CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP013660	Planococcus kocurii strain ATCC 43650 plasmid unnamed, complete sequence	0 crisprs	csa3	0	0	0	0
NZ_CP013661	Planococcus kocurii strain ATCC 43650 chromosome, complete genome	1 crisprs	cas3,RT,csa3,DEDDh,DinG	0	0	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013661_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013661_1

1314337-1314451

Orphan

Consensus_repeat	Method
GGCAATCCCCTCCGGAATATTATGAATG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013661_1

>merge|NZ_CP013661|1|1314337-1314451|CRISPRCasFinder
GGCAATCCCCTCCGGAATATTATGAATGGCTACTGCAATTGCGATAGCGATTCCAAGAGCCGGATCTTGTATTGCCGACATAAACGTGGCAATCCCCTCCGGAAAATTATGAATG

>NZ_CP013661|1|1|1314337-1314451|CRISPRCasFinder
GGCAATCCCCTCCGGAATATTATGAATG	GCTACTGCAATTGCGATAGCGATTCCAAGAGCCGGATCTTGTATTGCCGACATAAACGT
GGCAATCCCCTCCGGAAAATTATGAATG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013661.2\|WP_058386447.1\|1317490_1318159_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224059
NZ_CP013661.2\|WP_058386446.1\|1316066_1317356_+\|ammonium-transporter	unknown	unknown	gnl\|CDD\|223083
NZ_CP013661.2\|WP_058386450.1\|1320425_1321187_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|226963
NZ_CP013661.2\|WP_058386444.1\|1314946_1315591_-\|uracil-DNA-glycosylase	unknown	unknown	gnl\|CDD\|381680
NZ_CP013661.2\|WP_058386433.1\|1303051_1304668_-\|long-chain-fatty-acid--CoA-ligase	unknown	unknown	gnl\|CDD\|341284
NZ_CP013661.2\|WP_058386437.1\|1308082_1308985_-\|glycine/betaine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270246
NZ_CP013661.2\|WP_058386451.1\|1321183_1322134_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	unknown	unknown	gnl\|CDD\|226964
NZ_CP013661.2\|WP_058386434.1\|1304761_1305910_-\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|173849
NZ_CP013661.2\|WP_058386442.1\|1313039_1313987_-\|DUF4003-family-protein	unknown	unknown	gnl\|CDD\|379047
NZ_CP013661.2\|WP_058386438.1\|1308996_1309635_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224095
NZ_CP013661.2\|WP_058386435.1\|1305924_1306695_-\|3-hydroxyacyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|187629
NZ_CP013661.2\|WP_058386441.1\|1311672_1312890_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340874
NZ_CP013661.2\|WP_058386436.1\|1306722_1307871_-\|thiolase-family-protein	unknown	unknown	gnl\|CDD\|238383
NZ_CP013661.2\|WP_058386449.1\|1319447_1320404_-\|siderophore-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|226966
NZ_CP013661.2\|WP_058386439.1\|1309631_1310600_-\|betaine/proline/choline-family-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224050
NZ_CP013661.2\|WP_058386445.1\|1315712_1316054_+\|P-II-family-nitrogen-regulator	unknown	unknown	gnl\|CDD\|223424
NZ_CP013661.2\|WP_058386448.1\|1318162_1319227_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223650
NZ_CP013661.2\|WP_058386453.1\|1323359_1324223_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013661.2\|WP_058386440.1\|1310687_1311533_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|225928
NZ_CP013661.2\|WP_058386452.1\|1322126_1323077_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226965

Protein	Function_ID	Function_description	E-value
NZ_CP013661.2\|WP_058386447.1\|1317490_1318159_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224059	COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms].	1.47894e-92
NZ_CP013661.2\|WP_058386446.1\|1316066_1317356_+\|ammonium-transporter	gnl\|CDD\|223083	COG0004, AmtB, Ammonia permease [Inorganic ion transport and metabolism].	9.36717e-131
NZ_CP013661.2\|WP_058386450.1\|1320425_1321187_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|226963	COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism].	1.30881e-146
NZ_CP013661.2\|WP_058386444.1\|1314946_1315591_-\|uracil-DNA-glycosylase	gnl\|CDD\|381680	cd10030, UDG-F4_TTUDGA_SPO1dp_like, Uracil DNA glycosylase family 4, includes Thermotoga maritima TTUDGA, Bacillus phage SPO1 DNA polymerase, and similar proteins. Uracil DNA glycosylase family 4 includes Thermotoga maritima TTUDGA, a robust uracil DNA glycosylase that shares narrow substrate specificity and high catalytic efficiency with family 1, acting on double-stranded and single-stranded uracil-containing DNA. Members of this family possess four conserved cysteine residues required to coordinate the [4Fe-4S] iron-sulfur cluster. This family also includes the N-terminal domain of Bacillus phage SPO1 DNA polymerase. Bacteriophage SPO1 is one of a group of large, lytic, tailed bacteriophages of Bacillus subtilis, and contains hydroxymethyluracil (hmUra) in place of thymine in their DNA. It has been speculated that this UDG domain may help discriminate between hmUra containing SPO1 DNA and thymine-containing host DNA. Uracil-DNA glycosylases (UDGs) initiate repair of uracils in DNA. Uracil in DNA can arise as a result of mis-incorporation of dUMP residues by DNA polymerase or via deamination of cytosine. Uracil in DNA mispaired with guanine is one of the major pro-mutagenic events, causing G:C->A:T mutations. Thus, UDG is an essential enzyme for maintaining the integrity of genetic information. UDGs have been classified into various families on the basis of their substrate specificity, conserved motifs, and structural similarities. Although these families demonstrate different substrate specificities, often the function of one enzyme can be complemented by the other.	7.6133e-61
NZ_CP013661.2\|WP_058386433.1\|1303051_1304668_-\|long-chain-fatty-acid--CoA-ligase	gnl\|CDD\|341284	cd12119, ttLC_FACS_AlkK_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles. This family includes fatty acyl-CoA synthetases that can activate medium-chain to long-chain fatty acids. They catalyze the ATP-dependent acylation of fatty acids in a two-step reaction. The carboxylate substrate first reacts with ATP to form an acyl-adenylate intermediate, which then reacts with CoA to produce an acyl-CoA ester. The fatty acyl-CoA synthetases are responsible for fatty acid degradation as well as physiological regulation of cellular functions via the production of fatty acyl-CoA esters. The fatty acyl-CoA synthetase from Thermus thermophiles in this family catalyzes the long-chain fatty acid, myristoyl acid, while another member in this family, the AlkK protein identified from Pseudomonas oleovorans, targets medium chain fatty acids. This family also includes uncharacterized FACS proteins.	0
NZ_CP013661.2\|WP_058386437.1\|1308082_1308985_-\|glycine/betaine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270246	cd13528, PBP2_osmoprotectants, Substrate-binding domain of osmoregulatory ABC-type transporters; the type 2 periplasmic-binding protein fold. This family represents the periplasmic substrate-binding component of ABC transport systems that are involved in uptake of osmoprotectants (also termed compatible solutes) such as betaine, choline, proline betaine, carnitine, and L-proline. To counteract the efflux of water, bacteria and archaea accumulate the compatible solutes for a sustained adjustment to high osmolarity surroundings. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	7.65398e-116
NZ_CP013661.2\|WP_058386451.1\|1321183_1322134_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	gnl\|CDD\|226964	COG4605, CeuC, ABC-type enterochelin transport system, permease component [Inorganic ion transport and metabolism].	2.63571e-127
NZ_CP013661.2\|WP_058386434.1\|1304761_1305910_-\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|173849	cd01160, LCAD, Long chain acyl-CoA dehydrogenase. LCAD is an acyl-CoA dehydrogenases (ACAD), which is found in the mitochondria of eukaryotes and in some prokaryotes. It catalyzes the alpha, beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of LCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. LCAD acts as a homodimer.	6.03902e-165
NZ_CP013661.2\|WP_058386442.1\|1313039_1313987_-\|DUF4003-family-protein	gnl\|CDD\|379047	pfam13170, DUF4003, Protein of unknown function (DUF4003). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 327 and 345 amino acids in length.	5.1972e-45
NZ_CP013661.2\|WP_058386438.1\|1308996_1309635_-\|ABC-transporter-permease	gnl\|CDD\|224095	COG1174, OpuBB, ABC-type proline/glycine betaine transport systems, permease component [Amino acid transport and metabolism].	1.10959e-79
NZ_CP013661.2\|WP_058386435.1\|1305924_1306695_-\|3-hydroxyacyl-CoA-dehydrogenase	gnl\|CDD\|187629	cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydrogenase type 10 (HSD10)-like, classical (c) SDRs. HSD10, also known as amyloid-peptide-binding alcohol dehydrogenase (ABAD), was previously identified as a L-3-hydroxyacyl-CoA dehydrogenase, HADH2. In fatty acid metabolism, HADH2 catalyzes the third step of beta-oxidation, the conversion of a hydroxyl to a keto group in the NAD-dependent oxidation of L-3-hydroxyacyl CoA. In addition to alcohol dehydrogenase and HADH2 activites, HSD10 has steroid dehydrogenase activity. Although the mechanism is unclear, HSD10 is implicated in the formation of amyloid beta-petide in the brain (which is linked to the development of Alzheimer's disease). Although HSD10 is normally concentrated in the mitochondria, in the presence of amyloid beta-peptide it translocates into the plasma membrane, where it's action may generate cytotoxic aldehydes and may lower estrogen levels through its use of 17-beta-estradiol as a substrate. HSD10 is a member of the SRD family, but differs from other SDRs by the presence of two insertions of unknown function. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	3.54655e-122
NZ_CP013661.2\|WP_058386441.1\|1311672_1312890_-\|MFS-transporter	gnl\|CDD\|340874	cd17316, MFS_SV2_like, Metazoan Synaptic vesicle glycoprotein 2 (SV2) and related small molecule transporters of the Major Facilitator Superfamily. This family is composed of metazoan synaptic vesicle glycoprotein 2 (SV2) and related small molecule transporters including those that transport inorganic phosphate (Pht), aromatic compounds (PcaK and related proteins), proline/betaine (ProP), alpha-ketoglutarate (KgtP), citrate (CitA), shikimate (ShiA), and cis,cis-muconate (MucK), among others. SV2 is a transporter-like protein that serves as the receptor for botulinum neurotoxin A (BoNT/A), one of seven neurotoxins produced by the bacterium Clostridium botulinum. BoNT/A blocks neurotransmitter release by cleaving synaptosome-associated protein of 25 kD (SNAP-25) within presynaptic nerve terminals. Also included in this family is synaptic vesicle 2 (SV2)-related protein (SVOP) and similar proteins. SVOP is a transporter-like nucleotide binding protein that localizes to neurotransmitter-containing vesicles. The SV2-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	6.59616e-72
NZ_CP013661.2\|WP_058386436.1\|1306722_1307871_-\|thiolase-family-protein	gnl\|CDD\|238383	cd00751, thiolase, Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine. They are found in prokaryotes and eukaryotes (cytosol, microbodies and mitochondria). There are 2 functional different classes: thiolase-I (3-ketoacyl-CoA thiolase) and thiolase-II (acetoacetyl-CoA thiolase). Thiolase-I can cleave longer fatty acid molecules and plays an important role in the beta-oxidative degradation of fatty acids. Thiolase-II has a high substrate specificity. Although it can cleave acetoacyl-CoA, its main function is the synthesis of acetoacyl-CoA from two molecules of acetyl-CoA, which gives it importance in several biosynthetic pathways.	0
NZ_CP013661.2\|WP_058386449.1\|1319447_1320404_-\|siderophore-ABC-transporter-substrate-binding-protein	gnl\|CDD\|226966	COG4607, CeuA, ABC-type enterochelin transport system, periplasmic component [Inorganic ion transport and metabolism].	9.55064e-137
NZ_CP013661.2\|WP_058386439.1\|1309631_1310600_-\|betaine/proline/choline-family-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224050	COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism].	1.62356e-137
NZ_CP013661.2\|WP_058386445.1\|1315712_1316054_+\|P-II-family-nitrogen-regulator	gnl\|CDD\|223424	COG0347, GlnK, Nitrogen regulatory protein PII [Amino acid transport and metabolism].	3.21647e-37
NZ_CP013661.2\|WP_058386448.1\|1318162_1319227_-\|ABC-transporter-permease	gnl\|CDD\|223650	COG0577, SalY, ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms].	7.73256e-09
NZ_CP013661.2\|WP_058386440.1\|1310687_1311533_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|225928	COG3393, COG3393, Predicted acetyltransferase [General function prediction only].	5.25658e-15
NZ_CP013661.2\|WP_058386452.1\|1322126_1323077_-\|ABC-transporter-permease	gnl\|CDD\|226965	COG4606, CeuB, ABC-type enterochelin transport system, permease component [Inorganic ion transport and metabolism].	5.65628e-146

>NZ_CP013661.2|WP_058386442.1|1313039_1313987_-|DUF4003-family-protein
MDIKRIEQTFSDVSKTTGWAVDKRIALAVTNIYLSQDQAFDAEKHEAAVEVIKKNEGWTSPLRSHLLHVAAAFMVMKEEAVESSLKLANQNQKALNDAGFWKTSYTYLAALLMKKPEEAEQARALYKEMKKHHKFLTSNEDIPYAALLGSREGSLEERAATMNRYYRDLREQGFTMGNNLQWLSQIMTFDSSVYDAKIVGKVLAIHQFFKEEKINISLAQYPILGFLAVTEIDGKALEGVVENTRELEKNKIFRWYKDMAFSTAVQQAMADNIEVRDVATMTFATSLETLMQAQQAAMMVSINAAIISSSNTSSS
>NZ_CP013661.2|WP_058386441.1|1311672_1312890_-|MFS-transporter
MATIAEKKTGPISRNRLLGIAGLGWLFDAMDVGILAFVIAALHEDWGLTSSQMGWIGSVNSIGMAVGAFVFGIYADRVGRKKIFIITLLLFSIASGISAFTTTLAAFMILRFFVGMGLGGELPVASTLVSESVPAKERGRVIVLLESFWAAGWLVAAVISYFIIPSFGWRVALLLTALPAFYALYLRINLPDSPQFSAKKDVLRSISTNIKDVWSEKYRRPTLMLWIVWFTVVFSYYGMFLWLPSVMVLKGFTLIKSFQYVLIMTLAQLPGYFSAAWLIERAGRKFVLVTYLIGTAISALAFGNADTITLLIVSGAFLSFFNLGAWGALYAYSPEQYPTVIRGTGTGMAAAFGRIGGVLGPLLVGTLLTAGANLNVIFGIFCVSILIGALAVAFLGKETKQLELE
>NZ_CP013661.2|WP_058386440.1|1310687_1311533_-|GNAT-family-N-acetyltransferase
MEMIIYSDSAVFLEKVSPLLYKNEDIHSLFLGVLGQIHANQYEDYFLALVETDDEIVAACLMTPPHALQLIVFQTFPQIEREIVGHLQNLGIEVSGIVGEQTTSRLFAEAWTERTGEQVNILMDQGLYRIEAVNKGLRKSRGSWRIASKKDAIILEEWYRLFEEEIGIGRSTQTQISHKIAGFLERKEVYVWEVDERVVSCMQKKRPSKNGITVSFVFTPNAQRRNGYAQTLVAEVTNELLLEYDFVMLYTDLTNPTSNKIYREIGYEQIANPVHLIFVEK
>NZ_CP013661.2|WP_058386439.1|1309631_1310600_-|betaine/proline/choline-family-ABC-transporter-ATP-binding-protein
MIRFENVTKRFPDGTEALKDISLVLPTNELTAIIGPSGCGKTTLMKMINKLEKPTEGSIFIDEKPINGMDEVQLRRSIGYVIQRIGLFPHMTISDNVALVPKLLDWTKDKKEQRVRELLQLVGLDPEVYMERYPLELSGGQQQRVGVVRALAGDPNIVLMDEPFSALDPISREQLQDELRNLQQTINKTIVFVTHDMDEALKIADSVILMRDGQVEQVGTPQQLIDNPANEFVRSFIGIERINQKRTFGDRKLLEFLDLFTEEWAGDTEEISAEQTIENAFLQLDKSAKNYLAIVQGAQVVAYANDRDLLKAALAKETGATA
>NZ_CP013661.2|WP_058386438.1|1308996_1309635_-|ABC-transporter-permease
MKNFLDTLVSRQDMIIGALLEHMYLSFVAVAIGIAIALPLGILITRYRRYAESIIGVTAVFQTIPSLALFGFLVPILGIGSPTALIALIIYALLPILRNTYAGIVGVDSSTIEAGRGMGMTRTQILRQIELPLALPFIMAGIRTATVLTVGIATLATFVGAGGLGDIIYRGLQSYNNSLVLAGALPVALLAIGFDQILKWIEKRATPKGLKT
>NZ_CP013661.2|WP_058386437.1|1308082_1308985_-|glycine/betaine-ABC-transporter-substrate-binding-protein
MKKTTLGVFLAATTVIAGCGSGGDELDPIVIGGKPWTEQYILPHILGQYIEANSDYTVEYEEGLGEVSILTPALEKGDIDMYVEYTGTGMKDVLKKESVPGQSSEEVLDIVRTGYEDTLGATWLEPLGFENGYTLAYSKDSGYDAKTYSDLAEISQSEEMRFGAPHPFYERKGDGYEDLIATYPFKFSATESFDPAIMYEAVKSGEVEVIPAFTTDSRIELFDLETTEDDLSFFPKYDAAPVVRMETLEEYPELEEVLSGLAGQISEEEMLAMNSRIDVDQEIAADVAREFLIDKGLIEE
>NZ_CP013661.2|WP_058386436.1|1306722_1307871_-|thiolase-family-protein
MREVVIIEGVRSAVGRRKGQFADQRPDELAALVLEELVSRAGVDKSEVEDIILGCVSQAGEQGGNIARTASLIAGFPDYVPGVTIDRQCGSSQQAVHFGAQAILAGDMDIVIAGGVESMTRVPMFSNMQGAALSEKLTDQYEIINQGLSAERIAKKWGFTRQQLDAFAVQSHERAQHAIGAGHYKREIVPIRTQGPDGETRMIDEDEGPRPGTTEEVLAGLKTAFDENGVITAGNASQMSDGASAVLLMSSDKAKELGLKPKARIVARVVVGSDPTLMLTGPIAATKKVLAKAGLEINEMDRYEVNEAFAPVPLAWLHDIGGDPEKLNVNGGAIALGHPLGATGTKLLVSLLHELERTDGRYGLLAICEGMGMANATIIEKL
>NZ_CP013661.2|WP_058386435.1|1305924_1306695_-|3-hydroxyacyl-CoA-dehydrogenase
MEFSQVKAVVTGGASGLGEATVRRIAKSGGKAAIFDLNAERAKVLIEELGEGSVIYKETDVTNASQVEQNINDTLEQFGGINLVVNCAGIGTPGKVVSKGEPIALDQFEKVIKVNLVGSFNVIRVAAAAMQKNEPTEDGERGVIISTASVAAYEGQIGQAAYSASKGGVVAMTLPIARELARDGIRVMAIAPGLMETPMVEGLPDAAIASLSAAVPFPARLGKPTEFAHLVESITTNSMLNGETIRLDGAIRMQPK
>NZ_CP013661.2|WP_058386434.1|1304761_1305910_-|acyl-CoA-dehydrogenase-family-protein
MGRYRFEEDEHVMFRKSLRKFLEKEAVPNYDQWEKDRLIPKSFWKKLGDMGFLSPQIEEQYGGLGLDFRYAVVIGEEMERVGASLTGVGLHNDITVPYIEAYGNEEQKQRWLPGCISGDHITAIAMTEPGAGSDLANISTTAVRDGDNYIVNGQKTFITNGINSTLVLVVVKTDPKAQPKHRGISLLMVEEGTPGFQKGRKLDKVGLHAQDTSELYFEDCIVPATNLIGEENKGFTYLMEKLQQERLVVAMAAQVASEDMLEMTLEYVKSRKAFGKPIGSFQNSQFKLVEMATEIELGHSFLESLIEDHMAGKDIVSKVSMAKFWLTDTAKKISGECMQLHGGYGYMEEYKIARRYRDIPVAAIYAGSNEIMKTIVAKRMGL
>NZ_CP013661.2|WP_058386433.1|1303051_1304668_-|long-chain-fatty-acid--CoA-ligase
MMDSPLLLSSFVKRAERYFPEKLIISRTGENMIHRIPYKEFAVRSRKLAAALTGLGMKRGTKVGSFAWNHHRHLELYFGVPGAGAILHMINIRLSHEHIAYVINHAEDEILVVDHDLFPLIEKLAPMLKSVKHFIIMKDGVDLPETTLGNVYSYEQLLAAEDDSFEFPEDLDENTPAGMCYTSATTGNPKGVVYTHRGLVLHSYALGMSDAMGLSEQDIALSIVPMFHANAWGLPFAGVLFGTTQVLPGPGFAPGMLLDLIESEKVTLTAGVPTIWMGVLKELEANPRNIDTLRMIICGGSASPKGLIRAFEEKYNVPFVTGYGMTETAPLVSLAITTSAMTDMTMDERIERRSMAGLPMPGLEVRIVNENGEAPWDGETMGELNVKGAWIADEYYKDERTEEAFKEGWLYTGDIAVIEPDGYIKLMDRTKDLIKSGGEWISSVDLENALMTHEAVFEAAVVAIPHEKWMERPLACVVLKEGHAEDDATKAELLTYLESQFAKWWVPDDVVFLKEVPKTSVGKFLKAALRKELDGYYQ
>NZ_CP013661.2|WP_058386444.1|1314946_1315591_-|uracil-DNA-glycosylase
MYRISEKLAELGMQRIEGFPVEGFVWGSGPGNPVIMLVGEAPGENELETGIPFTGRAGKELMASLESVGLAREDVYITSAVRSRPYKWGTKKKRNGETIARKYNRAPTKKEIIAHAPILDTEIQAVQPPIIVTLGNVGLQRLVGSKAKVTELHGVLMETPILYWNEEESCFKETTEVYHIFPTFHPASVFYNPSVRMLKDADWQKLKELLGGAK
>NZ_CP013661.2|WP_058386445.1|1315712_1316054_+|P-II-family-nitrogen-regulator
MKKIETIIRPSVFADVRQALALEGIDGLSVTEIAGIGKQEGRVGLFRGNTYTMEFSPKLKLEMVVADDKVEDIIQALLAYASTGQVGDGKIFIFSVEEAIRIRTKERGTVAIG
>NZ_CP013661.2|WP_058386446.1|1316066_1317356_+|ammonium-transporter
MEAVQSSVDMIWVMLGAMLVFFMHAGFAMVESGFTRSKNTLNILMKNMITVSLGSILYFIVGYALMFGPSSFGLIGTQGFALTGVEDIGFFVFQAVFAATCATIISGAVAERMNLSAYILLTIAMTAVIYPVVGHWVWGGGWLSQIGFIDFAGSTVVHLTGAVAAFIAAWKIGPRIGKYSGKSVNTIPGHSLPLGALGVFILWLGWFGFNGGSTLAADPTLVPPVIANTLLAASAGIIATAGYTRFRYGRIDASLTMNGALAGLVGITAGAANVSFFGAMMIGLLAGVIMTEAIRLLDSKIRVDDPVGAISVHGIAGIWGTLAVGLFDTTNGLFYGGGTEILGLQAVGVLAVIAWASLSTGIVLFAIGRIVPLRVTAEDEEAGLDFSEHGSQAYSMQDVLHGSPVGHNDSFAQRLNQLGEAPSPQKTIS
>NZ_CP013661.2|WP_058386447.1|1317490_1318159_-|ABC-transporter-ATP-binding-protein
MAVLELNRVKKSFGTGHKKVDALKETNFQAEQGELIAVIGPSGSGKSTFLTIAGGLLSPTGGDILINDTNISSLNEKQLSKIRLKEIGFILQASNLVPFLTVEKQLKLLDKVKKDNMNKEQLEQLYKDLGIGDLRSKYPSDLSGGERQRVAIAKALYSNPSIILADEPTASLDSDRAYEVMELLKAETKNKKTTTIVVTHDIRLVDYCDKVYKMVDGVLELQ
>NZ_CP013661.2|WP_058386448.1|1318162_1319227_-|ABC-transporter-permease
MFLAWNEIIKNKLRFTLIIGVLMLVAYLVFFLSGLANGLASLNREAVDKWDADAIVLTEESDQSLTQSSLSIDAVDEIQADETAVLGQLNAIAQTGDLKAGVSIFGINSDEFIMPEVIEGEEFTDANEVIAGDALKDEGFKLGDTLSLSSTKETLKIVGFTDQARFNAAPVLYTTLETLQLVKFGETAENDSQISAIVVRTEDISATTDENGLATIETETFIESLPGYTEQSLTLNFMIYFLFVISSVIVAIFLYVLTVQKISMFGVMKAQGIPSGYLARSVIAQTAILAAIGVAVGLGLTLFTGAFLPSAVPVAFDIPTMLIYGVVLIAVAILGAVFSVLTIVKIDPLKAIGG
>NZ_CP013661.2|WP_058386449.1|1319447_1320404_-|siderophore-ABC-transporter-substrate-binding-protein
MKKWIVAAVTLMMVAFLAACGSTEKTTESDTATAESEEMTVTHELGETTFNKNPEKVVVFDFGVLDSMDKLGIEAVAGVPQANIPAYLEKYEDAEKYENVGTLKEADFEAINAMKPDLIIISGRQADMYDEFSEIAPTIHMAVDTEDYMGSFKENMTTLGEIFGKEDQITEELAAIDTKIEEVKETVSGSAEKALIILANEGKVSAYGAASRFGLIHDVFGVKQADEGIEASTHGQSISYEYILETNPDMMFVVDRNAVVGNGTNAADSLENELVQKTNAYQNDKIIYLDPDFWYLSGGGLQSVTQMVADVQSAFEQN
>NZ_CP013661.2|WP_058386450.1|1320425_1321187_-|ATP-binding-cassette-domain-containing-protein
MIQVRELTKLYGKKTVVENVTVDIQRGQITSFIGPNGAGKSTLLSMVSRLLDADTGEVLIDSTNTKKLKSNDFSKRVSILKQSNFMNVRLTIRELVSFGRFPYSKGRLNDEDEKMVDQSIDYMDLKEMENSYLDELSGGQRQRAFIAMVIAQDTDYVLLDEPLNNLDMKHSVQIMKILRRLVDDLGKTVVIVLHDINFASVYSDRIVALKNGRVVKDGTTEEIIQSAALKEIYDMDIPIQQMNDCRICVYFNS
>NZ_CP013661.2|WP_058386451.1|1321183_1322134_-|iron-chelate-uptake-ABC-transporter-family-permease-subunit
MRDLHKMLILVGLALAACSLYLFQDLNGSFDYALPRRGVKVFAMVLTGVAIAYATVVFQTITHNRILTPSIMGLDSLYMLLQTVLIFFLGSDHVTIVNKQVNFLLSIAVMVIFALLFYRLLFKKNDRPIYFLLLVGIICGTFFSSITTFLQVLIDPNEFSIIQDRMFASFNNVNSDLVWTSLVIITLLIAFAWKQNSSLDVLTLGRDTAINLGVNYDALVKQMLVLSAVLIAVATALVGPITFFGLIVANLSYQFFTSYKHSVLLTGSIVISVVALVSGQWVVERIFTFNTTLSVIINFIGGIYFIYLLLKESRSK
>NZ_CP013661.2|WP_058386452.1|1322126_1323077_-|ABC-transporter-permease
MKKRYLIPTLIILSIISLFVGVSSISVADLLDFQSEETQIFLISRLPRLVAILLAGAGMSMAGLIMQQLSRNKFVSPTTAGTLDATRLGILVSMLLFANATMLEKMTVAFAFALAGTFLFMQILNRIKFKDAIFIPLVGLMFGNILSSITTFFAYRADVIQNMSAWLQGDFSMVMKGSYELLYISVPVFIIAYLYANRFTVAGMGEDFSKNLGMKYRSVVNIGLTLVALITATVVLTVGVIPFLGLIIPNIVSIFKGDHLQKTLPHTAMLGAIFLLVCDILGRVLIYPYEISISLMVGVIGSFIFLFLLFRRKTYA
>NZ_CP013661.2|WP_058386453.1|1323359_1324223_-|hypothetical-protein
MKKWILFMTTATLAIGLSACSETAEPASGDETTKGEDSKLTVQEVYEKSVEASEDITSVHADIVTDQTIAMQGDGMEMDMTVSSSMDMTIDPVAFYQKAETSVVSEDIDNSNPMSMEMYFTEQGMYMYEETMATWLKMPDASIEDLKALADQQTVNPSQQLEELAEFKDDFTFKQTEGEYILTLDASGEKFNELMNQQLEKTLGQMELEAQMALEDMTIHAVNYVIYVDKESFLTTGMDMKMDMDMNIEDEMMNIKSDMQADYSRFNEIQSITVPAEVVEQAQEIAG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

537417 : 543013

Staphylococcus_phage(83.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058385819.1\|537417_538614_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	2.9e-161	75.9
WP_058385820.1\|539312_540902_+	phosphoenolpyruvate carboxykinase (ATP)	A0A2H4PQN1	Staphylococcus_phage	8.4e-185	61.8
WP_058385821.1\|540944_541724_-	S9 family peptidase	A0A2H4PQM6	Staphylococcus_phage	2.7e-35	37.2
WP_058385822.1\|541704_542163_-	nucleoside triphosphatase YtkD	A0A2H4PQM4	Staphylococcus_phage	1.9e-20	39.3
WP_058385823.1\|542229_542676_-	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	2.8e-45	61.6
WP_058385824.1\|542782_543013_+	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	1.9e-21	66.7

DBSCAN-SWA_2

820267 : 830037

Prochlorococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058386054.1\|820267_821803_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	2.8e-76	50.7
WP_058386055.1\|821835_822408_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.1e-22	33.5
WP_058386056.1\|822397_823459_-	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	1.2e-62	41.7
WP_058386057.1\|823471_824893_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.4e-53	33.7
WP_058386058.1\|824868_827094_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	4.4e-163	41.7
WP_049695147.1\|827077_827761_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_058386059.1\|827757_828012_-	phosphoribosylformylglycinamidine synthase subunit PurS	M4QPE7	Synechococcus_phage	6.1e-05	34.1
WP_058386060.1\|828008_828725_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A1D7SCX8	Cyanophage	2.6e-45	42.4
WP_058386061.1\|828741_830037_-	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	1.6e-16	31.5

DBSCAN-SWA_3

2227386 : 2235823

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058384255.1\|2227386_2228016_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.9e-39	45.8
WP_082707537.1\|2228033_2228654_+	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	6.2e-59	56.6
WP_058384256.1\|2228677_2229142_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	2.2e-45	58.6
WP_058384257.1\|2229299_2229830_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_058384258.1\|2229875_2230496_-	flavodoxin family protein	NA	NA	NA	NA
WP_058384259.1\|2230759_2232580_+	LTA synthase family protein	W6LM83	Streptococcus_phage	1.8e-29	28.0
WP_082707538.1\|2232641_2233655_+	50S ribosome-binding GTPase	NA	NA	NA	NA
WP_058384260.1\|2233758_2234439_+	response regulator transcription factor	W8CYM9	Bacillus_phage	6.0e-39	39.9
WP_082707584.1\|2234467_2235823_+	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	4.1e-23	32.2

DBSCAN-SWA_4

3221619 : 3258771

Staphylococcus_phage(33.33%)

transposase,protease,integrase

attL 3214675:3214689|attR 3259102:3259116

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3214675:3214689	attL	NA	NA	NA	NA
WP_058385112.1\|3221619_3222516_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_058385113.1\|3222713_3223040_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_058385114.1\|3223149_3223494_-	hypothetical protein	NA	NA	NA	NA
WP_058385115.1\|3224739_3225057_-	hypothetical protein	NA	NA	NA	NA
WP_058385116.1\|3225072_3225636_-	DUF2812 domain-containing protein	NA	NA	NA	NA
WP_058385117.1\|3225635_3225959_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_058385118.1\|3226805_3227438_+	DUF2599 domain-containing protein	NA	NA	NA	NA
WP_058385119.1\|3228421_3228988_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_058385120.1\|3228974_3229715_+	hypothetical protein	NA	NA	NA	NA
WP_058385121.1\|3230049_3230802_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_058386882.1\|3230835_3231504_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_082707560.1\|3231798_3232749_-	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_058385123.1\|3232717_3233365_-	hypothetical protein	NA	NA	NA	NA
WP_058386883.1\|3233710_3234223_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_058385124.1\|3234431_3234986_+	NUDIX hydrolase	NA	NA	NA	NA
WP_058385125.1\|3234995_3235457_+	NUDIX domain-containing protein	A0A0K1LQN4	Klebsiella_phage	9.7e-09	46.2
WP_058385126.1\|3235607_3236192_-	hypothetical protein	NA	NA	NA	NA
WP_058385128.1\|3237366_3238566_-	hypothetical protein	NA	NA	NA	NA
WP_058385129.1\|3239095_3239977_+	helix-turn-helix transcriptional regulator	D0R0F8	Streptococcus_phage	1.1e-08	34.3
WP_058385130.1\|3240383_3241151_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_058385131.1\|3241147_3242038_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.4e-27	35.3
WP_058385132.1\|3242015_3242264_-	PLDc N-terminal domain-containing protein	NA	NA	NA	NA
WP_058385133.1\|3242466_3242985_+	hypothetical protein	NA	NA	NA	NA
WP_058386885.1\|3243257_3243587_+	PadR family transcriptional regulator	NA	NA	NA	NA
WP_058385134.1\|3243588_3244359_+	DUF1129 family protein	NA	NA	NA	NA
WP_058385135.1\|3244655_3244973_+	hypothetical protein	NA	NA	NA	NA
WP_058385136.1\|3244978_3245182_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_058385137.1\|3245178_3245601_+	hypothetical protein	NA	NA	NA	NA
WP_058385138.1\|3245879_3247229_+\|transposase	transposase	NA	NA	NA	NA
WP_058385139.1\|3248986_3249856_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_058385140.1\|3249839_3250307_-	hypothetical protein	NA	NA	NA	NA
WP_058385141.1\|3250270_3251515_-	poly-beta-1,6 N-acetyl-D-glucosamine synthase	A8CG95	Salmonella_phage	4.2e-06	35.9
WP_058385142.1\|3251674_3252712_+	family 20 glycosylhydrolase	A0A076G5S5	Staphylococcus_phage	2.5e-92	50.5
WP_058385143.1\|3252903_3253710_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_058385144.1\|3254878_3256006_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_156423951.1\|3255968_3256448_-\|transposase	transposase family protein	NA	NA	NA	NA
WP_058386886.1\|3256594_3257320_-	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	2.3e-36	40.7
WP_058385145.1\|3257319_3258771_-\|transposase	IS21 family transposase	NA	NA	NA	NA
3259102:3259116	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage