	0

>NZ_CP013102.1|WP_060599602.1|838101_839523_+|IS66-family-transposase
MTKMPDIKELTPEQKDALIIDLVRRLNELEAKLEKNSHNSSKPPSSDGPKRKPKSLRNTSDARPGAQPGHKGKTLKRVAQADHIEIHPVARVCDKCGNRIAAASVAVLPEGRQVIDLPPTRFEVTEHRVQIAQCRCCGKQHSGAFPKGVSQAVQYGPQIRAAAVYLTQYQQLPVARTAQALEDLFGLHVSTGTVQHSIDQAAQLLAPCVDQIQQALRGQPVVHFDESCMRVGRESHWLHVASTHALSWYGAHSKRGSQALDSFGILPGFTGVAVHDGWRPYAGYECEHALCNAHHLRELVFVLESTQQPWAQQMIDLLRQAKREVELSRASGNNMLSPARQRYYTRRSRALIARARKLNPQQAREPLRQERRGRIRQSFTCNLLTRLHKYADEVWRFIADHRVPFDNNQAERDIRMPKLKQKISGCFRSESGMEAFCTIRSYLATLRKQNRSLINALALGFAGFVVSPLVTAE
>NZ_CP013102.1|WP_060599601.1|835935_837402_+|glutamate-synthase-subunit-beta
MGKATGFLEFERRHEAYEAPLTRVKHYKEFVSALTDDEAKIQGARCMDCGIPFCNNGCPVNNIIPDFNDLVFRQDWKNAIDVLHSTNNFPEFTGRICPAPCEAACTLGINDDPVGIKSIEHAIIDKAWAEGWVAPQPPKHKTGKKVAVVGSGPAGLAAAQQLARVGHDVTVFEKNDRVGGLLRYGIPDFKLEKWLIDRRMRQMEAEGVTFRANVFVGKDPLPAHIGNTAKETITPEELKDQFDAVILTGGSETPRDLPVPGRELAGIHYAMEFLPQQNKVNAGDKVADQLLAKGKHVVVIGGGDTGSDCVGTSNRHGAKGVTQFELLPQPPEEENKPLVWPYWPVKLRTSSSHEEGCERDWAVATKRFEGKNGKVEKLIAARVEWKDGKMVEVPDSQFEMKADLVLLAMGFTQPVSPVLEAFGVDKDARGNVRASTEGDKAYYTSVEKVFTAGDMRRGQSLVVWAIREGRQCARSVDAYLMGHSELPR
>NZ_CP013102.1|WP_054929142.1|831130_835834_+|glutamate-synthase-subunit-alpha
MNDHQQPLSTVPAAQGLYDPANEHDACGVGFVAHIKGKKSHEIIQQGLKILENLDHRGAVGADPLMGDGAGILIQIPDSFYREEMAKQGVTLPPEGEYGVGMIFLPKEHASRLACEQELERTVKAEGQVVLGWRDVPADHTMPISPTVKASEPLIRQIFIGRGKDIMVTDALERKLYVIRKTASHRIQALKLKHGKEYFVPSMSARTVVYKGLLLAGQVGVYYRDLQDERVVSALALVHQRFSTNTFPAWELAHPYRMIAHNGEINTVKGNVNWLNARTGAIASHVLGDDLPKLWPLIYPGQSDTASFDNCLELLVMAGYPLVHAVMMMIPEAWEQHTLMDDNRRAFYEYHAAMMEPWDGPAAIAFTDGRQIGATLDRNGLRPARYIVTDDDLVIMASEAGTLPIPESKIVKKWRLQPGKMFLIDMEHGRIIDDKELKDNLANAKPYKSWIDAVRIKLDEIEPNAEDVVTERREAAALLDRQQAFGYTQEDLKFLMAPMAQAGEEAVGSMGNDSPLAVMSNKNKTLYHYFKQLFAQVTNPPIDPIRENMVMSLVSFVGPKPNLLDTNNINPPMRLEVSQPVLDFKDIAKIRAIDQYTGGKFSSYELNICYPVSWGKEGIEARLASLCAEAVDAVKSGYNMLIVSDRKTDRDNVAIPALLATSAIHSHLVQQGLRTSTGLVVETGSARETHHFALLAGFGAEAVHPYLAMETLAQMAAGMKGDLSAEKAVYNFTKAIGKGLHKVMSKMGISTYMSYTGAQIFEAVGLAEDLVNKYFKGTASKVGGIGLFEVAEEAIRLHRDAFGDNPVLANMLDAGGEYAYRVRGEDHMWTPDAIAKLQHSARSNSYQTYKEYAHLINDQTKRHMTFRGLFEFKVDPSKAIPLDEVESAKEIVKRFATGAMSLGSISTEAHATLAVAMNRIGGKSNTGEGGEDENRYRNELRGIPIKNGDTMKSILGDEVVTDIPLKEGDSLRSKIKQVASGRFGVTAEYLASADQIQIKMAQGAKPGEGGQLPGHKVSEYIGKLRYSVPGVGLISPPPHHDIYSIEDLAQLIHDLKNANPAASISVKLVSEVGVGTVAAGVAKAKADHVVIAGHDGGTGASPLSSVKHAGTPWELGLAETQQTLVLNQLRGRIRVQADGQMKTGRDVVIGALLGADEFGFATAPLVVEGCIMMRKCHLNTCPVGVATQDPVLRAKFQGQPEHVVNFFFFIAEEVREIMAQLGVRKFDDLIGHSEYLDMKKGIEHWKAKGLDFSRVFYQPDVPASVARMHVDSQDHGLDRALDHTLIEKAKAAIEKGEHVSFIQPVRNVNRTVGAMLSGTIAKKYGHDGLPDDAIHIQLKGTAGQSFGAFLAKGITLDLVGDGNDYVGKGLSGGRIIIRPTNDFRGKSEENIICGNTVMYGAIEGESFFRGVAGERFCVRNSGATAVVEGTGDHGCEYMTGGTVVVLGETGRNFAAGMSGGLAYVYDVDGTFAAKCNKSMVALEPVLQQAEQERTVDKALWHMGQTDEALLKGLIERHFQFTGSPRAKALLENWDASRRQFVKVFPTEYKRALGEMGAKKAAKEVLAA
>NZ_CP013102.1|WP_035988887.1|830112_830820_+|transposase
MARLARLYVPDQPQHVILRGLDQQPAFVDDQDYELFIDCLKAASRDHHLSVHAYALMPGAVQLLVTPTDESSLPKAMQAVGRRYVAHFNRRYSRRGTLWEGRYRATVIEGEKYFLLASRVVEMSPVRNQLVSTPEDYRWSSYRHHIGLTLDSLITDHRLYWSLGNTPFERQRAYRELCEQPLDEREASQLQQATLKGWVLGSDSYREWAARAANRRVSPLPRGRPRKVRETPQTQ
>NZ_CP013102.1|WP_054929143.1|829202_829925_-|OmpW-family-protein
MKLKQALGVAALACITTTAHAQSAGSFFVTTGWFHLAPQSSSDPLRETNVNGTPVNITVPNTGATLGSGDTIGFTGGYFVTDHIATEFVIGVPPQFDLHGSGAFQQYGKLGSAKQWSPTLLFKYYFNQPQAKFRPYLGLGVSRVSFTDEHITNGAFEANVLHGPTTVTTDSSWEPVFNAGFTYAFTDHWFAGFSISYLPLSTTAKLNTQAQTPIGTVNVQSETKIRLNPIVTYVNLGYRF
>NZ_CP013102.1|WP_054929144.1|828486_828870_-|DUF883-domain-containing-protein
MTALPNTRDALGESWTTAGRRARRIARHSRHAAEDIASELRTLMTELENTLGDGTQADAAVLRTQMRKRLDEARTRLNDTRDAMRERAEAAIHDADDYVHENPWRTIAIVGGVALIAGALLARGGSR
>NZ_CP013102.1|WP_060599600.1|827076_828297_+|deoxyguanosinetriphosphate-triphosphohydrolase
MSEIRSDPLSESLDAASVTPVTGVVSLPTIAALEAHLAPYAAHSSQSRGRRHHEAPPSARTEFQRDRDRIVHSTAFRRLEYKTQVFVNHEGDLFRTRLTHSLEVAQIARSVARNLRVNEDLVEAISLAHDLGHTPFGHAGQDALNECMRDYGGFEHNLQSLAVVDDLEEHYGAFDGLNLCFETREGILKHCSRENARRLGELGERFLQGRQPSIEAQIANLADEIAYNNHDVDDGLRSGLLTIEQLAEVELWHTHYDAARRDYPQIEGRRLIHETVRRIINTLIVDLIDTTTRNIAQHAPASLDDVRRAPPLVAHSDAVAAQATQLKRFLFKNLYRHYRVMRMANKAQRVIAGLFDAFIDDPRLLPPAYQTPDAAKQPRLIAHYIAGMTDRYASKEYQRLFIVDGD
>NZ_CP013102.1|WP_060602433.1|825936_827019_+|3-dehydroquinate-synthase
MITVNVELGERAYPIHIGADLIGRSELFTPHIRGASVTIVTNTTVDPLYGDTLRKALAPLGKDVTTVVLPDGEAHKNWETLNLIFDALLGARADRKTTLIALGGGVIGDMTGFAAACYMRGVPFIQVPTTLLSQVDSSVGGKTGINHPLGKNMIGAFYQPQAVIADIGALRTLPPRELAAGVAEVIKTGAIADATFFDWIEANIEALNRREPEALAEAVKRSCEIKASVVAADEREGGLRAILNFGHTFGHAIEAGLGYGEWLHGEAVGCGMVMAADLSVRLGHLDEAARKRLVAVIEAAHLPVQAPTLGAARYVDLMRVDKKAEAGEIKFILLKRFGDTLITRAPDEAVLQTLDASVGT
>NZ_CP013102.1|WP_035988874.1|825368_825920_+|shikimate-kinase
MQPRDAHANVFFVGLMGAGKTTVGRAVARRLDRPFFDSDHEIEARTGARIPVIFELEGESGFRDREAQVIAELTGRESIVLATGGGAVLRPENRDALRAHGIVVYLRANPHDLWLRTRRDKNRPLLQTEDPKGRLEALYEVRDPLYRECAHFVIETGRPSVNGLVNMVLMQLEMAGVAKPATS
>NZ_CP013102.1|WP_060599599.1|823647_825231_+|type-IV-pilus-secretin-PilQ
MMRLNVMRSMLACAAFVAMAARASLPPLPADMPFDEALTPAGMPPLPRVVTTDVANPFTPDATDEAGAAGRETDPARDAAQPPSAARVETEPKRQDEARTEPLEGPPVPLPPAARLSTNASPSIPADSPITLHFQHAELGAVLGAFAKFTGLNIVASDKARGAVTLHLDNVPWRAAFDTLLDVNGLAMEQRSNVIWVAPLSELAARERQRFEAHARAAELEPLASRTFELHYAHAEELRKLLTASGNQRVLSKRGAAMADPRTNLLFVTDLDARLAQIAELIASLDRPTRQVLIEARIVEAEKGFSRNLGVKLSMLATNEDGKAIGVVGGKEGAIYDLSARPISGFDAATAGFTLFAAQATRLVNIELSALEAEGLGRIVSSPRVVTADRMKAIVEQGTELPYQAKVGQGVSGVQFRRASLKLEVEPQITPDGRVVLDLDVAKDSVGEQTASGPAINTKHVQTRVEVEDGGTVSIGGIYESDDRDDVTRVPLLGKIPLLGALFRHRAHRDLTSELVVFITPRVVQTN
>NZ_CP013102.1|WP_060599603.1|839797_840415_+|RNA-2',3'-cyclic-phosphodiesterase
MQRTDPHPDQKESAGSASDPNLEATTNPHDYQRCFIALVPDTATRDALSSIDIPTTARRVPYEQLHLTVTFIGVLPQEKAAPLIESLTHETVSLKRTPITKIEHWPRASHPRLTVATLAMSDEFVALDWRVRSSMIALGLPVDARTFRPHVTLARYRQDAAAVGPAMDLQHELIACFDSLTLYSSTLARTGARYRSLASVPVVYG
>NZ_CP013102.1|WP_054929137.1|840453_841722_-|D-amino-acid-dehydrogenase
MRTIVLGGGIIGVATAFYLRERGCDVTVIERESDVALATSFGNAGVIAPGYVTPWAAPGMPFKILKYLFKPASPLIFRPTFDLAQWRWIARWLRECDLARFRVNKQRMQRIAYYSRECLREFRGHHPFEYGRSQGYLQLFRTAFDVELAQPALAVLRDAGISHREVSAAECAEIEPGLRWARQAPLSGLYLPDDEAGDCARFTRELRAICEAHGVRFRFDTRVTALDVRGRSVHGVHVESAAGSETLVANAVVVAAGVDSADLLAPLGVKVPLYPVKGYSATLQIVDDEKSPRAALMDESLKTAITRFGPNLRVAGTAELGNRQTTLREQALQTLMKVLDDWFPHATAPSSAQFWVGRRPMTPDGAPLLGPSGIDGLWINLGHGSTGWAMSLGSGRVVADLITQREPEIDLDGLTLGRYRGS
>NZ_CP013102.1|WP_060599604.1|841730_843002_-|MFS-transporter
MASFQWFTELSTRERRTLYAGFGGYAVDAFDFMIYSFLIPTLIATWGMSKSEAGMIATSSLISSAIGGWLAGILADRYGRIRVLQWTIATFALFTCLSGFTHNFWQLLTTRTLQGIGFGGEWSVVTIMMAETIRSPQHRAKAVGTVQSSWSFGWGAAAILYWAFFALLPEEYAWRACFWIGIVPALWIIYIRRNVSDPDIYLATRRARDNGFDTSHFLQIFSAAHLKTTILGSALCSGMLGGYYAITTWLPTYLKTVRHLSVFNTSGYLVVLIVGSFIGYIVGAILSDRIGRRASFVLFAIGSFVLGMIYTMLPITDGAMLLLGFPLGIVVQGIFAGVGAYLSELYPNAIRGSGQGFCYNLGRGVGSFFPILVGTLSQTMTLVKAIGIVAGSGYLLVVVAALALPETKGKSLAAESAESAEHV
>NZ_CP013102.1|WP_098021503.1|843257_844322_+|tyrosine-protein-phosphatase
MRLITLSIGSSNLHVTRVRLSHPRVALAPHLVDTTMTSSAKADISLAAAHDLYALPTVPAPSHARAQRASRRRFLKSTAGALLLSGMGSTLLTACGGNNAGSDQAPTPRLASLENFRDVGGTAAGYPTVDGRVVRRNAFYRSNALTQSAADAAVLDSLGIAAVCDLRTPGEIERASDALPANAAYVKINVTGREDVITPMLDNEASAVSSMERAQRLYVTDAVQRAAFGSLLSQLASTAGPQLIHSSAGKDRAGWAAALLLSIANVPFDIIMQDYLLSNTYMANAISARVEARRQQSGDLAASAEKPLASVQSSFLQASFDQVQSSYGTMSGYLTRGLGLTQSTVDTLRERLVL
>NZ_CP013102.1|WP_060602439.1|844531_845836_-|HAMP-domain-containing-protein
MRNPLNTLFGRMALLSSAVLFAIQAGWFVLVVMQPPHHEVDGYARGILLALQAANGEPVNGADVAPALRVHLVPTWNMPATVHLEPPTRRPFVELTRHLRASLPVGTEIAVDDTHMPRLWVRFPRKSMWVVIPVDVPPRPRFVIESISMLLAALLLSLLAVWQMQRPLTRVAHAARAFGAGSRPEPVSEQGPRELRDLIGSFNDMMRRLNEAGDDQAVMLAGVAHDLKAPLTRLKLRASVLADENERAGLIRDVDSLTNIVQQFLEFAGQSAESGPMTEVDAFLREQFSSTDGNEGDEADSGDEAEAPLFRLDLQAGSRFTLPRTLLDRLVTNLVDNAFEHGAPPVEIATSRDEQQWLIDVRDHGPGIPEDRIAAAMKPFVRLDAARGGEGHCGLGLAIVVRLAHHRGGKCTVENHPEGGLHVRVALPVAMPEA
>NZ_CP013102.1|WP_054929135.1|845852_846590_-|response-regulator
MNPQVLIVDDDPVVRDLLCRFLQSNGYDASVLHDGTHLQRRLERERPSVVVLDIMMPNTDGLRALTALRAAGDDIPVIFVTARGTVADRIIGLSLGADDYLTKPFDPRELLARIQTVLRRRGPATTSAPEARKRYRFGPFELDFATRTLSRDDTRVTLRDSEFALLKIFVNNPYKVLSRVLIHDLVHRDDLPFRDRSLDVPIWRLRRVIENDPSNPCYVQTVRGKGYVFVPDADPNGAPFAADPA
>NZ_CP013102.1|WP_054929134.1|846997_847201_+|hypothetical-protein
MTVQNNHFTTQLQSIARPSAAEKPSARGASTTAAATATGDKTGDKAGAAQTSGSPVGMVGNHVNTTA
>NZ_CP013102.1|WP_060602442.1|847217_847427_+|hypothetical-protein
MPRSRFYTHVRRAATRLAMWSAVGAAVLPLDGCAVAALPCRLTSATLKILPVVGHVAATPFDACAAAID
>NZ_CP013102.1|WP_060599605.1|847457_848183_+|hypothetical-protein
MQLTSIGRALTACAVAMCCALMPFAASAQNMLPPQQAAALRMSAIGAKKRAADKPFAFRGIPLGITLDEFRAVSRVRATPLGSVPVCETDNVAGSLGMRLKTSQSLTIACQWAHRVADGWEVSRAVVDGAPADEHVLRFVRVDGQSGFRLYEISFVIDEITADDLRDAFEDRYGAPRTATQVSSPTAGQLPVYIWENDVSSITLCLLPATHNATLIYLLKDPDAYMKSVVRQWQASSPDAG
>NZ_CP013102.1|WP_060599606.1|848237_848924_+|flagellar-basal-body-L-ring-protein-FlgH
MNAMHMPRAAAVLTSAAVFYALAGCGSTKDSIVDTPMLPPLSTAPLNVNTQGAIFQAGTGILLYETPRAQHIGDVLTIRLSESYTGSNSTNAQASRASDITAEAADKSTGTAARLARLFNIGSASTTFKGQGSIADTSGMTGTLAVTVIGTMPTGNLVVSGEKLISMGGNRDRLRLSGIVNPKDIESGNYVASSKVANARIEQAGQGMLADSTTLGWLQRMFMSVLTF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP013102_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013102_2

849977-850060

Orphan

Consensus_repeat	Method
GTTAGCTCGCTTCAGGCGTCGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013102_2

>merge|NZ_CP013102|2|849977-850060|CRISPRCasFinder
GTTAGCTCGCTTCAGGCGTCGCCGTTCGGTGTTTTGGTTTTTTCGCTGGCATCCGCGATTCGTTAGCTCGCTTCAAGCGTCGCC

>NZ_CP013102|2|2|849977-850060|CRISPRCasFinder
GTTAGCTCGCTTCAGGCGTCGCC	GTTCGGTGTTTTGGTTTTTTCGCTGGCATCCGCGATTC
GTTAGCTCGCTTCAAGCGTCGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013102.1\|WP_054929124.1\|858684_859506_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224052
NZ_CP013102.1\|WP_082670306.1\|857476_858598_+\|thiamine-phosphate-synthase	unknown	unknown	gnl\|CDD\|237041
NZ_CP013102.1\|WP_060599606.1\|848237_848924_+\|flagellar-basal-body-L-ring-protein-FlgH	unknown	unknown	gnl\|CDD\|376732
NZ_CP013102.1\|WP_060599608.1\|852086_852860_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235546
NZ_CP013102.1\|WP_054929137.1\|840453_841722_-\|D-amino-acid-dehydrogenase	unknown	unknown	gnl\|CDD\|234819
NZ_CP013102.1\|WP_035988929.1\|855248_856388_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274092
NZ_CP013102.1\|WP_054929128.1\|850754_851339_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013102.1\|WP_009771314.1\|856398_856596_+\|sulfur-carrier-protein-ThiS	unknown	unknown	gnl\|CDD\|180768
NZ_CP013102.1\|WP_054929135.1\|845852_846590_-\|response-regulator	unknown	unknown	gnl\|CDD\|181883
NZ_CP013102.1\|WP_060602442.1\|847217_847427_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013102.1\|WP_054929134.1\|846997_847201_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013102.1\|WP_035988932.1\|856655_857480_+\|thiazole-synthase	unknown	unknown	gnl\|CDD\|234687
NZ_CP013102.1\|WP_009771308.1\|849024_849771_-\|response-regulator	unknown	unknown	gnl\|CDD\|181883
NZ_CP013102.1\|WP_035988938.1\|859502_860270_+\|lipid-asymmetry-maintenance-ABC-transporter-permease-subunit-MlaE	unknown	unknown	gnl\|CDD\|223838
NZ_CP013102.1\|WP_060602439.1\|844531_845836_-\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|236531
NZ_CP013102.1\|WP_098021503.1\|843257_844322_+\|tyrosine-protein-phosphatase	unknown	unknown	gnl\|CDD\|379135
NZ_CP013102.1\|WP_060599607.1\|851392_851890_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013102.1\|WP_060599609.1\|852856_854590_-\|ABC-transporter-ATP-binding-protein/permease	unknown	unknown	gnl\|CDD\|226646
NZ_CP013102.1\|WP_060599604.1\|841730_843002_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340929
NZ_CP013102.1\|WP_060599605.1\|847457_848183_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP013102.1\|WP_054929124.1\|858684_859506_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224052	COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism].	2.22895e-136
NZ_CP013102.1\|WP_082670306.1\|857476_858598_+\|thiamine-phosphate-synthase	gnl\|CDD\|237041	PRK12290, thiE, thiamine phosphate synthase.	1.21655e-89
NZ_CP013102.1\|WP_060599606.1\|848237_848924_+\|flagellar-basal-body-L-ring-protein-FlgH	gnl\|CDD\|376732	pfam02107, FlgH, Flagellar L-ring protein.	2.79471e-56
NZ_CP013102.1\|WP_035988929.1\|855248_856388_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|274092	TIGR02352, Glycine_oxidase, glycine oxidase ThiO. This family consists of the homotetrameric, FAD-dependent glycine oxidase ThiO, from species such as Bacillus subtilis that use glycine in thiamine biosynthesis. In general, members of this family will not be found in species such as E. coli that instead use tyrosine and the ThiH protein. [Biosynthesis of cofactors, prosthetic groups, and carriers, Thiamine].	9.78244e-63
NZ_CP013102.1\|WP_054929137.1\|840453_841722_-\|D-amino-acid-dehydrogenase	gnl\|CDD\|234819	PRK00711, PRK00711, D-amino acid dehydrogenase.	0
NZ_CP013102.1\|WP_009771314.1\|856398_856596_+\|sulfur-carrier-protein-ThiS	gnl\|CDD\|180768	PRK06944, PRK06944, sulfur carrier protein ThiS; Provisional.	1.49465e-29
NZ_CP013102.1\|WP_009771308.1\|849024_849771_-\|response-regulator	gnl\|CDD\|181883	PRK09468, ompR, osmolarity response regulator; Provisional.	1.88872e-91
NZ_CP013102.1\|WP_060599608.1\|852086_852860_-\|SDR-family-oxidoreductase	gnl\|CDD\|235546	PRK05653, fabG, 3-oxoacyl-ACP reductase FabG.	3.85656e-46
NZ_CP013102.1\|WP_035988932.1\|856655_857480_+\|thiazole-synthase	gnl\|CDD\|234687	PRK00208, thiG, thiazole synthase; Reviewed.	6.17115e-155
NZ_CP013102.1\|WP_054929135.1\|845852_846590_-\|response-regulator	gnl\|CDD\|181883	PRK09468, ompR, osmolarity response regulator; Provisional.	1.26994e-84
NZ_CP013102.1\|WP_035988938.1\|859502_860270_+\|lipid-asymmetry-maintenance-ABC-transporter-permease-subunit-MlaE	gnl\|CDD\|223838	COG0767, Ttg2B, ABC-type transport system involved in resistance to organic solvents, permease component [Secondary metabolites biosynthesis, transport, and catabolism].	1.16757e-86
NZ_CP013102.1\|WP_060602439.1\|844531_845836_-\|HAMP-domain-containing-protein	gnl\|CDD\|236531	PRK09467, envZ, osmolarity sensor protein; Provisional.	3.95949e-57
NZ_CP013102.1\|WP_098021503.1\|843257_844322_+\|tyrosine-protein-phosphatase	gnl\|CDD\|379135	pfam13350, Y_phosphatase3, Tyrosine phosphatase family. This family is closely related to the pfam00102 and pfam00782 families.	1.76062e-72
NZ_CP013102.1\|WP_060599609.1\|852856_854590_-\|ABC-transporter-ATP-binding-protein/permease	gnl\|CDD\|226646	COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only].	0
NZ_CP013102.1\|WP_060599604.1\|841730_843002_-\|MFS-transporter	gnl\|CDD\|340929	cd17371, MFS_MucK, Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.30055e-135

>NZ_CP013102.1|WP_009771308.1|849024_849771_-|response-regulator
MNSSIMVVDDDPVVRDIVRDYLQGRGFTVSVLENGMALQQALQHERPALVVLDIMMPELDGISALRALRLAGDNIPVILLTARADVIDRVIGLELGADDYLGKPFDPSELVARIRSVLRRRESAAPSAPENRAPYRFGRFEVNFPARELRRDGERIALRSSEFAMLKVFVSHAMTVLTRAQLLEKLHGGTDTHRNRSLDVSIWRLRRLIEVDPSEPRYVQTVWGKGYVFVPDGEIGAAERYDAPVANL
>NZ_CP013102.1|WP_060599606.1|848237_848924_+|flagellar-basal-body-L-ring-protein-FlgH
MNAMHMPRAAAVLTSAAVFYALAGCGSTKDSIVDTPMLPPLSTAPLNVNTQGAIFQAGTGILLYETPRAQHIGDVLTIRLSESYTGSNSTNAQASRASDITAEAADKSTGTAARLARLFNIGSASTTFKGQGSIADTSGMTGTLAVTVIGTMPTGNLVVSGEKLISMGGNRDRLRLSGIVNPKDIESGNYVASSKVANARIEQAGQGMLADSTTLGWLQRMFMSVLTF
>NZ_CP013102.1|WP_060599605.1|847457_848183_+|hypothetical-protein
MQLTSIGRALTACAVAMCCALMPFAASAQNMLPPQQAAALRMSAIGAKKRAADKPFAFRGIPLGITLDEFRAVSRVRATPLGSVPVCETDNVAGSLGMRLKTSQSLTIACQWAHRVADGWEVSRAVVDGAPADEHVLRFVRVDGQSGFRLYEISFVIDEITADDLRDAFEDRYGAPRTATQVSSPTAGQLPVYIWENDVSSITLCLLPATHNATLIYLLKDPDAYMKSVVRQWQASSPDAG
>NZ_CP013102.1|WP_060602442.1|847217_847427_+|hypothetical-protein
MPRSRFYTHVRRAATRLAMWSAVGAAVLPLDGCAVAALPCRLTSATLKILPVVGHVAATPFDACAAAID
>NZ_CP013102.1|WP_054929134.1|846997_847201_+|hypothetical-protein
MTVQNNHFTTQLQSIARPSAAEKPSARGASTTAAATATGDKTGDKAGAAQTSGSPVGMVGNHVNTTA
>NZ_CP013102.1|WP_054929135.1|845852_846590_-|response-regulator
MNPQVLIVDDDPVVRDLLCRFLQSNGYDASVLHDGTHLQRRLERERPSVVVLDIMMPNTDGLRALTALRAAGDDIPVIFVTARGTVADRIIGLSLGADDYLTKPFDPRELLARIQTVLRRRGPATTSAPEARKRYRFGPFELDFATRTLSRDDTRVTLRDSEFALLKIFVNNPYKVLSRVLIHDLVHRDDLPFRDRSLDVPIWRLRRVIENDPSNPCYVQTVRGKGYVFVPDADPNGAPFAADPA
>NZ_CP013102.1|WP_060602439.1|844531_845836_-|HAMP-domain-containing-protein
MRNPLNTLFGRMALLSSAVLFAIQAGWFVLVVMQPPHHEVDGYARGILLALQAANGEPVNGADVAPALRVHLVPTWNMPATVHLEPPTRRPFVELTRHLRASLPVGTEIAVDDTHMPRLWVRFPRKSMWVVIPVDVPPRPRFVIESISMLLAALLLSLLAVWQMQRPLTRVAHAARAFGAGSRPEPVSEQGPRELRDLIGSFNDMMRRLNEAGDDQAVMLAGVAHDLKAPLTRLKLRASVLADENERAGLIRDVDSLTNIVQQFLEFAGQSAESGPMTEVDAFLREQFSSTDGNEGDEADSGDEAEAPLFRLDLQAGSRFTLPRTLLDRLVTNLVDNAFEHGAPPVEIATSRDEQQWLIDVRDHGPGIPEDRIAAAMKPFVRLDAARGGEGHCGLGLAIVVRLAHHRGGKCTVENHPEGGLHVRVALPVAMPEA
>NZ_CP013102.1|WP_098021503.1|843257_844322_+|tyrosine-protein-phosphatase
MRLITLSIGSSNLHVTRVRLSHPRVALAPHLVDTTMTSSAKADISLAAAHDLYALPTVPAPSHARAQRASRRRFLKSTAGALLLSGMGSTLLTACGGNNAGSDQAPTPRLASLENFRDVGGTAAGYPTVDGRVVRRNAFYRSNALTQSAADAAVLDSLGIAAVCDLRTPGEIERASDALPANAAYVKINVTGREDVITPMLDNEASAVSSMERAQRLYVTDAVQRAAFGSLLSQLASTAGPQLIHSSAGKDRAGWAAALLLSIANVPFDIIMQDYLLSNTYMANAISARVEARRQQSGDLAASAEKPLASVQSSFLQASFDQVQSSYGTMSGYLTRGLGLTQSTVDTLRERLVL
>NZ_CP013102.1|WP_060599604.1|841730_843002_-|MFS-transporter
MASFQWFTELSTRERRTLYAGFGGYAVDAFDFMIYSFLIPTLIATWGMSKSEAGMIATSSLISSAIGGWLAGILADRYGRIRVLQWTIATFALFTCLSGFTHNFWQLLTTRTLQGIGFGGEWSVVTIMMAETIRSPQHRAKAVGTVQSSWSFGWGAAAILYWAFFALLPEEYAWRACFWIGIVPALWIIYIRRNVSDPDIYLATRRARDNGFDTSHFLQIFSAAHLKTTILGSALCSGMLGGYYAITTWLPTYLKTVRHLSVFNTSGYLVVLIVGSFIGYIVGAILSDRIGRRASFVLFAIGSFVLGMIYTMLPITDGAMLLLGFPLGIVVQGIFAGVGAYLSELYPNAIRGSGQGFCYNLGRGVGSFFPILVGTLSQTMTLVKAIGIVAGSGYLLVVVAALALPETKGKSLAAESAESAEHV
>NZ_CP013102.1|WP_054929137.1|840453_841722_-|D-amino-acid-dehydrogenase
MRTIVLGGGIIGVATAFYLRERGCDVTVIERESDVALATSFGNAGVIAPGYVTPWAAPGMPFKILKYLFKPASPLIFRPTFDLAQWRWIARWLRECDLARFRVNKQRMQRIAYYSRECLREFRGHHPFEYGRSQGYLQLFRTAFDVELAQPALAVLRDAGISHREVSAAECAEIEPGLRWARQAPLSGLYLPDDEAGDCARFTRELRAICEAHGVRFRFDTRVTALDVRGRSVHGVHVESAAGSETLVANAVVVAAGVDSADLLAPLGVKVPLYPVKGYSATLQIVDDEKSPRAALMDESLKTAITRFGPNLRVAGTAELGNRQTTLREQALQTLMKVLDDWFPHATAPSSAQFWVGRRPMTPDGAPLLGPSGIDGLWINLGHGSTGWAMSLGSGRVVADLITQREPEIDLDGLTLGRYRGS
>NZ_CP013102.1|WP_054929128.1|850754_851339_-|hypothetical-protein
MIVTSFAHVLRFLLAACCLMSLGGCAWTLITAADATGSVIQAGYAIASNYSSPTFINGRRAKISAVCIEVNQLVSVGDFVPALQLALDKRGIRSDVYNPGTSPAGCEARLVYNASVDYGRRSFSDEPTQYLSMIDLTLIQHGRILVTARYQTGGLGVDRYSSASVKLDGLIGKMVVDQIAELQPESIQTSSIGK
>NZ_CP013102.1|WP_060599607.1|851392_851890_-|hypothetical-protein
MSFDRRLPSLSRLSLRLTQAGRDAALTATAALLFATAANAAQITPVKQAEPADVCPALSHIVSSADFKKLRDEPAATLPGVDPIDDCRANAHSYDCRWRAHWEADGFVNDPLEEIGADIAACFPNVVHDINTPTRQHFIVKTADRRVSVTASVQGQNELRLRIAR
>NZ_CP013102.1|WP_060599608.1|852086_852860_-|SDR-family-oxidoreductase
MSDASFESVVLVTGAGSGIGAALARRIAAPRVALMLHARGADDASRARLDQVAATCAASGATCATVLADLAERGASEHAVHQTLARFGALDQIVANAGHAQRQTIGTLDFDALAESFAAMPAAFAALVKRAAPALETSKRGRVVAVSSFVAHRYRADSAFAGTAAAKAALESLAKTAAAELAQHGVTVNCVAPGYTRKDRGPSAENAPAWARAAEATPLGQVAEPDDVAALIAFLLSDSARHITGQVIHVDGGLTLG
>NZ_CP013102.1|WP_060599609.1|852856_854590_-|ABC-transporter-ATP-binding-protein/permease
MIDNSKNPADITAWGLIKPYWVSEDRWKARGLLALVIAMNMTMVAANVWFNSWQRTFFDAIQQYNYPVFKYSLLQFTVIALALILLGSYRTYFRQMLEFRWRQWLTNRYLNDWLGDRAYYRIERDNLADNPDQRVSADLQGLASASLNLSLGLLSTTVTLFSFIVILWNLSGAFAFHMFGTEFSIPGYMVWAALIYAAVGSWVTHKVNHPLVSINYQQQRVEADFRFSLIRIRENADQIALYQGERSEEQQLKGVFSHIRENWRLIMRFTRRFNIVVISYSQLAIVFPYIAAAPKYFSKSISFGMYQQVTGAFGTVSDSFSWFINNYDSLAEWRATVNRLREFHRVMRSQHLHESVVEGTAHGGINVHVTDTDSIEVTNLRLQRPNGEPMANVGSFTIAPKTRWLVRGPSGAGKSTLMRTLAGLWPFGEGTIEKPADAKLLFIPQRSYLPIGTLKAALCYPSEASAYSDEACRDVLTVCRLPELAERLGESAHWERSLSPGEQQRLAAARALLQQPDFLFLDEATSALDPENESIIYNALIERLPNAAIVSVAHRKTLEAFHDHTLFIERAVEREAA
>NZ_CP013102.1|WP_035988929.1|855248_856388_+|FAD-dependent-oxidoreductase
MRTSAQPDFAVIGGGLCGRLVAWQLAGEGHRVALYERGDAAGSQAAAWVAAAMLAPLAEAASAELLITRLGAASLETWPTLLAQLPEPVFFQRNGSLIVWHHSDRAEAPLFERRLRANAPAELLDGGLVALAGAQVGAAEPALAGRFTQGWLLPHEGQLDNRQVLSALAAGLAQRGVETHWNTSVDDGALPPAKVTIDCRGLGAKPVMPTLRGIRGEVARVHAPGIDLTRPVRLLHPRYPLYIAPKQDDLYVIGATEVEGEDMSPVSVRSALELLSAAFSVHPGFGEARILELNSQCRPTLPDHRPVLLWDGASTLRVNGLYRHGYMIVPEVAGEAVRLASALLDGRVADSDGFADWQRNARWSELFRLDREPAVTLNV
>NZ_CP013102.1|WP_009771314.1|856398_856596_+|sulfur-carrier-protein-ThiS
MDIQINQKPLSLPEGATVADALSAYGARPPFAVALNGNFVARGQHAARALQAGDKLDVVHPVAGG
>NZ_CP013102.1|WP_035988932.1|856655_857480_+|thiazole-synthase
MNSHANAPADALTLYGETFQSRVLLGTSRYPSLQSLSDSIAASKPGMVTVALRRQMSEGGAEAGFFDLLKRHGVPLLPNTAGCQTVSEAVTTAHMAREVFDTDWIKLELIGDDYTLQPDPVGLIEAAAQLVKDGFKVLPYCTEDLVIGRRLLDAGCEALMPWGAPIGTGKGVVNPYGLRVLRERLPDVPLIVDAGLGVPSHACQVMEWGFDGVLLNTAVSQATHPETMARAFAMGVEAGREAYLAGPMAERETAHASTPVVGMPFWHQDGSAAA
>NZ_CP013102.1|WP_082670306.1|857476_858598_+|thiamine-phosphate-synthase
MTETLKLAGRDLFWPPADELTEAAERIRAHLGDWPPTHVDWRICLTPPDDANGGDLIVFTDLKQSSAQHVEQIARWQTQGAGVIEAAEGRAVLHLGGVRYQLEGHLAEDWIAALAAFLDCGFDPHDALVLALAWRDGDETRSDDAWPCDMSHFPRVAGLPDAPAQAFAACPDALGLYAVLPTAEWVERVAGFGVKTLQLRRKTAEPEELKREIARSVAAGREHGACVFINDHWQAAIDAGAYGVHLGQEDVHTADLHALSKAGVRLGLSTHGYYEMLTALHFRPSYIALGAVFPTTTKVMPTAPQGLARLARYVKLLDGVVPLVAIGGISGDVLPQVLATGVKSAAVVRAITEAADPASAAATLQKAFLQQKV
>NZ_CP013102.1|WP_054929124.1|858684_859506_+|ABC-transporter-ATP-binding-protein
MPSSSETLLELRDVDFGYGERLVLSNLNLRFKRGQVVAVMGGSGCGKTTVLRLIGGLVRAQRGQVMFHGQDIGAQTRDGLYALRRKMGMLFQFGALFTDMSVFENVAFALREHTDLPEELIRDLVLMKLNAVGLRGARDLAPSEISGGMARRVALARAIALDPELMMYDEPFAGLDPISLGITANLIRALNTALGATSILVTHDVPESFAIADYVYFLANGGVLAEGTPAELRASTDPTVRQFIDGTPDGPFKFHYPSNTPLAADFGIGGGRA
>NZ_CP013102.1|WP_035988938.1|859502_860270_+|lipid-asymmetry-maintenance-ABC-transporter-permease-subunit-MlaE
MISFIGRSVICGLGQTGYATRMFLRLVLEFFPLLRRPRLVTKQIHFVGNYSLVIIAVSGLFVGFVLGLQGYYTLNRYGSEQALGLLVALSLVRELGPVVTALLFAGRAGTSLTAEIGLMKAGEQLTAMEMMAVDPLKVVVAPRMWAGIISMPILAAIFSAVGVLGGYVVGVLMIGVDAGAFWSQMQGGVDAYRDVGNGVIKSIVFGFAVTFIALYQGYEAKPTPEGVSRATTKTVVYASLAVLGLDFLLTALMFS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP013102_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013102_3

1848101-1848190

Orphan

Consensus_repeat	Method
TTCGCTGGCATCCGCGATGCGTTAGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013102_3

>merge|NZ_CP013102|3|1848101-1848190|CRISPRCasFinder
TTCGCTGGCATCCGCGATGCGTTAGCTCGCTTCACGCGTCGCTGTTCGGGGTTTTGGTTTTTTCTTCGCTGGCATCCGCGATTCGTTAGC

>NZ_CP013102|3|3|1848101-1848190|CRISPRCasFinder
TTCGCTGGCATCCGCGATGCGTTAGC	TCGCTTCACGCGTCGCTGTTCGGGGTTTTGGTTTTTTC
TTCGCTGGCATCCGCGATTCGTTAGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013102.1\|WP_060600254.1\|1840632_1841400_-\|SGNH/GDSL-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|238141
NZ_CP013102.1\|WP_028368672.1\|1852562_1852724_-\|DUF1328-domain-containing-protein	unknown	unknown	gnl\|CDD\|227774
NZ_CP013102.1\|WP_060602578.1\|1848857_1849244_-\|SgcJ/EcaC-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226769
NZ_CP013102.1\|WP_060600262.1\|1852873_1853365_+\|DUF523-domain-containing-protein	unknown	unknown	gnl\|CDD\|377367
NZ_CP013102.1\|WP_060600264.1\|1853389_1854040_-\|LysE-family-transporter	unknown	unknown	gnl\|CDD\|273358
NZ_CP013102.1\|WP_054930150.1\|1854128_1854944_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_CP013102.1\|WP_060602575.1\|1838718_1840074_+\|2-hydroxycarboxylate-transporter-family-protein	unknown	unknown	gnl\|CDD\|377030
NZ_CP013102.1\|WP_054930130.1\|1837315_1838680_+\|short-chain-fatty-acid-transporter	unknown	unknown	gnl\|CDD\|224942
NZ_CP013102.1\|WP_060600260.1\|1845363_1848087_+\|alpha-ketoglutarate-dehydrogenase	unknown	unknown	gnl\|CDD\|237267
NZ_CP013102.1\|WP_060600256.1\|1842389_1842920_+\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NZ_CP013102.1\|WP_054930144.1\|1852276_1852480_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013102.1\|WP_036004315.1\|1850321_1851218_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|237907
NZ_CP013102.1\|WP_167352337.1\|1855266_1855506_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013102.1\|WP_054930131.1\|1840332_1840620_+\|PAAR-domain-containing-protein	unknown	unknown	gnl\|CDD\|269829
NZ_CP013102.1\|WP_060602584.1\|1851385_1852057_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP013102.1\|WP_054930133.1\|1841526_1841898_+\|DUF2591-domain-containing-protein	unknown	unknown	gnl\|CDD\|378491
NZ_CP013102.1\|WP_060602581.1\|1849326_1850223_-\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|227339
NZ_CP013102.1\|WP_060600258.1\|1843004_1844639_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|341275
NZ_CP013102.1\|WP_054930134.1\|1841943_1842216_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013102.1\|WP_036004308.1\|1844665_1845205_-\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439

Protein	Function_ID	Function_description	E-value
NZ_CP013102.1\|WP_060600254.1\|1840632_1841400_-\|SGNH/GDSL-hydrolase-family-protein	gnl\|CDD\|238141	cd00229, SGNH_hydrolase, SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.	7.01505e-17
NZ_CP013102.1\|WP_060600262.1\|1852873_1853365_+\|DUF523-domain-containing-protein	gnl\|CDD\|377367	pfam04463, DUF523, Protein of unknown function (DUF523). Family of uncharacterized bacterial proteins.	2.26146e-57
NZ_CP013102.1\|WP_060602578.1\|1848857_1849244_-\|SgcJ/EcaC-family-oxidoreductase	gnl\|CDD\|226769	COG4319, COG4319, Ketosteroid isomerase homolog [Function unknown].	1.14654e-23
NZ_CP013102.1\|WP_060600264.1\|1853389_1854040_-\|LysE-family-transporter	gnl\|CDD\|273358	TIGR00949, Uncharacterized_membrane_protein_YahN, The Resistance to Homoserine/Threonine (RhtB) Family protein. [Transport and binding proteins, Amino acids, peptides and amines].	1.39637e-22
NZ_CP013102.1\|WP_054930150.1\|1854128_1854944_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	1.40763e-28
NZ_CP013102.1\|WP_060602575.1\|1838718_1840074_+\|2-hydroxycarboxylate-transporter-family-protein	gnl\|CDD\|377030	pfam03390, 2HCT, 2-hydroxycarboxylate transporter family. The 2-hydroxycarboxylate transporter family is a family of secondary transporters found exclusively in the bacterial kingdom. They function in the metabolism of the di- and tricarboxylates malate and citrate, mostly in fermentative pathways involving decarboxylation of malate or oxaloacetate.	8.88668e-166
NZ_CP013102.1\|WP_054930130.1\|1837315_1838680_+\|short-chain-fatty-acid-transporter	gnl\|CDD\|224942	COG2031, AtoE, Short chain fatty acids transporter [Lipid metabolism].	7.95578e-109
NZ_CP013102.1\|WP_060600260.1\|1845363_1848087_+\|alpha-ketoglutarate-dehydrogenase	gnl\|CDD\|237267	PRK13012, PRK13012, 2-oxoacid dehydrogenase subunit E1; Provisional.	0
NZ_CP013102.1\|WP_060600256.1\|1842389_1842920_+\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	3.42921e-41
NZ_CP013102.1\|WP_028368672.1\|1852562_1852724_-\|DUF1328-domain-containing-protein	gnl\|CDD\|227774	COG5487, COG5487, Small integral membrane protein [Function unknown].	0.00648885
NZ_CP013102.1\|WP_036004315.1\|1850321_1851218_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|237907	PRK15092, PRK15092, DNA-binding transcriptional repressor LrhA; Provisional.	6.676e-48
NZ_CP013102.1\|WP_054930131.1\|1840332_1840620_+\|PAAR-domain-containing-protein	gnl\|CDD\|269829	cd14744, PAAR_CT_2, proline-alanine-alanine-arginine (PAAR) domain with uncharacterized C-terminal extension. This domain is found in the PAAR (proline-alanine-alanine-arginine) repeat family of mostly beta- and gamma-proteobacteria, and forms a sharp conical extension on the VgrG spike, a trimeric protein complex of the bacterial type VI secretion system (T6SS). Most members contain C-terminal domain extensions corresponding to several uncharacterized domains such as S-type pyocin, DUF2235, DUF2345 and cytotoxic proteins. However, these terminal domains are exposed to solution, and do not distort the binding site of VgrG. The pointed tip of the PAAR domain is stabilized by a zinc atom positioned close to the cone's vertex and is likely to be important for its integrity during penetration of the target cell envelope. VgrG proteins are orthologous to the central baseplate spikes of bacteriophages with contractile tails, and genes encoding proteins with PAAR motifs have been frequently found immediately downstream from vgrG-like genes.	4.00609e-23
NZ_CP013102.1\|WP_054930133.1\|1841526_1841898_+\|DUF2591-domain-containing-protein	gnl\|CDD\|378491	pfam10765, DUF2591, Protein of unknown function (DUF2591). This bacterial family of proteins has no known function.	1.34035e-27
NZ_CP013102.1\|WP_060602584.1\|1851385_1852057_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	6.14045e-12
NZ_CP013102.1\|WP_060602581.1\|1849326_1850223_-\|EamA-family-transporter	gnl\|CDD\|227339	COG5006, rhtA, Threonine/homoserine efflux transporter [Amino acid transport and metabolism].	3.24809e-57
NZ_CP013102.1\|WP_060600258.1\|1843004_1844639_+\|AMP-binding-protein	gnl\|CDD\|341275	cd05971, MACS_like_3, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS). MACS catalyzes the two-step activation of medium chain fatty acids (containing 4-12 carbons). The carboxylate substrate first reacts with ATP to form an acyl-adenylate intermediate, which then reacts with CoA to produce an acyl-CoA ester. MACS enzymes are localized to mitochondria.	0
NZ_CP013102.1\|WP_036004308.1\|1844665_1845205_-\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	1.68736e-48

>NZ_CP013102.1|WP_060600260.1|1845363_1848087_+|alpha-ketoglutarate-dehydrogenase
MTDLSSGARPVLALTQARIDSDPQETAEWLAALDGVVQHVGLERAQYLFDRLAAHALGNGVATARANVTPYANTISVDQQPPYPGDLDTEEKLAAALRWNALAMVVRANRAYGELGGHIASYASAADLFEVGFNHFFRAASQSPGGHGGDLVYFQPHSSPGVYARAFLEGFLDETHLEHYRREIAGPGLCSYPHPWLMPDFWQFPTGSMGIGPINSIYQARFMRYLQNRGLQKTEGRKVWGFFGDGEMDEPESIGALSLAAREGLDNLVFVINCNLQRLDGPVRSNGRIIDELEAQFTGAGWNVIKVVWGSDWDGLFARDRTGALLRAFAHTVDGQFQTFSANDGAYNRERFFGQNPELAALAAHLSNDDIDRLRRGGHDVRKLHAAYDRALKHIGQPTVILAKTMKGFGMGAIGQGRMTTHQQKKLDVEQLKAFRDRFRLPLSDSDVEQLKFYKPAENSPEMQYLHARRAALGGYLPRRRKAASQTPTVPALSSWGQFALDANGKEMSTTMAIVRMLGSLLKDASLGPRVVPVVADEARTFGMANLFRQVGIYSPLGQLYEPEDMGSMLYYREDTGGQILEEGISEAGAVSSWIAAATSYSVHDLPMLPFYIYYSMFGFQRIGDLIWAAADQRARGFLIGATAGKTTLGGEGLQHQDGTSHLAASTVPNCRAYDPAFAYEVAMIVDEGMQEMIGRQRDVFYYLTVTNENYAQPSLPADSVDRVREGVLKGMYALDVASLETAQVQLLGSGAILGEVQAAARMLKDDWNIDAAVWSVTSFTELHRDGVASERAERLFGDHGTGTPYVTSALAASRGPVIAATDYVRAVPELIRAFVSRRYVTLGTDGFGRSDTRAALRAFFEVDRASIVIAALKALAEEGAVARGVVEEALARYGCHRDGRAAPWER
>NZ_CP013102.1|WP_036004308.1|1844665_1845205_-|Lrp/AsnC-family-transcriptional-regulator
MSSEARPAARRLDRIDIAILQQLQQNARITNAELARAVNLSPTPCFNRVRALEKLGLFRQQVTLLDAGALGLRINVFIQVSLEKQVEDALRRFEQEVGERPEVMECYLMTGDADYLLRVVVPDMQSLERFIVQWLTKIPGVSNIRSSFALKQVRYKTALPLPVAGLTLPTEDDTPREWA
>NZ_CP013102.1|WP_060600258.1|1843004_1844639_+|AMP-binding-protein
MLPAADTYDGLVAAFEWRIPPQYNIGIDACDKWADGSGRLALICETRDGQATRYSFDQLKSLSDRFANALRRSGVKKGDRVGIFLAQSVETALAHLAVYKCGAIAVPLFALFGPDALQYRLSDSGAVALVTDLGGAQKIASVRASLPELRSIFCVDAEHADTALQVESFWSALDESPAAFDAEPTAADDPAVIIYTSGTTGKPKGALHAHRVLLGHLPGVEMPQAFFPNDARLMWTPADWAWIGGLFDVLLPSWHHGVAVLARRFEKFDGEAAFDLMQRHAVTHTFLPPTALKMMRAVEHPERWKLSLRAVASGGESLGAELIEWGRRALGVTINEFYGQTECNVVVSSCATLFDPCFGSIGKVVPGHRVAIVDDAGHTVPRGEPGNIAIHAPDPVMFLGYWRNESATRDKFRGDWLLTGDMGLMDADGFIRFVGRDDDVITSAGYRIGPAPIEDCLLRHPAVRMAAVVGAPDAQRTEIVTAFVVLNPGYQASDALVQTLQLHVKTHLAAHEYPRAIHFVDALPMTATGKVIRRELRERVTPPR
>NZ_CP013102.1|WP_060600256.1|1842389_1842920_+|MgtC/SapB-family-protein
MGGWWHEVWLTMAREFSDLNDVKAITQVVMRLGLALLLGGALGFEREMAGRDAGLRTHMLVATGSALFVLVPLQAGFSQDNMSRVLQGLVSGIGFLGAGAIIKLSAQREVRGLTTAASLWLAAGVGVAAGLGREATAILSTVIALAILGGVRMIKPLVPPYTHDVPAQDESSKRVE
>NZ_CP013102.1|WP_054930134.1|1841943_1842216_-|hypothetical-protein
MKKCILLAGIGVLAACTAVSGVDRKQNGYLSVTSRGRISLISWNSVRNAGIKHAKAYCREQNKELHTVEIHTNGVRSAGTQSVEVVFECI
>NZ_CP013102.1|WP_054930133.1|1841526_1841898_+|DUF2591-domain-containing-protein
MRVSELEGALLDYWVARADNLPKPRVDDGFCWIEEPACDGDPAGALEAAFAPSTDWAQCGPIIERARIHLVPAAAGDRASWTGSVPAGASTIEQVGESPLIAAMRAFVASRFGDTVADEAGTH
>NZ_CP013102.1|WP_060600254.1|1840632_1841400_-|SGNH/GDSL-hydrolase-family-protein
MTFDYRQASPCAKPSPRRSHALAAVLLGIAALQADAAAGRTRAAATADRPVIIDAQGDSTMFGYQTSDGFNKSWQTPDNPPALLQAALQARFGPRVIVQNNGVPGATLVDREKGINGYSQPYAQWAATSPAHIVIVNFALNDADNHVKEPPSAFRAHLMRFIEESQGAGRIVVLEEPNPVDYSVNKRIVPRYVAVVDEMAKHYRLALIRQYAYIGAMHDWRSLLIDGVHPTDALYRLKAERQRAVVAPIVAKLVE
>NZ_CP013102.1|WP_054930131.1|1840332_1840620_+|PAAR-domain-containing-protein
MKRYLILNGDKTTVSGTVQAVSSTIQLEGRDVAHEGDNVICPACNTTGKIRCDGPREVMTAPDGRHAALSDDLCICKCEPPPKLVASQQTFSVGE
>NZ_CP013102.1|WP_060602575.1|1838718_1840074_+|2-hydroxycarboxylate-transporter-family-protein
MKSSTQAALSATSSGRTQAPHAVVEWWWRVFDLRIGSLPLPVYVLMLGVLGAMAAKGKLAADLPTGIALVAVGGFTCAELAKRIPWIRHIGATSIFAAFIPSMLVYYKLMPEPVVKAVTTFTKTSNFLYLFIAAIIVGSVLSMDRQMLIKGFVRIFVPVAAGSVAAALVGTAVGTALGLDARHALFMVVVPIMAGGVGEGALPLSAGYAQIMGVEQGPLFAQVLSAVMLGNIAAICCAGLLSYLGTRRPEWTGNGRLTRAGDSDDDIAQRPASFEFDVGSVAAAGSTAIAFYLLGVLSHQLFGWPAPVVMLVLVVAAQLFQLVSPRVRGGARFMYGFFSTAVTYPLMFAISVAMTPWGEIVTAFHWVNIVTAVSTVLTLTVTGFFVGRLVGMYPVEAAIVNATHSGLGGTGDVAILTAANRMELMPFAQIATRIGGALTVMAALGVFAYWK
>NZ_CP013102.1|WP_054930130.1|1837315_1838680_+|short-chain-fatty-acid-transporter
MKSTVAPTSVRKTRFTEATIGLFERTIPDPFVLAILITAIVAVLSAMFAPHASLGKLVGGWYKGFFDILTFAFQITLVLVTGHAFAHAPIVQRVFKSLVSVARTPVQAATLTFVLVAVASFCNWGLGLVVSALLAREVAKRMRVDFAWIVAAGFSGWVVWASGISSSIALAQSTPGSAMNVVQKITGEVLPFSATVFTGFNLVPTIAMLLAMPFVLAWLKPRDEDAVLLDTQKHPDAAPREKPTGKLSFARWIEYSWLGSAFIGATGIALLVLAQSEHIAFSGVNAVIFVMFIAGVILHGYPLAYADAVKNAARQTGSMMLQYPLYGGIMGMMDATGLPNVISHFFIAISNAHTLPFWSYVCSLIVTFFIPSGGGHWAVQGPFVVPAAVALHASVPATTMAVAMGEQVSNMMQPFWAAPVVAMAGIGVQRVLGFTVMTFIVGALVYGAALLLLV
>NZ_CP013102.1|WP_060602578.1|1848857_1849244_-|SgcJ/EcaC-family-oxidoreductase
MTDDERAIRELIDTWLAASKAGETATVMSLMTDDAVFMVPGQKPFGKAAFGVAAEGQKNVDIDGKSEILELQVLGDWAFLRSQLEVTITLKDGSAPPVRHAGNTLTILRKETDGRWLVARDANLLVKG
>NZ_CP013102.1|WP_060602581.1|1849326_1850223_-|EamA-family-transporter
MKNSTLAEPIAFDTAPVSSAPKLHVGMAALLGVLSMSCVQFGAALSAPTMAAFGAFSTTWLRLAWAALILALVVRPKLRSYSRAHWLAAGVLGVAMAGMTLCFFSAIERIPLGLAVAIDFLGPLAVATLGVRRLRALLWPLLAVAGVLLLAHDRSGWIGEPVGMLLAAGAACGWGSYIVLMKKTGALFDGLEGLSVSLIAAALVATPFGLVEHGLHIAPMQLAATAGLAVLVPLLPYALEMIALRHMPAASFGILMSVEPAIGAAAGFIVLHQPMTALQLAGTLFVVSASVGVIVTSK
>NZ_CP013102.1|WP_036004315.1|1850321_1851218_+|LysR-family-transcriptional-regulator
MRDFDSSLLRAFVTVAETGAVSAAAVRLARTQAAVSMQLRRLEDDIGQRLLERSPRGVRLTDAGHRLLPYAHAILGAGEDARRALEVGDVAGTVRLGMLEDVAVGRLPRALRRFSAAHPQVALEIVVDASAALSQRLNEGALDVLVGDPAMVDATPLVTWTQPLFWVGARGYLADPQSPLPLVAFGGACLWQQQVMTALRRAGIAWRVVCTSTSLPAVQSAVEAGLGVSVLLDGNIRYDTMRVLGAADGLPEPPAADLGLFVRQAAGAQEAAVDALRTFLCEALDLDFIERTSRAPRR
>NZ_CP013102.1|WP_060602584.1|1851385_1852057_+|TetR/AcrR-family-transcriptional-regulator
MPTTHPSRRQPKQARAEFALDSILEAAARTLESHGKAGLTTQRVADTAGFSIGAIYQYFPNKEGLVEALASRELERLTAMMKEALTQPAPFGTGLNARRMMRATAAFIGDRPRLYSILRAEWADAAPDTAIGEGMRRYFELIAGTLNRENPDLGKRIACDEARFVLFRAISGVLLATALERPHYFGTDAFEDEMVRLILGFLNYDLDPDIPRLAPEGGSFTSA
>NZ_CP013102.1|WP_054930144.1|1852276_1852480_+|hypothetical-protein
MNHHQLESALDHLEHILARISGTDHLPLSYWRKRVDDVTAAARIPAQKNRARRLDEALSALESRAGA
>NZ_CP013102.1|WP_028368672.1|1852562_1852724_-|DUF1328-domain-containing-protein
MLRYAAIFFVIAIIAAVFGFGGIAAGAAEIAKVLFFIFIVIFLVTLLMGVIRR
>NZ_CP013102.1|WP_060600262.1|1852873_1853365_+|DUF523-domain-containing-protein
MKRILVSACLAGLPVRYDGSAKTLASMLLQTWRDEGRLVVVCPEVAAGFATPRRPAEIQLRRNGHDVLDGTARIRDNAGADVTALFIDGARHALQQALAHDCRYALLADGSPSCGSSFIHDGTFSRVAHEAVGVTAALLERHGIRVFAPDGIDELAASINVDG
>NZ_CP013102.1|WP_060600264.1|1853389_1854040_-|LysE-family-transporter
MGLSLQQFAMVAGAHLLALLSPGPDFFLIARSALLRGWRKTGAVCFGIACANGVFIVLAVGGFAALHRHGIAFALVQAAGCAYLFYLGVLMLRHARAASIAAHVQDDSPASNTGAWPTRFAMGFASAILNPKNALFYASLFALLAARDAPFSAQIVYGVWMFAAVFGWDLLVAMGVGHPAVVARFTRHGAAIERVTGVVLLAIATSVLTMLAREWL
>NZ_CP013102.1|WP_054930150.1|1854128_1854944_-|helix-turn-helix-transcriptional-regulator
MNDQRYWCDPQLPFVESRRASHSRACYVPHTHETLSIGAVDSGHSNYACGGDRARLGPGSLVLIPAMRVHSCNPDAQSEWSYQMLHLDVAWASAVLRENGSADADTVLACPSINQNREAYLRYCALNRLLFSNADSGEKEAALILFVGERSWLGEARDLPPVPRIAGERLARITGLLHDAYGERLPIAQLAQMAGMSRYAFIRAFRAATGMSPHAYQLDLRINAARRLLRHGRALTAIAHELGFADQAHFQRAFKERVAMTPGAYRRAAVS
>NZ_CP013102.1|WP_167352337.1|1855266_1855506_-|hypothetical-protein
MHYPVERLSRFEYRLNPHWHTIFSSVLLLFTDRFLKPVSPGIYVPTAALDGQLLNIWRPLHADENLQTGKIRGYEALSL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP013102_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013102_4

2640417-2640479

Orphan

Consensus_repeat	Method
GCAGCAGCCGCAGTATCAGCAGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013102_4

>merge|NZ_CP013102|4|2640417-2640479|CRISPRCasFinder
GCAGCAGCCGCAGTATCAGCAGCCTTATCAACAGCCCTATCAGCAGCCGTATGCGCAGCAGCC

>NZ_CP013102|4|4|2640417-2640479|CRISPRCasFinder
GCAGCAGCCGCAGTATCAGCAGCC	TTATCAACAGCCCTA
TCAGCAGCCGTATGCGCAGCAGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013102.1\|WP_060601241.1\|2646240_2647452_+\|putative-DNA-modification/repair-radical-SAM-protein	unknown	unknown	gnl\|CDD\|188431
NZ_CP013102.1\|WP_054934497.1\|2641009_2641828_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197715
NZ_CP013102.1\|WP_060601250.1\|2651116_2651935_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237171
NZ_CP013102.1\|WP_054934502.1\|2634719_2636216_-\|NCS1-family-nucleobase:cation-symporter-1	unknown	unknown	gnl\|CDD\|271404
NZ_CP013102.1\|WP_060601234.1\|2642012_2642858_+\|carbon-nitrogen-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|143600
NZ_CP013102.1\|WP_054934504.1\|2632667_2633621_-\|allantoinase-PuuE	unknown	unknown	gnl\|CDD\|211797
NZ_CP013102.1\|WP_060601244.1\|2647467_2648928_+\|UdgX-family-uracil-DNA-binding-protein	unknown	unknown	gnl\|CDD\|274850
NZ_CP013102.1\|WP_060601236.1\|2643028_2644369_+\|APC-family-permease	unknown	unknown	gnl\|CDD\|223605
NZ_CP013102.1\|WP_054934501.1\|2636610_2637327_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_CP013102.1\|WP_060601247.1\|2649322_2650906_-\|glutamine-hydrolyzing-GMP-synthase	unknown	unknown	gnl\|CDD\|234614
NZ_CP013102.1\|WP_054934529.1\|2638595_2639231_-\|tRNA-adenosine(34)-deaminase-TadA	unknown	unknown	gnl\|CDD\|182786
NZ_CP013102.1\|WP_060601253.1\|2653709_2654684_+\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|223769
NZ_CP013102.1\|WP_060601226.1\|2637655_2638582_-\|muramoyltetrapeptide-carboxypeptidase	unknown	unknown	gnl\|CDD\|183059
NZ_CP013102.1\|WP_060601229.1\|2639815_2640052_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013102.1\|WP_060602705.1\|2639254_2639656_-\|DUF1992-domain-containing-protein	unknown	unknown	gnl\|CDD\|182303
NZ_CP013102.1\|WP_054934486.1\|2651941_2653402_-\|IMP-dehydrogenase	unknown	unknown	gnl\|CDD\|235507
NZ_CP013102.1\|WP_060601239.1\|2644433_2645975_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|276809
NZ_CP013102.1\|WP_060601223.1\|2632149_2632671_-\|2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline-decarboxylase	unknown	unknown	gnl\|CDD\|132208
NZ_CP013102.1\|WP_060601225.1\|2633776_2634634_-\|aspartate/glutamate-racemase-family-protein	unknown	unknown	gnl\|CDD\|226611
NZ_CP013102.1\|WP_042313548.1\|2631069_2632083_-\|allantoicase	unknown	unknown	gnl\|CDD\|237319

Protein	Function_ID	Function_description	E-value
NZ_CP013102.1\|WP_060601241.1\|2646240_2647452_+\|putative-DNA-modification/repair-radical-SAM-protein	gnl\|CDD\|188431	TIGR03916, hypothetical_protein, putative DNA modification/repair radical SAM protein. This uncharacterized protein of about 400 amino acids in length contains a radical SAM protein in the N-terminal half. Members are present in about twenty percent of prokaryotic genomes, always paired with a member of the conserved hypothetical protein TIGR03915. Roughly forty percent of the members of that family exist as fusions with a uracil-DNA glycosylase-like region, TIGR03914. In DNA, uracil results from deamidation of cytosine, forming U/G mismatches that lead to mutation, and so uracil-DNA glycosylase is a DNA repair enzyme. This indirect connection, and the recurring role or radical SAM protein in modification chemistries, suggest that this protein may act in DNA modification, repair, or both. [Unknown function, Enzymes of unknown specificity].	0
NZ_CP013102.1\|WP_054934497.1\|2641009_2641828_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197715	smart00421, HTH_LUXR, helix_turn_helix, Lux Regulon. lux regulon (activates the bioluminescence operon.	1.13544e-14
NZ_CP013102.1\|WP_060601250.1\|2651116_2651935_-\|hypothetical-protein	gnl\|CDD\|237171	PRK12678, PRK12678, transcription termination factor Rho; Provisional.	0.000116883
NZ_CP013102.1\|WP_054934502.1\|2634719_2636216_-\|NCS1-family-nucleobase:cation-symporter-1	gnl\|CDD\|271404	cd11555, SLC-NCS1sbd_u1, uncharacterized nucleobase-cation-symport-1 (NCS1) transporter subfamily; solute-binding domain. NCS1s are essential components of salvage pathways for nucleobases and related metabolites; their known substrates include allantoin, uracil, thiamine, and nicotinamide riboside. NCS1s belong to a superfamily which also contains the solute carrier 5 family sodium/glucose transporters (SLC5s), and solute carrier 6 family neurotransmitter transporters (SLC6s).	0
NZ_CP013102.1\|WP_060601234.1\|2642012_2642858_+\|carbon-nitrogen-hydrolase-family-protein	gnl\|CDD\|143600	cd07576, R-amidase_like, Pseudomonas sp. MCI3434 R-amidase and related proteins (putative class 13 nitrilases). Pseudomonas sp. MCI3434 R-amidase hydrolyzes (R,S)-piperazine-2-tert-butylcarboxamide to form (R)-piperazine-2-carboxylic acid. It does so with strict R-stereoselectively. Its preferred substrates are carboxamide compounds which have the amino or imino group connected to their beta- or gamma-carbon. This subgroup belongs to a larger nitrilase superfamily comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13), class 13 represents proteins that at the time were difficult to place in a distinct similarity group. It has been suggested that this subgroup represents a new class. Members of the nitrilase superfamily generally form homomeric complexes, the basic building block of which is a homodimer. Native R-amidase however appears to be a monomer.	9.47942e-107
NZ_CP013102.1\|WP_054934504.1\|2632667_2633621_-\|allantoinase-PuuE	gnl\|CDD\|211797	TIGR03212, uraD_N-term-dom, putative urate catabolism protein. This model represents a protein that is predominantly found just upstream of the UraD protein (OHCU decarboxylase) and in a number of instances as a N-terminal fusion with it. UraD itself catalyzes the last step in the catabolism of urate to allantoate. The function of this protein is presently unknown. It shows homology with the pfam01522 polysaccharide deacetylase domain family.	0
NZ_CP013102.1\|WP_060601244.1\|2647467_2648928_+\|UdgX-family-uracil-DNA-binding-protein	gnl\|CDD\|274850	TIGR03914, SPO1_DNA_polymerase-related_protein, uracil-DNA glycosylase family domain. This model represents a clade within the uracil-DNA glycosylase superfamily. Among characterized proteins, it most closely resembles the Thermus thermophilus uracil-DNA glycosylase TTUDGA, which acts uracil (deamidated cytosine) in both single-stranded DNA and U/G pairs of double-stranded DNA. This domain may occur either as a stand-alone protein or as the C-terminal domain of a fusion with another domain that always pairs with a particular radical-SAM family protein.	4.64543e-70
NZ_CP013102.1\|WP_060601236.1\|2643028_2644369_+\|APC-family-permease	gnl\|CDD\|223605	COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism].	1.03432e-39
NZ_CP013102.1\|WP_054934501.1\|2636610_2637327_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	1.40394e-47
NZ_CP013102.1\|WP_060601247.1\|2649322_2650906_-\|glutamine-hydrolyzing-GMP-synthase	gnl\|CDD\|234614	PRK00074, guaA, GMP synthase; Reviewed.	0
NZ_CP013102.1\|WP_054934529.1\|2638595_2639231_-\|tRNA-adenosine(34)-deaminase-TadA	gnl\|CDD\|182786	PRK10860, PRK10860, tRNA-specific adenosine deaminase; Provisional.	1.83107e-63
NZ_CP013102.1\|WP_060601253.1\|2653709_2654684_+\|DMT-family-transporter	gnl\|CDD\|223769	COG0697, RhaT, Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only].	7.63537e-12
NZ_CP013102.1\|WP_060601226.1\|2637655_2638582_-\|muramoyltetrapeptide-carboxypeptidase	gnl\|CDD\|183059	PRK11253, ldcA, L,D-carboxypeptidase A; Provisional.	0
NZ_CP013102.1\|WP_060602705.1\|2639254_2639656_-\|DUF1992-domain-containing-protein	gnl\|CDD\|182303	PRK10203, PRK10203, hypothetical protein; Provisional.	2.11068e-23
NZ_CP013102.1\|WP_054934486.1\|2651941_2653402_-\|IMP-dehydrogenase	gnl\|CDD\|235507	PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed.	0
NZ_CP013102.1\|WP_060601239.1\|2644433_2645975_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	9.77969e-16
NZ_CP013102.1\|WP_060601223.1\|2632149_2632671_-\|2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline-decarboxylase	gnl\|CDD\|132208	TIGR03164, UHCUDC, OHCU decarboxylase. Previously thought to only proceed spontaneously, the decarboxylation of 2-oxo-4-hydroxy-4-carboxy--5-ureidoimidazoline (OHCU) has been recently been shown to be catalyzed by this enzyme in Mus musculus. Homologs of this enzyme are found adjacent to and fused with uricase in a number of prokaryotes and are represented by this model.	1.07871e-81
NZ_CP013102.1\|WP_060601225.1\|2633776_2634634_-\|aspartate/glutamate-racemase-family-protein	gnl\|CDD\|226611	COG4126, COG4126, Hydantoin racemase [Amino acid transport and metabolism].	4.45653e-87
NZ_CP013102.1\|WP_042313548.1\|2631069_2632083_-\|allantoicase	gnl\|CDD\|237319	PRK13257, PRK13257, allantoicase; Provisional.	0

>NZ_CP013102.1|WP_060601229.1|2639815_2640052_+|hypothetical-protein
MSHRNTTPAIVSIQQKRAAARRSRMPGAIRRRVGWYATMFVTGVALSLALSGCGVFCNVGGGSGGVGGSCGVGTGFRF
>NZ_CP013102.1|WP_060602705.1|2639254_2639656_-|DUF1992-domain-containing-protein
MKLLDALVEQRIAAAAARGEFDDLPGTGAPQVLDDDALVPEEVRVANRILKNAGFVPPAVEQLRALRDLQNELDAVSDRNSRCRLQAKMLALDMALESLRGGPMVMPREYCRRIAERLYERVADEPAAGAGPA
>NZ_CP013102.1|WP_054934529.1|2638595_2639231_-|tRNA-adenosine(34)-deaminase-TadA
MPSAVSVSSEDSGGALCSNVSDANADTPEPAPISERDRRFMALAQAAAEEARAAGEVPVGAVLVCGDEVIAKGFNHPIGGHDPSAHAEMAALRAAAQKLENYRLPGCELYVTLEPCLMCAGAIMHARIARVVYGARDPKTGACGSVVDAFANPQLNHHTTVTGGVLADECGAALRSFFADRRRAAREARAAAASSNASDAADPRPDTNPTH
>NZ_CP013102.1|WP_060601226.1|2637655_2638582_-|muramoyltetrapeptide-carboxypeptidase
MAKHRTIELIAPSGYPHDPNAVHVALKRLRAQGHHVENVSATQRRFQRFAGTDGERAAELNRLADPSRELPDIVLAVRGGYGAVRLLHGLDYRGLQRRLGDQPIAFCGHSDFTALQLALLSQANVKTFGGPMLAVDFGAESVSDFTMKHFWHALTSETFTISSTAPQSQTFDVTGTLWGGNLAVIASLVGSPYMPPVEGGILFVEDVNEQPFRIERLIYQLHLAGILERQQALVLGDFSGGKPFDYDNGYDLRAMVEQVRSVIGIPIVTGLQFGHIPDMVTLPVGAEARLVAGARGFKLTVSGHPVLD
>NZ_CP013102.1|WP_054934501.1|2636610_2637327_-|GntR-family-transcriptional-regulator
MSETPNATASSTKPEAIAERIRAAILEHRLAPGAKLTEAQLCEVFGVKRGPIRQALALLSTDHLVDLEPNRGAFVASPSLQEVHEVFEMRRIIELAVVDKICASQGSRRLKNIGGMIARERRAFESRDFPAWIRLSGEFHTELASLTGNTVLCDCLNGLVARSTLISALYESLGRSPCSFEDHEAILAALDAGDAKTAGALMSRHLQSVELKMLDRPASGGTDLHEVFGTRAPRAAAG
>NZ_CP013102.1|WP_054934502.1|2634719_2636216_-|NCS1-family-nucleobase:cation-symporter-1
MAQFSAAPDSSAIPDYESSEQGAHALPAGYSERLYNEDLAPLKHQTWGAYNIFAFWMSDVHSVGGYVFAGSLFALGLTSWQVLIALLVGITLVNVLCNMIAKPSQQNGVPYPVACRATFGVLGANVPAVIRGLIAVAWYGIQTYLASSALVIVVLKFFPQLLPYADVHHHGFMGLSTIGWAGFMLLWVLQALVFWNGMETIKKFIDFAGPAVYVVMFILAGYMIWRAGWKNIGINLGGVKYHGMEVIPVMITAISLVVSYFSGPMLNFGDFSRYGKSFRSVKRGNFWGLPVNFLAFSLVTVVTTAATLPVFGELITDPVETVGRIDYPTAVILGALTFTIATIGINIVANFVSPAFDFSNVAPKLISWRAGGMLAAVASIFITPWNLFNNPAVIHYTLDVLGSFIGPLYGILIVDFFLVKRQKIVLDDLYTVSEKGSYWYRNGVNYRAVGALLPAAVIAVICVMVPSLNALANFSWFIGAGLGAVFYSVLARDLPRGA
>NZ_CP013102.1|WP_060601225.1|2633776_2634634_-|aspartate/glutamate-racemase-family-protein
MRIKLINPNTTQRMTEAMGRCARDVVAPGTELVAVSPTMGPPSIEGYYDEALATPGLLAEIEAGERDGFDGYVIACFGDPGLYAARELARGPVIGIAEAAMHAASVLAPGFSVVTTLSRTCGMAWHLAERYGMKRFCRNVRATDVAVLELDQPGSSARRIILDECRRALDEDGSDAIVLGCAGMAELCREIEDALGAPVVEGVTAAVKWVEALVSLRLATAKRGDYARPLAKRYDGEFARFSPTGEQPAAAPAARQAAGDALLRVNSSALRADPAADIAPHIHSV
>NZ_CP013102.1|WP_054934504.1|2632667_2633621_-|allantoinase-PuuE
MSFDPNYPRDLIGYGRHPVQANWPGRARVAVQFVLNYEEGGENCVLHGDPGSEQFLSEIVGAASYPARHMSMESIYEYGSRAGVWRILREFEKRGLPLTVFGVGMAIERHPELARTFVELGHEIACHGYRWIHYQDMSPEREAEHMRLGMEAIERVTGQRPLGWYTGRDSPNTHRLVAEYGGFLYDSDNYGDDLPFWMDVEVTGGAKVPQLILPYTLDTNDMRFATPQGFNTADHFFTYLRDAFDVLYEEGDEAPKMLSIGMHCRLLGRPGRFRALQRFLDHIEKHERVWVTRRVDIARHWREHHPYQQQDNRGAAA
>NZ_CP013102.1|WP_060601223.1|2632149_2632671_-|2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline-decarboxylase
MKAMQYTLDQLNSISTDAFVAALSGIFEHSPWVAEVAAAQRPYASIDALHQTMSNAVETAGVAKQLALINAHPELAGKAAVRGELTAESTREQSGAGLGQCTQEEFDKLLRLNAAYREKFGFPFILAVRGYDRHGIIANFEARVNNSRADELRASLDQIYRIARFRLDDLISP
>NZ_CP013102.1|WP_042313548.1|2631069_2632083_-|allantoicase
MALPILDPNAPDFTRRFVNLADPRLGAQALEASDDFFAPKDRMLNPEPAVFIPGKYDEHGKWMDGWETRRKRTTGYDWCVVKLARPGVIKGLDLDTSHFTGNFPPAASVEAARVVDGAPNQSTQWTEIVPSTTLQGNSHHYLEVGDTNAYTHLRVNIYPDGGIARLRVYGQPQVDWAGASRTDLFDLAAMENGAYLVGANNQHFGAASTLLMPGRGVNMGDGWETRRRREPGNDWAIVALAQPGVIKKIEVDTAHFKGNYPDRCSIQAAYVTGGTDSSLITQAMFWPVLLGEQKLQMDKQHFFESEIAALGPVTHIRFNIIPDGGVSRLRLWGTLAS
>NZ_CP013102.1|WP_054934497.1|2641009_2641828_-|helix-turn-helix-transcriptional-regulator
MDFEWRDLAFHREIGSAIDALDGPHFWARLTRVLERHIGFDSWVALRFKRDAAPLVLAEQAMPDGKIDLMFQDYLAALYQLDPFYLAAFETQASGFYTLADVAPDNFRMTEYYQRYFKKNIVGDEVHFNVVIDRDHTMGFSLGKTSRYDERETALLTLYSPWVLALMQQRLRFEKFVGEEEPRAAGNDEADLHARFGMLTGKNGRGALTAREIEVAMLSLSGFSSRAIAEKLSISFETVRAHKKHIYAKLGVGSQSELFAMFYEPGRTVEPE
>NZ_CP013102.1|WP_060601234.1|2642012_2642858_+|carbon-nitrogen-hydrolase-family-protein
MQVELAQLTLIDGVVAHNTRKVVETIGSADAAGGTKLIVFPETTLSGFPTRENVADVAQTLDGPALSAVRDAARQQGVAVAVGLAERDGKQFYNTTVLVDERGDIVLRYRKTHLWASDVGVFTPGDRFETCVWNGLTVGLLICYDIEFPESARAVAALDADLLIVTNGNMDPFGPVHRRAITARAMENQMFALMVNRCGSGDDNLTFPGLSALIDPFGETVLELGGDETVTKATVDFKRLEASREHYNYLHDARVPLGLVPVEQSNGHRALMVEARRRRTD
>NZ_CP013102.1|WP_060601236.1|2643028_2644369_+|APC-family-permease
MQASSSHEPSHLKRTLGLPSVLLFGLAYMAPLIVYGTYGVLAKASDDTAALAYLLALIAIAFTALSYGKLARLFPVAGSAYTYTRKTFNAHLGFLIGWATLLDYFFLPMVIWLIGAAYLNAAFPHVPSWIWIVAFIVLTSGLNIVGIELAARFNIVLMVVQLAIVAMFVALCWHYASAAAGPGGIAMAEPFFKPHVPLGATMAGAAIAAYSYLGFDAVSTLTEETIDPKKNMPRAILLIALIGGAIFVIAAYTMQLAHPGVEFKDTDSAAFEVAKMIGGDIFVTVFLAGLILAQFASGISAQASVGRLLYAMGRDEILPKRFFGYIHPRFKTPAINIAIAGIVGLIALKLDVATSTSFINFGAFLAFTAVNLCVIRVYLSGNHGERKIGLLGGLVFPLIGAVADIWLLASLEKTALVLGAAWFVLGIAYLCWITRLFRQAPPEVAI
>NZ_CP013102.1|WP_060601239.1|2644433_2645975_-|tetratricopeptide-repeat-protein
MTSQPDIDERYAAAEQAFVAGDHDVARAYLNGVLQAHPGHAAALHLRGLVALEAKEPGGAAHWIEQALRVRPDPIFYNSLSVVQIRSGALAEGAASAQRGLDLARSEPSVSIDTSILAFNLGVALQLNDDMEAAEHAYRSVIATNPAHSGAHNNLGLVLNALGDVEAAIVHHGRAYELDPSNLEARSNIGHMMLAAGRYEEAWPHFEYRWAALGNNRGERGARPAEWPVPQWLGDAAPTRDARLFIVYEQGLGDALQFSRFFPLTLDRFSTIGFNCPKPLRRLFEDSFGERYPQLRLVDDVPSDWRDWDCYSPMLSLPMALGIGLQNLGSAPSRYLRADPQRAAYWRARLADVAPQGVPRIGMVWAGGKINAHMDRMRSIAPAQIERLLAWPRAQWISLQKADDASKELACVPRPNVTDWMNEIADFADTAALVEPLDLVIAVDTSVAHLAAAMGKRVWLLNRYAGCWRWLRERTDSPWYPGMRLFNQSERGNWVDVLSNLIDALEAEFPARA
>NZ_CP013102.1|WP_060601241.1|2646240_2647452_+|putative-DNA-modification/repair-radical-SAM-protein
MELLKKLEILADAAKYDASCASSGAPQRNSRGADGLGASTGAGICHSFTPDGRCVSLLKILLTNFCLYDCQYCVNRRTSNVPRARFTPEEVVSLTLDFYRRNYIDGLFLSSGVIRSSNYTMEQLVRVARSLREVHLFRGYIHLKTIPDADPELIAQAGRYADRLSVNIELPTEISLERLAPEKSARTIRLAMSSIRLASDEAGSDAKAPRFSPAGQSTQMIVGADDTSDSTILQTAETLYGAYRLKRVYYSAFSPIPDSPTALPAQAPPLLREHRLYQADFLLRGYGFRVDELFDTPGNLALDIDPKLAWALNHRERFPVDLNRASARMIARVPGIGMRNAKRLVELRRSRRIRYQDLVQLRCSMDKTRPFVVTADYRPAHADLSTQRLRHALTPPPTQLSLL
>NZ_CP013102.1|WP_060601244.1|2647467_2648928_+|UdgX-family-uracil-DNA-binding-protein
MQIISIDDDYQAWREAALQALASRMAPEDIDWRVIADDDRAATPALFDDRARVPRAAVAPAKVRISRELGELLKDAACYRDTARWAFLYRVLWRWHDGDRSVASAADCDGARLYKMAKAVRRAKHDMIAYVRFRLREPGNDVPAPDQPEYVAWYEPEHDVLAWSAEHFARRMGRSTWLISTPDAAAWWDGKNLRLEHRPASSSDHCRHTADEAEALWLAYYRSTFNPARLNETALEQHMPVRFWKGLPEGRLIPSMISEAKSGAQRIAQARGVGMLGGKSVPVDAHDAQPARAQPSTLDACRRCELWRHATQAVDGIGPDDARIMLIGEQPGDQEDLAGKPFIGPAGRLLDAAIERAGLRREHLYLTNAVKHFKWMLRGKRRLHKTAAQQEIEACGYWLQRELERVTPAVVVTLGATALTALLREKVSLRDWLDRPIEVDGMRVIATYHPSFALRQEHDEARERVLDAIASALARARDLADAERER
>NZ_CP013102.1|WP_060601247.1|2649322_2650906_-|glutamine-hydrolyzing-GMP-synthase
MHDKILILDFGSQVTQLIARRIREAHVLSEIHPHDVSDEFIREFKPKGIILSGGPNSVTESDTPRAPQAVFEAGVPVLGICYGMQTMAEQLGGKVETGHLREFGYAEVRARNHTSFLDGIQDFATSEGHGMLKVWMSHGDKVLEMPQGFQLMASTDSCPIAAMADEARHFYGLQWHPEVTHTVQGRAMLERFVLKICGAKPDWEMGNYIDEAVENIRKQVGDEHVILGLSGGVDSSVAAALLHRAIGDQLTCVFVDHGLLRLNEAEQVMAMFADNLGVKVIHVDASEAFMSKLKGVTDPEAKRKIIGAEFVEVFQAEAGKLTDAKWLAQGTIYPDVIESAGKGKKAAHTIKSHHNVGGLPETLNLKLLEPLRELFKDEVRELGVKLGLPPSMVYRHPFPGPGLGVRILGEVKRDYADLLRRADAIFIETLRTFIDKETGKSWYDLTSQAFAVFLPVKSVGVMGDGRTYEYVVALRAVQTLDFMTAHWAHLPHDLLGHVSNRIINEVRGINRVVYDISGKPPATIEWE
>NZ_CP013102.1|WP_060601250.1|2651116_2651935_-|hypothetical-protein
MKPLLRAVLIIDALLLLAFGLLFLLTPWKSLYDALQLVQTDPALVGQGAGIALIGLAWLALHASIDGAMTATTAKVVGHVNWLTGVLMLVWLVGLHTPQLTGFGQLVAVLTGVVLLIIGLGGVKLSSAVKRRERLAGTAAAERTDRVAAREAENEARKAERERNAARPGVVYPATTGPHVEPTLAATPAVGAATPVSPATGHPVEPGLTAQPPRATMPEAAAAAREDALAHERRAEAHQDAAARERAAAQRNEADARAAEAKSGTPRPPFHG
>NZ_CP013102.1|WP_054934486.1|2651941_2653402_-|IMP-dehydrogenase
MRLIQKALTFDDVLLVPAFSDVLPRDTSLKTRLTRNISLNMPLVSAAMDTVTEARLAIAMAQMGGVGIIHKNLTPAEQAREVAKVKRFESGVVRDPITVPPQMKVSDVIALSRQHGISGFPVVEGAQLIGIVTNRDLRFETRLDEPVRTIMTPRERLVTVKEGTPLAEAKALMHSHRLERVLVVNDAFELRGLMTVKDITKQTEHPDACKDEHGKLRAGAAVGVGADNEERVSLLVQAGVDVIVVDTAHGHSRGVLERVQWVKKNFPHVEVIGGNIATADAAKALVEYGADGVKVGIGPGSICTTRIVAGVGVPQISAIANVSAALKGTGVPVIADGGVRFSGDVSKALAAGANAVMMGSMFAGTEESPGDVFLYQGRQYKSYRGMGSVGAMKDGAADRYFQDNSANIDKLVPEGIEGRVAYKGSVGAILFQLIGGVRASMGYCGCRTIDELHDKASFVEITAAGMRESHVHDVQITKEAPNYHVD
>NZ_CP013102.1|WP_060601253.1|2653709_2654684_+|DMT-family-transporter
MQRGVVYGMLAGALWGMVFLVPRLLPDFSPVLLSAGRYAMYGVVSLLAALPSARSLLRRLTREDLNALVRLALAGNLLYYLLLTGAVHLVGIAPSSLIVGVLPVTVTLLGRRDHGAVPLARLAWPLALVVAGIACINVDVFGTAGETPGTIMNKLIGIACAVGALGCWTWFAVENARYLQRHTHFSGNEWSVLWGVVTGLLGALLWLVVAVLPSSAVDTTHVDTRWHLFWLLNLGLAIGASWLGNGLWNAASKRLPLTLSGQLIVFETLFALLYAFIYDHRMPRPLEMAAILLLVAGVSWSVRQHADDDSDRSTLEEKAQAAVH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP013102_1	1.1\|839588\|38\|NZ_CP013102\|CRISPRCasFinder	839588-839625	38	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1036124-1036161	2	0.947
NZ_CP013102_2	2.1\|850000\|38\|NZ_CP013102\|CRISPRCasFinder	850000-850037	38	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	63884-63921	2	0.947
NZ_CP013102_1	1.1\|839588\|38\|NZ_CP013102\|CRISPRCasFinder	839588-839625	38	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1551786-1551823	3	0.921
NZ_CP013102_1	1.1\|839588\|38\|NZ_CP013102\|CRISPRCasFinder	839588-839625	38	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	214984-215021	3	0.921
NZ_CP013102_1	1.1\|839588\|38\|NZ_CP013102\|CRISPRCasFinder	839588-839625	38	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1271522-1271559	4	0.895
NZ_CP013102_1	1.1\|839588\|38\|NZ_CP013102\|CRISPRCasFinder	839588-839625	38	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1313541-1313578	5	0.868
NZ_CP013102_1	1.1\|839588\|38\|NZ_CP013102\|CRISPRCasFinder	839588-839625	38	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1313683-1313720	5	0.868
NZ_CP013102_1	1.1\|839588\|38\|NZ_CP013102\|CRISPRCasFinder	839588-839625	38	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	290848-290885	5	0.868
NZ_CP013102_1	1.1\|839588\|38\|NZ_CP013102\|CRISPRCasFinder	839588-839625	38	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1316845-1316882	5	0.868
NZ_CP013102_1	1.1\|839588\|38\|NZ_CP013102\|CRISPRCasFinder	839588-839625	38	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	2554516-2554553	5	0.868
NZ_CP013102_2	2.1\|850000\|38\|NZ_CP013102\|CRISPRCasFinder	850000-850037	38	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1317562-1317599	5	0.868
NZ_CP013102_3	3.1\|1848127\|38\|NZ_CP013102\|CRISPRCasFinder	1848127-1848164	38	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1036168-1036205	5	0.868
NZ_CP013102_2	2.1\|850000\|38\|NZ_CP013102\|CRISPRCasFinder	850000-850037	38	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	2002081-2002118	7	0.816
NZ_CP013102_1	1.1\|839588\|38\|NZ_CP013102\|CRISPRCasFinder	839588-839625	38	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	535790-535827	8	0.789
NZ_CP013102_1	1.1\|839588\|38\|NZ_CP013102\|CRISPRCasFinder	839588-839625	38	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	271225-271262	8	0.789
NZ_CP013102_1	1.1\|839588\|38\|NZ_CP013102\|CRISPRCasFinder	839588-839625	38	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	515006-515043	8	0.789
NZ_CP013102_3	3.1\|1848127\|38\|NZ_CP013102\|CRISPRCasFinder	1848127-1848164	38	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	508524-508561	8	0.789
NZ_CP013102_1	1.1\|839588\|38\|NZ_CP013102\|CRISPRCasFinder	839588-839625	38	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	289790-289827	9	0.763
NZ_CP013102_2	2.1\|850000\|38\|NZ_CP013102\|CRISPRCasFinder	850000-850037	38	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1313714-1313751	9	0.763

1. spacer 1.1|839588|38|NZ_CP013102|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.947

aattcgcggatgccagcgcaaaggccaaaccaccaaac	CRISPR spacer
aattcgcggatgccagcgcaaagaccaaaacaccaaac	Protospacer
***********************.***** ********

2. spacer 2.1|850000|38|NZ_CP013102|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.947

gttcgg-tgttttggttttttcgctggcatccgcgattc	CRISPR spacer
-ttcggttgttttggtgttttcgctggcatccgcgattc	Protospacer
 ***** ********* **********************

3. spacer 1.1|839588|38|NZ_CP013102|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.921

aattcgcggatgccagcgcaaaggcca-aaccaccaaac	CRISPR spacer
aattcgcggatgccagcgcaaaggccataacaaccaga-	Protospacer
*************************** *** ****.*

4. spacer 1.1|839588|38|NZ_CP013102|CRISPRCasFinder matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.921

aattcgcggatgccagcgcaaaggccaaaccaccaaac-	CRISPR spacer
aattcgcggatgccagcgcaaagg-caaacgcccaaacg	Protospacer
************************ *****  ******

5. spacer 1.1|839588|38|NZ_CP013102|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.895

aattcgcggatgccagcgcaaaggccaaaccaccaaac	CRISPR spacer
aaaacgcggatgccagcgcaaaggcaaaacaaccaaac	Protospacer
**  ********************* **** *******

6. spacer 1.1|839588|38|NZ_CP013102|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.868

aattcgcggatgccagcgcaaaggccaaaccaccaaac	CRISPR spacer
ccagcgcggatgccagcgcaaaggccaaaacaccaaac	Protospacer
    ************************* ********

7. spacer 1.1|839588|38|NZ_CP013102|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.868

aattcgcggatgccagcgcaaaggccaaaccaccaaac	CRISPR spacer
ccagcgcggatgccagcgcaaaggccaaaacaccaaac	Protospacer
    ************************* ********

8. spacer 1.1|839588|38|NZ_CP013102|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.868

aattcgcggatgccagcgcaaaggccaaaccaccaaac	CRISPR spacer
gaatcgcggatgccagcgcaaagaccaaaacaccaaaa	Protospacer
.* ********************.***** *******

9. spacer 1.1|839588|38|NZ_CP013102|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.868

aattcgcggatgccagcgcaaaggccaaaccaccaaac	CRISPR spacer
gaaacgcggatgccagcgcaaaggccaaaacaccgaac	Protospacer
.*  ************************* ****.***

10. spacer 1.1|839588|38|NZ_CP013102|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.868

aattcgcggatgccagcgcaaaggccaaaccaccaaac	CRISPR spacer
atcacgcggatgccagcgcaaaggcgaacccaccaaac	Protospacer
* . ********************* ** *********

11. spacer 2.1|850000|38|NZ_CP013102|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.868

gttcggtgttttggttttttcgctggcatccgcgattc	CRISPR spacer
gttcggtgtttttgctttttcgctggcatccgcgctat	Protospacer
************ *.******************* * .

12. spacer 3.1|1848127|38|NZ_CP013102|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.868

tcgcttcacgcgtcgctgttcggggttttggttttttc	CRISPR spacer
gtgcttcacgcgtcgccgttcggggttttggtctttgc	Protospacer
 .**************.***************.*** *

13. spacer 2.1|850000|38|NZ_CP013102|CRISPRCasFinder matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.816

gttcggtgttttggttttttcgctggcatccgcgattc	CRISPR spacer
gtggtttgctttggctttttcgctggcatccgcgatgc	Protospacer
**    **.*****.********************* *

14. spacer 1.1|839588|38|NZ_CP013102|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.789

aattcgcggatgccagcgcaaaggccaaaccaccaaac	CRISPR spacer
aattcgcggatgccagcgcaaaagcaaaacaagccgga	Protospacer
**********************.** **** * * ..

15. spacer 1.1|839588|38|NZ_CP013102|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.789

aattcgcggatgccagcgcaaaggccaaaccaccaaac	CRISPR spacer
aattcgcggatgccagcgcaaagtcaaacgcccgacgc	Protospacer
*********************** * **  * * * .*

16. spacer 1.1|839588|38|NZ_CP013102|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.789

aattcgcggatgccagcgcaaaggccaaaccaccaaac	CRISPR spacer
aattcgcggatgccagcgcaaagtcaaacgcccaacgc	Protospacer
*********************** * **  * * * .*

17. spacer 3.1|1848127|38|NZ_CP013102|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.789

tcgcttcacgcgtcgctgttcggggttttggttttttc	CRISPR spacer
tcgcttcacgcgtcgccgttcggtgttatcggcctttg	Protospacer
****************.****** *** * * ..***

18. spacer 1.1|839588|38|NZ_CP013102|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.763

aattcgcggatgccagcgcaaaggccaa-----accaccaaac	CRISPR spacer
aattcgcggatgccagcgcaaacgcaaaccgcggccgc-----	Protospacer
********************** ** **     .**.*

19. spacer 2.1|850000|38|NZ_CP013102|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.763

gttcggtgttttggttttttcgctggcatccgcgattc	CRISPR spacer
gcgctgggcgtttgctttttcgctggcatccgcgattt	Protospacer
*. * * *. ** *.**********************.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1165554 : 1178360

Pandoravirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060599712.1\|1165554_1167504_+	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	7.7e-148	48.8
WP_060599713.1\|1167758_1168892_+	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	4.8e-25	36.9
WP_060599714.1\|1168916_1170797_+	aminodeoxychorismate synthase component I	S4VNU7	Pandoravirus	4.1e-53	34.1
WP_054928902.1\|1170833_1171649_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	1.7e-35	30.2
WP_036003941.1\|1171690_1172371_-	deoxynucleoside kinase	A0A0C5K8U0	Enterococcus_phage	5.1e-06	28.0
WP_054928901.1\|1172382_1172946_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	S4VNV0	Pandoravirus	3.2e-14	40.1
WP_060599715.1\|1172994_1174617_-	polynucleotide adenylyltransferase PcnB	A0A172Q0J1	Acinetobacter_phage	1.0e-15	30.3
WP_054928899.1\|1174613_1175300_-	HAD-IB family hydrolase	NA	NA	NA	NA
WP_054928898.1\|1175292_1176075_-	DnaA regulatory inactivator Hda	NA	NA	NA	NA
WP_054928897.1\|1176118_1177195_-	AI-2E family transporter	NA	NA	NA	NA
WP_060599716.1\|1177292_1178360_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	5.3e-74	46.2

DBSCAN-SWA_2

1339268 : 1345013

Enterobacteria_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060599815.1\|1339268_1340174_+	NAD-dependent epimerase/dehydratase family protein	I7HTA3	Enterobacteria_phage	1.7e-20	28.9
WP_060602506.1\|1340291_1341422_+\|transposase	transposase	A0A0R8V9X2	Thermobifida_phage	7.2e-29	31.0
WP_060599817.1\|1341596_1342658_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	5.1e-85	47.4
WP_060599819.1\|1342668_1343562_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	9.8e-98	58.5
WP_060599821.1\|1343546_1344098_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	1.5e-48	53.6
WP_060599823.1\|1344113_1345013_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	5.7e-29	34.5

DBSCAN-SWA_3

1600355 : 1614578

Achromobacter_phage(30.0%)

tail,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060600077.1\|1600355_1600559_+	hypothetical protein	A0A2H4EUL1	Aeromonas_phage	8.3e-05	41.9
WP_060600079.1\|1600560_1602042_+\|portal	phage portal protein	B7SYD6	Stenotrophomonas_phage	3.6e-73	37.3
WP_060600081.1\|1602107_1604201_+	peptidase U35	A0A076G7Y9	Pseudoalteromonas_phage	3.7e-63	30.3
WP_060600083.1\|1604274_1604619_+	DUF2190 family protein	NA	NA	NA	NA
WP_098021521.1\|1604656_1604917_+	hypothetical protein	NA	NA	NA	NA
WP_060600087.1\|1604913_1605339_+	hypothetical protein	NA	NA	NA	NA
WP_082670369.1\|1605425_1606346_+	hypothetical protein	G8GWF3	Rhodobacter_phage	8.4e-52	39.5
WP_060600091.1\|1606406_1606745_+	hypothetical protein	NA	NA	NA	NA
WP_063803366.1\|1606816_1607122_+	hypothetical protein	A0A1B0VMG9	Pseudomonas_phage	3.0e-06	36.8
WP_060600093.1\|1607173_1610005_+\|tail	tail tape measure protein	A0A0U5KRL2	unidentified_phage	7.5e-27	29.9
WP_148654567.1\|1610073_1610502_+	hypothetical protein	B5WZT5	Pseudomonas_phage	1.3e-12	39.6
WP_060600096.1\|1610501_1611041_+	DUF1833 family protein	A0A0B5A6T7	Achromobacter_phage	9.3e-35	47.1
WP_082670323.1\|1611037_1611427_+	hypothetical protein	A0A0G3EYJ9	Achromobacter_phage	1.1e-32	52.0
WP_148654568.1\|1611539_1614578_+	hypothetical protein	A0A0B5A1N2	Achromobacter_phage	1.6e-160	43.7

DBSCAN-SWA_4

1617918 : 1624501

Burkholderia_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_148654570.1\|1617918_1618494_+	lysozyme	A0A221SAM6	Ralstonia_phage	1.1e-41	53.5
WP_060600108.1\|1618498_1619068_+	hypothetical protein	A4JX21	Burkholderia_virus	2.3e-23	43.4
WP_060600110.1\|1619575_1619875_-	hypothetical protein	Q8W6R9	Burkholderia_virus	2.2e-06	41.7
WP_060600112.1\|1620104_1620896_+	DNA adenine methylase	Q8W6S4	Burkholderia_virus	1.2e-128	80.6
WP_060600114.1\|1621027_1622149_+	sensor histidine kinase	A0A1B0VMK3	Pseudomonas_phage	1.6e-49	34.3
WP_082670326.1\|1622611_1624501_+	AAA family ATPase	C7BGE8	Burkholderia_phage	6.4e-06	33.3

DBSCAN-SWA_5

2151879 : 2171799

Marinobacter_phage(11.11%)

tail,terminase,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060600550.1\|2151879_2154609_+	virulence protein E	A0A2D1GN57	Marinobacter_phage	1.3e-89	45.5
WP_082670373.1\|2154891_2155641_+	hypothetical protein	NA	NA	NA	NA
WP_060600558.1\|2155896_2156652_+	hypothetical protein	A0A291AUT0	Sinorhizobium_phage	6.0e-24	37.1
WP_060600561.1\|2156844_2157492_+	hypothetical protein	NA	NA	NA	NA
WP_060602641.1\|2157439_2159509_+\|terminase	phage terminase large subunit family protein	A0A2H4JIC6	uncultured_Caudovirales_phage	7.1e-99	37.5
WP_060600563.1\|2159505_2159895_+	hypothetical protein	G8GWD9	Rhodobacter_phage	2.0e-15	38.0
WP_060600566.1\|2159897_2160101_+	hypothetical protein	A0A219YA34	Aeromonas_phage	5.8e-06	53.8
WP_060600569.1\|2160102_2161566_+\|portal	phage portal protein	B7SYD6	Stenotrophomonas_phage	1.5e-79	38.2
WP_060600572.1\|2161631_2163725_+	peptidase U35	A0A076G7Y9	Pseudoalteromonas_phage	4.7e-66	33.4
WP_060600574.1\|2163805_2164135_+	DUF2190 family protein	NA	NA	NA	NA
WP_060600576.1\|2164131_2164443_+	hypothetical protein	NA	NA	NA	NA
WP_060600578.1\|2164439_2164871_+	hypothetical protein	NA	NA	NA	NA
WP_060600581.1\|2164928_2165861_+	hypothetical protein	A0A2I5ARB3	Synechococcus_phage	2.5e-56	41.0
WP_060600584.1\|2165944_2166277_+	hypothetical protein	NA	NA	NA	NA
WP_060600586.1\|2166378_2166666_+	hypothetical protein	NA	NA	NA	NA
WP_060600588.1\|2166699_2171799_+\|tail	phage tail tape measure protein	A0A0S4L7E6	Pseudomonas_phage	2.2e-29	27.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP013103

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP013104

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP013105

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP013102

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection