CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP012122	Lactiplantibacillus plantarum strain LZ95 chromosome, complete genome	2 crisprs	csa3,DinG,cas3,DEDDh	5
NZ_CP012124	Lactiplantibacillus plantarum strain LZ95 plasmid LZ95p2, complete sequence	0 crisprs	NA	0
NZ_CP012123	Lactiplantibacillus plantarum strain LZ95 plasmid LZ95p1, complete sequence	0 crisprs	NA	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP012122_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012122_1

665779-665864

Orphan

Consensus_repeat	Method
AATAAGATACTTTAAGTTTCTTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP012122_1

>merge|NZ_CP012122|1|665779-665864|CRISPRCasFinder
AATAAGATACTTTAAGTTTCTTATTGACTTTTTCTTTATATAGCGTATTATACCAGTTATGCGAATAAGACACTTTAAGTTTCTTA

>NZ_CP012122|1|1|665779-665864|CRISPRCasFinder
AATAAGATACTTTAAGTTTCTTA	TTGACTTTTTCTTTATATAGCGTATTATACCAGTTATGCG
AATAAGACACTTTAAGTTTCTTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012122.1\|WP_003643398.1\|665161_665761_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP012122.1\|WP_003642351.1\|662085_663084_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP012122.1\|WP_058906772.1\|661093_662089_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP012122.1\|WP_003642357.1\|656804_657641_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|212492
NZ_CP012122.1\|WP_003643401.1\|660336_660849_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274100
NZ_CP012122.1\|WP_003642350.1\|663080_663875_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP012122.1\|WP_003642355.1\|658422_659169_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP012122.1\|WP_011102040.1\|671928_672495_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP012122.1\|WP_003642344.1\|670764_671802_-\|aldehyde-reductase	unknown	unknown	gnl\|CDD\|187538
NZ_CP012122.1\|WP_058906774.1\|672653_673382_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP012122.1\|WP_013355933.1\|665878_667357_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP012122.1\|WP_050577158.1\|664159_665041_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238558
NZ_CP012122.1\|WP_013355931.1\|668173_668365_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012122.1\|WP_058906773.1\|670049_670616_+\|DUF1211-domain-containing-protein	unknown	unknown	gnl\|CDD\|226078
NZ_CP012122.1\|WP_011102039.1\|673514_673880_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP012122.1\|WP_003642340.1\|674163_674448_-\|DUF1905-domain-containing-protein	unknown	unknown	gnl\|CDD\|378097
NZ_CP012122.1\|WP_003642346.1\|668876_669830_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381318
NZ_CP012122.1\|WP_003643403.1\|657899_658406_+\|acetyltransferase	unknown	unknown	gnl\|CDD\|100047
NZ_CP012122.1\|WP_013355932.1\|667687_667927_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012122.1\|WP_013355936.1\|659462_660356_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187572

Protein	Function_ID	Function_description	E-value
NZ_CP012122.1\|WP_003643398.1\|665161_665761_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.95133e-09
NZ_CP012122.1\|WP_003642351.1\|662085_663084_-\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	6.03952e-81
NZ_CP012122.1\|WP_058906772.1\|661093_662089_-\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	1.0645e-78
NZ_CP012122.1\|WP_003642357.1\|656804_657641_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|212492	cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs. Classical SDR subgroup containing retinol-DHs, LPORs, and related proteins. Retinol is processed by a medium chain alcohol dehydrogenase followed by retinol-DHs. Pchlide reductases act in chlorophyll biosynthesis. There are distinct enzymes that catalyze Pchlide reduction in light or dark conditions. Light-dependent reduction is via an NADP-dependent SDR, LPOR. Proteins in this subfamily share the glycine-rich NAD-binding motif of the classical SDRs, have a partial match to the canonical active site tetrad, but lack the typical active site Ser. This subgroup includes the human proteins: retinol dehydrogenase -12, -13 ,and -14, dehydrogenase/reductase SDR family member (DHRS)-12 , -13 and -X (a DHRS on chromosome X), and WWOX (WW domain-containing oxidoreductase), as well as a Neurospora crassa SDR encoded by the blue light inducible bli-4 gene. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	4.07613e-56
NZ_CP012122.1\|WP_003643401.1\|660336_660849_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|274100	TIGR02366, conserved_hypothetical_protein, probable dihydroxyacetone kinase regulator. The seed alignment for this family was built from a set of closely related uncharacterized proteins associated with operons for the type of bacterial dihydroxyacetone kinase that transfers PEP-derived phosphate from a phosphoprotein, as in phosphotransferase system transport, rather than from ATP. Members have a TetR transcriptional regulator domain (pfam00440) at the N-terminus and sequence homology throughout.	3.33884e-08
NZ_CP012122.1\|WP_003642350.1\|663080_663875_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	5.60764e-114
NZ_CP012122.1\|WP_003642355.1\|658422_659169_+\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	2.40011e-91
NZ_CP012122.1\|WP_011102040.1\|671928_672495_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	7.31502e-05
NZ_CP012122.1\|WP_003642340.1\|674163_674448_-\|DUF1905-domain-containing-protein	gnl\|CDD\|378097	pfam08922, DUF1905, Domain of unknown function (DUF1905). This domain is found in a set of hypothetical bacterial proteins.	1.07383e-22
NZ_CP012122.1\|WP_013355933.1\|665878_667357_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.13969e-71
NZ_CP012122.1\|WP_050577158.1\|664159_665041_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238558	cd01138, FeuA, Periplasmic binding protein FeuA. These proteins have predicted to function as initial receptors in ABC transport of metal ions in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	3.71721e-55
NZ_CP012122.1\|WP_058906774.1\|672653_673382_-\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	1.46761e-88
NZ_CP012122.1\|WP_003642344.1\|670764_671802_-\|aldehyde-reductase	gnl\|CDD\|187538	cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs. This subgroup contains aldehyde reductase of the extended SDR-type and related proteins. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.62333e-95
NZ_CP012122.1\|WP_011102039.1\|673514_673880_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.16334e-31
NZ_CP012122.1\|WP_003642346.1\|668876_669830_+\|aldo/keto-reductase	gnl\|CDD\|381318	cd19092, AKR_BsYcsN_EcYdhF-like, Bacillus subtilis YcsN, Escherichia coli YdhF and similar proteins. Bacillus subtilis YcsN and Escherichia coli YdhF are prototypes of this family. They are uncharacterized aldo/keto reductase family oxidoreductases.	5.65843e-131
NZ_CP012122.1\|WP_003643403.1\|657899_658406_+\|acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	1.58107e-53
NZ_CP012122.1\|WP_058906773.1\|670049_670616_+\|DUF1211-domain-containing-protein	gnl\|CDD\|226078	COG3548, COG3548, Predicted integral membrane protein [Function unknown].	3.2862e-28
NZ_CP012122.1\|WP_013355936.1\|659462_660356_+\|SDR-family-oxidoreductase	gnl\|CDD\|187572	cd05262, SDR_a7, atypical (a) SDRs, subgroup 7. This subgroup contains atypical SDRs of unknown function. Members of this subgroup have a glycine-rich NAD(P)-binding motif consensus that matches the extended SDRs, TGXXGXXG, but lacks the characteristic active site residues of the SDRs. This subgroup has basic residues (HXXXR) in place of the active site motif YXXXK, these may have a catalytic role. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	3.70513e-130

>NZ_CP012122.1|WP_003643398.1|665161_665761_-|TetR/AcrR-family-transcriptional-regulator
MTKTRRRGAELENAIYQAARDILNQDGLEQLTFANVAEQAGTSKPVIYRRWRSPLELAIAAIQDQIITENHGQLDEVSLTGQTLSEDLFQVLKRFTVSINTFNQALVITWFHHLDQQANPEVKDLLNAVKKIDAHAIERVCQRAQQRGELRTGTLSCDLQLMPFDWLRYRAFANEPITDATLHLLVDDLLVPAYQHALG
>NZ_CP012122.1|WP_050577158.1|664159_665041_+|ABC-transporter-substrate-binding-protein
MGSLLLGACGAKQPTSTTVTRTDYLKHKVKVPKHPKRIVASYLEDDLVALGIKPVVQWSVKNGSGTQAYLKEQLKGVPLIDYSLPYEAVTKAKPDLILMGTSSAVANGKYAQYNKIVPTYVVKNGTTVTWRQTFLDVAKVVNRQAKAKKVLAKYDKQVQTTRQALKKSGQHKVAVLWVTNNTAYMVNDNSASGALLYQDLQLGEPSLVKQVSKSATADWSAVSLEKLAKLDADDIFLVNSQKSASLFKDPLWKNIKAVKNNHLYQYGDSSSWQYSGPIAYSQMIDMVKTDLLK
>NZ_CP012122.1|WP_003642350.1|663080_663875_-|ABC-transporter-ATP-binding-protein
MNTIEAQNISIGYGDKVIVDQLSITIPHGQITTLIGPNGSGKSTLIRAIAHLLPPTTGVILLDHQNIQQIKSKTFAKKIAVLPQTNQTANDLTVEELVSFGRLPYRRPLSGLTTTDHQKIEWALTQASLQDLRQRPLSTLSGGQRQRAWIAMAVAQDTDTIILDEPTTYLDLTHQLEVMQLVKKLNEQAHRTIIMALHDLNHAARISDQLIALKDGHVLAHGPVSTVMTAANLKTIFNIDATLVDYHGTPLILTYNGCQEVAPA
>NZ_CP012122.1|WP_003642351.1|662085_663084_-|iron-ABC-transporter-permease
MKSTSRYWGWLALSTGVLILVMGLSLRFGADQMRTATVWHALTTTHTGNLDQQIIRHIRVPRVLGAALIGAALAGSGALMQAVTRNPLADSGLLGINAGAGLMLTLCLAFFPKLSTLQTTGWAIIGAAASAGLIFSISTARHVQLDPTILVLAGIAISSLLTALSEGLALVLQLKQDLAFWYFGGLGAVSWTQLKFLGPGLVLGLLLTLLLAPQLNLAYLTDDNAQSLGKSLPLLRGLALICAVILSGISVALVGTITFVGLMIPHMARWLAGANYRNSMPLTLILGATLTVGADLIARLVNPPHETPFGIIISLIGVPCFIYLARKEPMKA
>NZ_CP012122.1|WP_058906772.1|661093_662089_-|iron-ABC-transporter-permease
MSPNRRLIIWSLLLTASMLGLAILNLSTGTMTISWPALLGILTGRGNATDMLVLVNFRLPRIVLAIMVGWALALSGNVLQTVTNNPMADPSLLGINNGAGLAVMLLIIGAGTNASLTLSLPIVALAGAWLSTALIFLLANQRQRGISSKRLLLVGVALSGCFSALMVLMTLKLSPDNYQFVMNWLAGSLWGTDWSYIGWALPWLAVGSGILFIQLPVLDAFTLGTTTAQTLGINLKRQQLGVISVAAMLAGVSVAISGGISFIGLITPNLARRIVGSRQRYQLPLAGLLGSTLLLAADTLGKLITTTTELPAGVLVALIGAPYFIYLLVRG
>NZ_CP012122.1|WP_003643401.1|660336_660849_-|TetR/AcrR-family-transcriptional-regulator
MANQRNQRMQATILLAYENLLSDKPFRKITVQDISDAALVHRSTFYKHFQDQYDLLEALFEQKRQQSKLTIDQIFTHPFETLNSFGNARFQETLRHQFNDDAFRDAFLNYLIHLCKDTVDDDQRLVRFLAVGRIKGLTLWITVGNAPYNIFTDTATLDNIFSNPLNTVNY
>NZ_CP012122.1|WP_013355936.1|659462_660356_+|SDR-family-oxidoreductase
MKVFITGGTGFVGSAVVQELVANGFEVVGLARSETSAQKLISWGAQPVRGSLTSLSTLATAAAQADAIIHLGFNNDFRHFFQAGAMDRRAIETMGRAISGTNKPLVVTYGTTGIRKHVETEHEVADTGLLKWLTPRKSEIVARQLMAQNINAFVVRLSPAVHGAGDMGFTRTVIERAKKSHRAEYFGLGTHAWSAVHRLDAAHLFYLVTMYGLEHPTTNERVFNAVAEESITTAAIARTISRKLNVPLKAKYNPLSFGDTAMLYLINCPTSSQLTRQILGWVPVQPDLLTDISSSRY
>NZ_CP012122.1|WP_003642355.1|658422_659169_+|SDR-family-oxidoreductase
MSIKGKVVVITGASSGIGAATAKLLAAKGAKVVLGARREERLQALSQAIGDNAVYQVTDVTDRQQVRALIDLAVSKFGRVDVLYNNAGTMPQGNLSDREYDKWQMMLNVNIMGVLNGIGEVLPIMQKQHDGLIIATDSVAGHVVYPASAVYNGTKYAVRAIMEGLRQEEKEHGIRSTIVSPGAVRTELVNTIGNTQIQAGISELMNADDRQGLALNPEDIANAVLFAIDQPKHVAISEVLVRPAQQEV
>NZ_CP012122.1|WP_003643403.1|657899_658406_+|acetyltransferase
MQTIQPIVDANQRRIQALNVTREPSEIRERLAEITGQTIDISVEIRVPLWTDYGRNLKIGKRVFINDNVQITDLGGIELADDVLIGPGAMLLSVNHPLDPAKRHAVEVQPIHIERNAWIGAGAKVLAGVTVGENAVVGAGAVVTKSVPANTVVAGVPAKVIKTIEQVD
>NZ_CP012122.1|WP_003642357.1|656804_657641_-|SDR-family-NAD(P)-dependent-oxidoreductase
MQSKLAVIIGGTSGVGKHTAIDLANQNYHVIIVGSRADKGRQAQADISQATGNQAVQLALADLSTKTGVQQFAHQLAAMTDHIDILLNSIGVMLPERHLSADGYDLNLVLNYLTHFWTIQALLPLLKHSDQARILLVGALPFVINHAKVSLPDFDAPATSKYNAMTVTAQATAARVLLTLALSERLTATNVTINIFHPGYVPDSNFGAGGSWVSRLAGRILGESFSRKNSPIGAWLATAPELTHTSGHFYDDRLRQVRLSKQYTRSKANDLWRLSSQY
>NZ_CP012122.1|WP_013355933.1|665878_667357_+|DHA2-family-efflux-MFS-transporter-permease-subunit
MQAKAKISKATMTIAWVVVFGAMAPLLDSTMINIAINNLVTSFHSSVTTVQWAVTGYLLATGVAVPFSSWLLNRFDGKAVFVAGEILFGLGSIFAAVVPNIQLLIIARLVQGFAGGLIMPLLTTLLVQTAGAAVMGQMMATVGLPMILGPLIGPVIGGIIIKFASWHWIFWINVPVVLISIALILWKMPNYPAQNRTAKMDFIGILLLIVSSSAIIYSLVNAAHTDRFNNATSIEMLILGAIALISYVVWAAWQKERAVVPLHLFKFASFDGAGLGLFIAGTVLNGAMLLLPLYFQNVRGMSVINAALALLPQGAGMLVSRTLTGRLTDQIGAKYVVLGSVVITFVGTLPFYWFGQQTSYWILALILFVRGIGAGGILMPLMADAYTGMQPGQVPAATIGTRIIQNIGSAFGSALITTIVTAYSTHQVNVFERHLKAGTYHVDAAHLQVFTTSHLQAIRLAAFQQGFLVIAIAAIVIILPTLLLTNKLKAAK
>NZ_CP012122.1|WP_013355932.1|667687_667927_+|hypothetical-protein
MKKVYLRYQKQVDSFININKIMLLLEFVLLFVVKGSIDHYNQLPYDWFAYLTTLIHYFLGTFAFFGIILVIECVWNKFK
>NZ_CP012122.1|WP_013355931.1|668173_668365_-|hypothetical-protein
MAAFSEKQLKKAPITDQEFEKVVAVAKPDVQGIHSVCQQLVISFIAEERFLAVFGDGTCHPSN
>NZ_CP012122.1|WP_003642346.1|668876_669830_+|aldo/keto-reductase
MKTIQIGASQLKASAVALGIMRMVRLDTDAAANVLETVHDRGVNFIDSADIYGNGDSERIFGQALKQSSLKREDFFIQSKGGIVLDPEKSSGELVFGQRYDFSKQHLIATVDKILQRMQLDYLDSFLLHRPDPLMDPAEVAAAFDELQATGKVRHFGVSNFNPMQVEMLQAAVSQKLMINQLQFGVMHTGPIQFGLHTNMQDTASLNHDGEIIEYSRLHHMTIQAWSPYQYGMFAGTFIDNPKFPELNAKLQELADQYHVTKNAIATAWILRHPANMQVILGSMNPQHLDESIAGTDVTLTRQEWYDVYFAAGNDLP
>NZ_CP012122.1|WP_058906773.1|670049_670616_+|DUF1211-domain-containing-protein
MNKARLDAFTDAIIAIVLTLLVLDLPRPQTPSVRALFAEWQSIYVYIITFTLLISIWLNHHDLFVQVKKIDRVVFWANSFWLLCQSFIPFMASWITKFPHSKWPAVFYILTGFVWMLAYQLLVAAVRRLNPHIHRMSSPALSVVFGGFLVVLTVALINPDVGLFLIPVHAFASVILATKRKWHLRKYF
>NZ_CP012122.1|WP_003642344.1|670764_671802_-|aldehyde-reductase
MQKQLVVVTGGSGFIAIHIIRQLLQQGYAVRTTVRSLAKAPVIKEMLTNGGITDLSALEIVVADLAHDEHWSEAMAGATYAIDVASPTPKLNFKNKAEMIRPAVDGVRRVLTASRDAGVKRVVLTSAYGAIFAGHKNRTTPYTEADWSDLNWKAIHPYQESKTRAELAAWDFINHEGRGLELTTVNPVAVMGPVLSAKYSHSNIQIQQFLEGQVKAVPNVDSGYVDVRDVASLHLLAMTAPQANGERFLATTGETLSMLDVANVLRQAFPAFASQLPTKTIPNAAVKLAAKARPELRMVASLVGTYAETSNHKAQTLLDWHPRPAAESIIATAQSMIDLGIVTKP
>NZ_CP012122.1|WP_011102040.1|671928_672495_+|TetR/AcrR-family-transcriptional-regulator
MAATNHAQAIKKDSQTYLTTALLQLLRTHDLDTITVTQVVKRAGVSRMAFYRNFTTLEDLLTAYFAPAIAARFQDVLQHVPANRKLLAMGQFFSDFAPTLRLAEQRGFENIIQQLFNANMTNYYQATMTNGMLTAVQLKYWTRFMSAGVYAIWREWLLGGQLESLTTIHEILATLQTATMQALTQAQK
>NZ_CP012122.1|WP_058906774.1|672653_673382_-|SDR-family-oxidoreductase
MKPLVVITGASSGFGAEIAKLFAADNYPLLLLGRRQAKLAALSANFENAMIDTVDVTNYHQFETAVRKAEAKYGKTDLLVNNAGLMLLGNVQNQDPQEWQTMLNTNVMGVLNGTQIVLNDMRDREHGTILNMSSLAGKKTFVNHAAYVAYKFGVHGLSETLREENAPKNVRVMLVAPGAAETELLTHVTSKSALSDYEAWKASMGGLTLDPKHVAATVKFMYDMPQNVNIREVDIAATAQDA
>NZ_CP012122.1|WP_011102039.1|673514_673880_+|helix-turn-helix-transcriptional-regulator
MLKERVTAQPRYRNEFDATMQLIRGKWKIMILFELAEVKVSRFADLQHHIQAVSHKTLASQLKELEQDELIERHDFKTAQPHVEYRLTAKGQSLIPILDAICTWGDQHVDPALIERSLCDE
>NZ_CP012122.1|WP_003642340.1|674163_674448_-|DUF1905-domain-containing-protein
MKTYQFDAPIQAATIGKGGAYVACPFDIRDLFGKGRVKVHATFDEVPYNGSIVNMGVKNLDGSICYILGIRKDIRAKLHKSIGDVVAVTVTAID

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP012122_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012122_2

898456-898653

Orphan

Consensus_repeat	Method
GGCCGACGTTGCACTCTGGCTCGTCGTGCTAGTGACTGAACTAGCACT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP012122_2

>merge|NZ_CP012122|2|898456-898653|CRISPRCasFinder
GGTTACCGTTGTACTTTGACTAGCCGCACTTTTTACTGAACTAGCACTGGCTTGACTAGTACTGCTTTGGCTAGCGGCCGACGTTGCACTCTGGCTCGTCGTGCTAGTGACTGAACTAGCACTGGCTTGACTAGTACTACTTTGGCTAGTGGCCGACGTTGCACTCTGGCTCGTCGTACTAGTGACTGAACTAGCACT

>NZ_CP012122|2|2|898456-898653|CRISPRCasFinder
GGTTACCGTTGTACTTTGACTAGCCGCACTTTTTACTGAACTAGCACT	GGCTTGACTAGTACTGCTTTGGCTAGCGGCCGACGTTGCACTCTGGCTCGTCGTGCTAGTGACTGAACTAGCACTGGCTTGACTAGTACTACTTTGGCTAGT
GGCCGACGTTGCACTCTGGCTCGTCGTACTAGTGACTGAACTAGCACT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012122.1\|WP_003642133.1\|888007_890599_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223650
NZ_CP012122.1\|WP_003644756.1\|897419_897920_-\|methylated-DNA--[protein]-cysteine-S-methyltransferase	unknown	unknown	gnl\|CDD\|223427
NZ_CP012122.1\|WP_003642122.1\|899633_900578_-\|LysM-peptidoglycan-binding-domain-containing-protein	unknown	unknown	unknown
NZ_CP012122.1\|WP_015825853.1\|906058_906622_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379112
NZ_CP012122.1\|WP_003644757.1\|894387_895605_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224582
NZ_CP012122.1\|WP_003642134.1\|887312_888014_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224059
NZ_CP012122.1\|WP_013355869.1\|909656_910844_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
NZ_CP012122.1\|WP_003644815.1\|906680_907181_-\|DUF4811-domain-containing-protein	unknown	unknown	gnl\|CDD\|374344
NZ_CP012122.1\|WP_003642132.1\|890679_891942_+\|ArgE/DapE-family-deacylase	unknown	unknown	gnl\|CDD\|181490
NZ_CP012122.1\|WP_011101931.1\|907177_908662_-\|multidrug-efflux-MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP012122.1\|WP_003644818.1\|900886_902431_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340855
NZ_CP012122.1\|WP_003642119.1\|904020_904848_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP012122.1\|WP_003642126.1\|895597_896497_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226631
NZ_CP012122.1\|WP_003644761.1\|892113_892548_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133384
NZ_CP012122.1\|WP_013355871.1\|904964_905975_+\|putative-sulfate-exporter-family-transporter	unknown	unknown	gnl\|CDD\|225411
NZ_CP012122.1\|WP_003644759.1\|893152_893473_+\|carboxymuconolactone-decarboxylase-family-protein	unknown	unknown	gnl\|CDD\|223672
NZ_CP012122.1\|WP_003644760.1\|892720_893119_+\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380361
NZ_CP012122.1\|WP_003644813.1\|908875_909538_+\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|319787
NZ_CP012122.1\|WP_003644758.1\|893486_894230_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP012122.1\|WP_013355872.1\|902427_903936_+\|accessory-Sec-system-glycosyltransferase-Asp1	unknown	unknown	gnl\|CDD\|340855

Protein	Function_ID	Function_description	E-value
NZ_CP012122.1\|WP_003642133.1\|888007_890599_+\|ABC-transporter-permease	gnl\|CDD\|223650	COG0577, SalY, ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms].	3.85225e-14
NZ_CP012122.1\|WP_003644756.1\|897419_897920_-\|methylated-DNA--[protein]-cysteine-S-methyltransferase	gnl\|CDD\|223427	COG0350, Ada, Methylated DNA-protein cysteine methyltransferase [DNA replication, recombination, and repair].	1.72955e-47
NZ_CP012122.1\|WP_015825853.1\|906058_906622_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379112	pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	2.0163e-25
NZ_CP012122.1\|WP_003644757.1\|894387_895605_-\|ABC-transporter-permease	gnl\|CDD\|224582	COG1668, NatB, ABC-type Na+ efflux pump, permease component [Energy production and conversion / Inorganic ion transport and metabolism].	6.10363e-34
NZ_CP012122.1\|WP_003642134.1\|887312_888014_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224059	COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms].	4.59578e-102
NZ_CP012122.1\|WP_013355869.1\|909656_910844_+\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.63824e-66
NZ_CP012122.1\|WP_003644815.1\|906680_907181_-\|DUF4811-domain-containing-protein	gnl\|CDD\|374344	pfam16069, DUF4811, Domain of unknown function (DUF4811). This family of proteins is found in bacteria. Proteins in this family are typically between 188 and 241 amino acids in length. There is a single completely conserved residue Y that may be functionally important.	1.81864e-41
NZ_CP012122.1\|WP_003642132.1\|890679_891942_+\|ArgE/DapE-family-deacylase	gnl\|CDD\|181490	PRK08588, PRK08588, succinyl-diaminopimelate desuccinylase; Reviewed.	0
NZ_CP012122.1\|WP_011101931.1\|907177_908662_-\|multidrug-efflux-MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	6.06458e-95
NZ_CP012122.1\|WP_003644818.1\|900886_902431_+\|glycosyltransferase	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	8.2518e-93
NZ_CP012122.1\|WP_003642119.1\|904020_904848_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	6.66516e-33
NZ_CP012122.1\|WP_003642126.1\|895597_896497_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226631	COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only].	1.14298e-136
NZ_CP012122.1\|WP_003644761.1\|892113_892548_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133384	cd01109, HTH_YyaN, Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB. Putative helix-turn-helix (HTH) MerR-like transcription regulators of Bacillus subtilis, YyaN and YraB, and related proteins; N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	2.12096e-48
NZ_CP012122.1\|WP_013355871.1\|904964_905975_+\|putative-sulfate-exporter-family-transporter	gnl\|CDD\|225411	COG2855, COG2855, Predicted membrane protein [Function unknown].	2.81967e-67
NZ_CP012122.1\|WP_003644759.1\|893152_893473_+\|carboxymuconolactone-decarboxylase-family-protein	gnl\|CDD\|223672	COG0599, COG0599, Uncharacterized homolog of gamma-carboxymuconolactone decarboxylase subunit [Function unknown].	5.24383e-25
NZ_CP012122.1\|WP_003644760.1\|892720_893119_+\|cupin-domain-containing-protein	gnl\|CDD\|380361	cd02233, cupin_HNL-like, Granulicella tundricola hydroxynitrile lyase (GtHNL) and related proteins, cupin domain. This family includes archaeal, eukaryotic, and bacterial proteins homologous to hydroxynitrile lyase from Granulicella tundricola (GtHNL), a novel class of HNLs that does not show any sequence or structural similarity to any other HNL and does not contain conserved motifs typical of HNLs. HNLs comprise a diverse group of enzymes that vary in terms of their substrate specificity, enantioselectivity and the need for a co-factor. In plants, they catalyze the reversible cleavage of cyanohydrins, yielding HCN and aldehydes or ketones. Also included in this family is TM1010 from Thermotoga maritima, a protein of unknown function. Some but not all members of this family have N- or C-terminal carboxymuconolactone decarboxylase domains in addition to the cupin domain. Members of this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	8.25352e-52
NZ_CP012122.1\|WP_003644813.1\|908875_909538_+\|HAD-family-hydrolase	gnl\|CDD\|319787	cd02588, HAD_L2-DEX, L-2-haloacid dehalogenase. L-2-Haloacid dehalogenase catalyzes the hydrolytic dehalogenation of L-2-haloacids to produce the corresponding D-2-hydroxyacids with an inversion of the C2-configuration. 2-haloacid dehalogenases are of interest for their potential to degrade recalcitrant halogenated environmental pollutants and their use in the synthesis of industrial chemicals. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	4.60136e-60
NZ_CP012122.1\|WP_003644758.1\|893486_894230_+\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	4.86242e-97
NZ_CP012122.1\|WP_013355872.1\|902427_903936_+\|accessory-Sec-system-glycosyltransferase-Asp1	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	1.15478e-80

>NZ_CP012122.1|WP_003644756.1|897419_897920_-|methylated-DNA--[protein]-cysteine-S-methyltransferase
MHLTLTQTTINQQTYWLGTTPTGLAFVGRANGPRDEWQAFFKSANIHYDQQANQQACQELHDYLTGQRQHFDIPLDQTTGTPLQHQVWQALTRIPYGQTATYSQLATMINHPTAVRAVASAVGQNPLLIVIPCHRIRRKDGQLGGYRGGLPMKRALLALENARLPK
>NZ_CP012122.1|WP_003642126.1|895597_896497_-|ABC-transporter-ATP-binding-protein
MLSIAHIQKRFGTVQALNDVSFDVHDGEIMGLIGQNGAGKSTTFHSILNFLSFDGQITWNGQPLTADDYDQIGYLPEERSLMSKLTITQQIVYLARLKNQPARVTKGKIAAWMKRFAVKGQPTDKIDKLSKGNQQKVQLICTLIHDPKLIILDEPFSGLDPVNADLLKQAILDAKQRGAAIIFSSHDMSNVEAICDSLVMLRNGEAVLKGTVEDVRAQFGRTRLFLTTDWSQAQLADLPGVTTVTQQGARRFRLELADASVGPAIFDQVTAGHYIEEFSQQPPTLDEIFRTEAGGVNHE
>NZ_CP012122.1|WP_003644757.1|894387_895605_-|ABC-transporter-permease
MNKTWIVTFETYLRQIKSWSFLSLVFMPFLFFGFVAAFSYFAAPSASKNDIAVVSTSPQLRTSFIKQSHVATANKYQTLASAKAATKRNDIAGYLVLTTKNQQLQAQFTGPNAVSSGDKAKIQQFLATAQSQRNVQRAQLSAKQTQALTVQPKFTEQLQKHAASDKTAKTVSFYIVVFFVYLILTTYSAITAQEIAADKGTKIMEVIFSSTTPRKYFNGKIYGVLLVIVTQLLVYLVGGFAVMQFVKRSSLTIDFWQQNTDLINQVIHNLVSINLLFALLAVLLYTVASAFCGALVTRVADASKAAQPVIYLSMLAFFMALAFQNTPTNLFVKIFSYIPFFSSYFMPLRLINGMATMPAAIVSLLILIATIIGSMIYIGRIYGGLMLQTDELGFWGNLKRGLRLK
>NZ_CP012122.1|WP_003644758.1|893486_894230_+|SDR-family-oxidoreductase
MTVKNKVVVITGASSGIGATTAKQLASNGAKVVLGARREERLAALVDEIKAAGGQAAYQVTDVTKSADVQALVKLAQTQFGGLDVIFNNAGIMPTSPISALHTDEWDQMVDINIKGVLNGVAAVMPIFTAQKSGQIITTSSVAGIKSFAGSGVYGATKFAVRNLMEVIRMESAQEGTNIRTVSLYPAAINTELLHTITDKTAKQNMTDFYQQVGISPAAVANVVNFAIDQPEDVNVNEFTIYPTKQA
>NZ_CP012122.1|WP_003644759.1|893152_893473_+|carboxymuconolactone-decarboxylase-family-protein
MTVKQTAGRDNLGKLAPQFAALNDDVLFGEVWARESTLSLHDRSMITIACLMTSGDFPQLKAHFKMGKDHGISKDEAVEIVTHLAFYAGWPKAWSAMALIKEVYGE
>NZ_CP012122.1|WP_003644760.1|892720_893119_+|cupin-domain-containing-protein
MTTTNNSGLFGLGVKNEAYQQYFIGQSYLNALAGDEQVDVNVSNVTFEPGCRNNWHIHHNGYQILLVTSGEGWYQEAGKPAQLLHPGDVVTIHPGVKHWHGATKDSWFAHIAITKGTSEWLEPVDDEAYAKL
>NZ_CP012122.1|WP_003644761.1|892113_892548_-|MerR-family-transcriptional-regulator
MVRTTTERYSIGDFAKAVGLSAPTLRYYEKAGLIEPHRLDNGRRYYETADINWVKFLLHLKGTGMSISELQQYVTWRAAGDDTIPQRLALLKHVKEDFLVQFNEVQHHLQILNDKINWYEEKEAGITQDHEDFSSYLQRFGHHE
>NZ_CP012122.1|WP_003642132.1|890679_891942_+|ArgE/DapE-family-deacylase
MNGMAETAQLEAAVQALSDIVKMNTVNNHEQLVADYLVTLLKQHGIEAQSIEYAPGRVNLVAEIGDGHGPVVALDGHEDTVALGDADKWHTDPLAATIKDNRLYGRGVTDMKAGLMAEVFAMIALHDQDAPLHGTVRLLATVGEEVDHLGAEQLTELGYADDIQTLICAEPSGADKQLLLTKSIQAMLGVDGDTAQRMADANPTTEQHFIELAHKGSLTYTIKAQGVAAHSSMPAIGQNAIDMLMTYYQKQTAYFDSFKTIVNPVLGPTVPVVTLISGGEQVNTVPASAEMSVKIRTIPELRNDRLIKDLEAIIAECNADGANLTMDIASSFYPVHTPEDSQLVQLAKKVGEQVLQQRLPYFGAPGGTDASSYIVKSPDMQVIVFGPGNITAHQVNEYVDLDMYGRFIEIYQKMITELLA
>NZ_CP012122.1|WP_003642133.1|888007_890599_+|ABC-transporter-permease
MVGAAMTAAYFKTIMREIWSSKARFASILLIIFLGVAFYTGIRATGPDMSQAANDYYAKQKLATNSVQSTMGLTKADTRVLNQHRSQLTYQATRYADVNQLNNSQVVRVMALPTTQRLNRLRIVKGRLPRHANEIVLDAQAQRLQPKLKVGSTYRISSTAKRNAQFTRRTFKVVGFVNSPTYVENTNRGVTNVGKGTLDYLVYVRPQVIKSSVITRIDVQFKNLRGVTPYTAKYRRLNRENTAQLKRWLKPQARKRQQALQAQAQAKLKPLQQATQQLASQVPAGTAQLVKLQSQLKRAQAQVAAITMPTYLYTDRTDNPGYTEYHENTQRVVALSTVFPLFFIAIAALICLTTMTRMVEELRLQMGTLKALGYTNTAVGSEFMIYGGLAALIGTALGVLFGVNFFPRFIAQAYGSMYNLPAINVQYIWMDIGIALAIALLCTLGTALVVLRVDLNSLPAQLLQPRSPKAGKTLLLERWQWLWHRLSFNHKITLRNLFRYKQRLLMTVLGIAGCMAMMITGFGLKDSIGDISVKQFNELWHYDAVVTRSGNETDQQRQALSRGQLYQASLKLQAKQVTVKQSGVAEQTATLGIPAPHQSLSKFVVLRHRQSHQAIHIGDRGAVIDEKLAKLYGVQAGDDLTIKLAGQTTKRIHISAVAENYVNHFIYMSPTYYRRVFKQAPVYNTNYVRFKQATKKQENAYADRLLKQAGVQNVTLMSTEKATNFKMLDSMNLVVLIFVISAGALALVVLYNLTNINVSERIRELSTIKVLGFYDGEVTMYIFRENLILTVLGIIAGCFLGNWLHAYILQTAETNALMFSPTIHPLSYVYAALLTLAFSLLVMGMMHRKLKRVNMLDALKSVD
>NZ_CP012122.1|WP_003642134.1|887312_888014_+|ABC-transporter-ATP-binding-protein
MAYIEVQQATRQFKNGEQVTVANRDISFEVDQGAVVVILGPSGAGKSTLLNILGGMDSPTSGRVLVDGVDIAQFNSRQLTTYRRQAVGFVFQFYNLVPNLTARENVELASQITKDARDVDETLTLVGLTHRSDNFPAQLSGGEQQRVAIARAVAKNPKLLLCDEPTGALDYQTGKQVLQVIQDAAKQTQTTVIIVTHNSAIAQLGDQVIRINDAQVQSVEHNAHPTPLAEIEW
>NZ_CP012122.1|WP_003642122.1|899633_900578_-|LysM-peptidoglycan-binding-domain-containing-protein
MKIKNALLTSLAATGLLALGTTVANADTVVVKAGDTVSEIALTHKTTIKAIQKANHLKNVNLIYIGDKLEVNGKHHATTVTTQVPTSAASSTASSTSTASSTANSTSTQSASSASVSSSTSTSAASTATSSSTTSVASSSAASSSSTSAASSSVTSTSTASAASSSAASSSTSSATSSSATSQASTASSSTATSASMTKLSNTTASSAASTSTAASSSATTSSSTTTSTSSSSSTTSTSSSAEAAAKAWIANKESGGSYTASNGNYYGKYQLSKSLLNGDYSASNQETVADEYVASRYGSWVAAKAFWEANGYY
>NZ_CP012122.1|WP_003644818.1|900886_902431_+|glycosyltransferase
MYYFVNTSINPKKSGIEHAEMKRLALFNQHHVPAKMVTRFFSLSLHQTLTAAGIAAENQINLFDFIQHSSERPTTKMTIEDLHLAPDLRVQPVGRHYEVYQNDQLLMKVNTFLNTQKQLNNVQYYDQNGKLVKTDWYDTRGFKGLEQFYAADGQVASEQVFNPDGEVVYQTFHMADRQNQVQNSLYRFINYEGQDWSFAGETAMTTFFLDELNRRTPHAVFVIDRTYELAYAALHMRTKAFKVMHLHSNHVNDPAHPKTASLNFNYAYALNNLDQWNGVIASTKQQTADFQARFGNQPAVYTIPVGIVDDATLNAPKPSFDQRTAGKIIFVARLAEEKQQDQVIRAFKKVLAQVPNATLDFWGYANGDTGKQLHQLVEQLGLKAAVTFNDYTTDLTAVYNDAQLAMLTSRAEGFALALLEGQAHGVPQIAYDVKYGPRDIIRDGHDGQLVPVNDENALATAMIDLLTQPKKLAMYSQQAYQDAQRFSTTAVWQQWQPLMKAAADFYQVEGATQR
>NZ_CP012122.1|WP_013355872.1|902427_903936_+|accessory-Sec-system-glycosyltransferase-Asp1
MNFFVNQYLMALNSGVEHAEFKRLQLFKDHQAPAKLVTRQFDGLLHQNMRRFNIADDQMANLFDFFRETTSFSSRVIKMADLNWPTAYDIKPDPNVSEVRAGDRLVAKVHFVPSTVGHVYFIEIFDHFNNLVQRTDYDERGFKARDEFFSSAGEPITDIFYRPDGSRMAEQYYAHDNNGTNYVSLCHLINYHGRDYYFNGEQEWYRFFLDELNKQYDENNVFIADRPLAAQWPVVNMQTAAKKYLWLPTPHAVDPRDQVYSNLNNAYVYGLHEFLSAWDGVITSTEQQKQDLTQWLGGQPSVPILTISAAVVSKQQAQHAPISISERHAHEIIYTGRLDAERRVDQLVTAFDQVHHKITDATLVIYGYGGELDRLKQQVSQLHLETAVTFAGYQPNLTMAYDQAGAYVYTGESDAQPLSLIEALSHGVPAIAYDINYGPKDVLKDGKNGYLVTDGAVNQLVRALTRTLESPQRQQRLSKGAYRSSEQYSDEQVWQQWQPVVQ
>NZ_CP012122.1|WP_003642119.1|904020_904848_-|LysR-family-transcriptional-regulator
MFKQLETFCAVYETRNFSHAAEQLFISQPTVSTQIKQLEADLQTTLLTRNGRQEIVPTASGQLLYQQAQKLLTTWAATKTAVQSPRHLVKVPCRIGASHTTGRLILPTLLANLSAVSDRFDFQVTLANSAEILTAMSQHKLDFGLVEKPLVTDQLNRLPFGHDELVHAGDFASPLWLLREPNSGVRHYTNAFLKARNIQPAQVMVIHSNQIIADLLAHGIGQTIISRHVLSNEIPIEQLSAHYQRQFFLLTNTQPAAALRPVQTAITQYLTTWSD
>NZ_CP012122.1|WP_013355871.1|904964_905975_+|putative-sulfate-exporter-family-transporter
MKVKGILPGLVTSLVIAIISQGLAQFVPALGAATIAILLGIIGGNTFLKQPQLGRGTKFAESKLLEYSVMLLGATMTVQTIGKIGGFGVLFILCQMTITIVGALWLGRKLGFSQSVRMLMAGGNAVCGSSAIASIAPVIDADEDDKGTVITLVNLMGTVLMLTLPVLGMAVFGGSVILKGALIGGTLQSVGQVVAAASMVNQTTVQFATIFKIMRIMMLVVVVLIFGRLHQRTIENELAEDAVVSGNGNGHWLPWYVAGFLILCALNSLISLPAIIGATAHTISSWFEIIALAAIGLRLNLVNFMKAGKRLALYGLGVGTIQVVSALILITLLLQH
>NZ_CP012122.1|WP_015825853.1|906058_906622_+|GNAT-family-N-acetyltransferase
MFMLTYRVTPAIELREPLPQSDAPALLALLTANRAQYQYYLPWVAKIQTVADEQRFLTFAQAQLQQAQALNLVIVVEQRVAGMVSCDHFDDNDHSANIGYWLGRPFQGRGVMTAAVRGVCDLGFNQYHRQCLRIRAAVDNQASNAVAQRTGFDFLIQHPGGQHLLDGDHDENVYQVSAVDWLAKRHK
>NZ_CP012122.1|WP_003644815.1|906680_907181_-|DUF4811-domain-containing-protein
MIIVLLILATFVFAGTMIFSPAGRNRLIAIIISGLIIATSLIALVLNDNYHWGMHEVTRTQIQDLAPLKSKQVALRVQQLGTGSERVISYRVAAATKVSHTVTATTTTTKLTSGSPAQVQLKTTTWQFKNHLTHVLFSLGNTKTKIVQRQYLFTIPKTWQVVTVKN
>NZ_CP012122.1|WP_011101931.1|907177_908662_-|multidrug-efflux-MFS-transporter
MPTQNSTLPLDANGQPYHRTWLVLTLLVGTFTTFITQTLLTTAFPTLMADFHISATAVQWLTTGFMLIMGIMIPVSAWLLTRINSKYLYLTAMLIFGLGTTLAYFAVNFQMLLIARMIQAMGVGISAPVFQTIMSSVYPPEKRGSAMGTAGIVIGLAPAIGPTLSGWIIDNYSWRALFLFILPINILVIIVSFFTLRKVLPTSKQPIDWWSVLISTIGFGSMLYGFSSVGNAGWGDPVVLTTLVIGLIFIGLFVWRQLHMDQPLLELRVFKIPAFTLSAILTALAYMAMMGVEMILPMYIQTVLGRSAMDSGLILLPGAIMMGIMSPITGRIFDHIGARRLAMTGMLLLTLGTAFFLSISATTPILWIIVVYAIRMFGLTMVTMPVTTTGINALPFRLISHGTAANNTLRQVAASMGTAVLISVYSSVAKWQMPGHQLLTQAPLKYRQDGITATLTGYHMAFVVSLIFCAIGFGITFFLKANHSKTISQEDDAA
>NZ_CP012122.1|WP_003644813.1|908875_909538_+|HAD-family-hydrolase
MTKKYLTFDCYGTLINTEPLYQWVANLGLAVGLDPLTVRKAYATYEDDPASVNPYLDYSTLVRADLKHLDRLFEQRHFFESHYVECLEVQRHLLPYADVIPTLTAWQQLGYQLIIMSNSSWDIMPANIAALKVPFTAVVTAEDVQAYKPALAFFETVQERFKLTADNHWHIARGYESDVVPASAMQWPMIWINRDQRQPTSSERPTHMVTDLAAAKQWVN
>NZ_CP012122.1|WP_013355869.1|909656_910844_+|MFS-transporter
MNSKSLNKSTVLLMAISAAIVVANINYIQPIEADIAQQFNLPNAVIGAVAMLTQLGYAFGLLLIVPMGDIMNRRMLIMRLLVLAIISALLAFVAPNIWVYALASLLIGITSVAPQVIIPYAGFLAPRNQRGQVLGNVLSGLLVGVLLSRTVSGVLASYLPWQMVYLIAAILIAGLWLVLWRKLPHDPVTTHTTNYKAMIQTVPQLVKRYPVLRASAVNGFVLFGVSNIFWATLVFYLQHQYGWGSREAGLLALLGVTGVLAAPLIGRLADRFRPRTIIGLGLVLSTLAYVVFWLSGTHLVGLIIGIVILDLGTQFGQVANQTRIQSIDVHASSRFNSVFMFGYFMGGALGSFCGNVLWDLAGWNGVCGLAVVVLMIGFYAHFVHYPRVVTRQAQY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

317618 : 399557

Bacillus_virus(20.0%)

protease,tRNA,bacteriocin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643762.1\|317618_318182_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_013355171.1\|318375_319044_+	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_013355172.1\|319201_320707_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_013355173.1\|320971_321340_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|321452_321962_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_013355174.1\|321992_323189_-	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003646440.1\|323298_323769_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_003641935.1\|323787_324243_+	hypothetical protein	NA	NA	NA	NA
WP_013355176.1\|324346_324919_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_013355177.1\|325084_326005_-	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_013355178.1\|326141_327053_+	oxidoreductase	NA	NA	NA	NA
WP_003646442.1\|327799_328246_-	ribonuclease H	NA	NA	NA	NA
WP_003641940.1\|328483_330010_+	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_003641941.1\|330010_330982_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_003646444.1\|331059_332391_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003643773.1\|332856_334374_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_003641944.1\|334388_336218_+	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_003641945.1\|336232_336955_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
WP_058906756.1\|337537_341221_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_058906757.1\|341222_342986_+	pre-toxin TG domain-containing protein	NA	NA	NA	NA
WP_003641948.1\|342982_343900_+	hypothetical protein	NA	NA	NA	NA
WP_003641949.1\|343943_344207_+	hypothetical protein	NA	NA	NA	NA
WP_003641950.1\|344318_344597_+	hypothetical protein	NA	NA	NA	NA
WP_003641952.1\|344976_345363_+	hypothetical protein	NA	NA	NA	NA
WP_003641954.1\|345812_346004_+	hypothetical protein	NA	NA	NA	NA
WP_114071742.1\|346206_346353_+	glycohydrolase toxin TNT-related protein	NA	NA	NA	NA
WP_003641956.1\|346429_346837_+	immunity 63 family protein	NA	NA	NA	NA
WP_003641960.1\|348107_348383_+	hypothetical protein	NA	NA	NA	NA
WP_003641962.1\|348764_349382_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_003641963.1\|349385_350540_-	MFS transporter	NA	NA	NA	NA
WP_011100993.1\|350543_351335_-	HAD family hydrolase	NA	NA	NA	NA
WP_058906758.1\|351405_352278_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_003641966.1\|352437_353253_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_011100994.1\|353778_355155_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_011100995.1\|355199_356384_+	cation:proton antiporter	NA	NA	NA	NA
WP_003641969.1\|356768_356972_+	hypothetical protein	NA	NA	NA	NA
WP_003641971.1\|357383_358052_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003641972.1\|358048_358222_-\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnK	NA	NA	NA	NA
WP_003641973.1\|358252_358420_-\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnJ	NA	NA	NA	NA
WP_003641974.1\|359281_359482_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003641975.1\|359609_359777_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_003641976.1\|359894_361094_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_003641977.1\|361124_361871_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641979.1\|362748_362895_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_011100998.1\|363085_364414_+	GHKL domain-containing protein	NA	NA	NA	NA
WP_058906759.1\|364414_365158_+	LytTR family transcriptional regulator DNA-binding domain-containing protein	NA	NA	NA	NA
WP_003641982.1\|365276_366020_+	response regulator transcription factor	NA	NA	NA	NA
WP_003646470.1\|366324_367098_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003643811.1\|367196_367355_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
WP_003641985.1\|367379_367550_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
WP_003641986.1\|367816_369967_+	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	6.1e-45	27.9
WP_003641987.1\|369982_371359_+	HlyD family secretion protein	NA	NA	NA	NA
WP_003641990.1\|372205_372874_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641991.1\|372960_373641_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641992.1\|373734_374421_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641993.1\|374558_374762_+	hypothetical protein	NA	NA	NA	NA
WP_003641994.1\|374856_377166_-	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_003643814.1\|377424_378201_+	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_003643815.1\|378639_379656_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_003641997.1\|380063_380774_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003641998.1\|380846_382208_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003641999.1\|382214_382403_+	hypothetical protein	NA	NA	NA	NA
WP_003642000.1\|382392_382815_+	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_003643816.1\|383037_384393_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003642002.1\|384410_385847_+	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	9.7e-31	25.5
WP_003642003.1\|385967_386864_+	ROK family protein	NA	NA	NA	NA
WP_003642004.1\|387013_387760_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_003643818.1\|387872_388886_+\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
WP_003642006.1\|389339_390473_+	hypothetical protein	NA	NA	NA	NA
WP_003643820.1\|390477_391272_+	hypothetical protein	NA	NA	NA	NA
WP_003642008.1\|391440_392358_+	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_003642009.1\|392403_393678_+	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_003642010.1\|393670_394630_+	hypothetical protein	NA	NA	NA	NA
WP_003642011.1\|394651_395356_+	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_003642012.1\|395355_396198_+	DUF72 domain-containing protein	NA	NA	NA	NA
WP_003646492.1\|396794_397184_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_003643823.1\|397505_399557_+\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.7e-90	35.8

DBSCAN-SWA_2

1007054 : 1015565

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645861.1\|1007054_1007537_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0
WP_011101896.1\|1007520_1008651_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003642587.1\|1008653_1009385_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
WP_003642588.1\|1009386_1009641_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_011101895.1\|1009640_1010321_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003645864.1\|1010313_1012533_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	4.5e-144	39.3
WP_058906790.1\|1012517_1013972_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.9e-50	34.0
WP_013355836.1\|1013968_1014994_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	5.4e-60	40.7
WP_003645867.1\|1014986_1015565_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9

DBSCAN-SWA_3

1200852 : 1306044

126

Lactobacillus_phage(50.65%)

terminase,integrase,portal,plate,capsid,protease,lysis,holin,head,tail

attL 1202189:1202248|attR 1256469:1256540

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058906800.1\|1200852_1202121_-\|integrase	site-specific integrase	A0A0P0I3D2	Lactobacillus_phage	8.2e-90	42.2
1202189:1202248	attL	NA	NA	NA	NA
WP_080396925.1\|1202302_1202479_-	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	9.1e-08	53.4
WP_058906802.1\|1202983_1203775_-	hypothetical protein	NA	NA	NA	NA
WP_003644968.1\|1203797_1204211_-	ImmA/IrrE family metallo-endopeptidase	A0A0M4RD70	Bacillus_phage	3.4e-05	31.3
WP_003644967.1\|1204222_1204591_-	helix-turn-helix transcriptional regulator	E9LUL4	Lactobacillus_phage	5.7e-20	44.1
WP_003644966.1\|1204740_1204977_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_024623923.1\|1205227_1205743_+	hypothetical protein	D6PST4	Lactobacillus_phage	1.7e-25	38.6
WP_058906804.1\|1205755_1206001_+	hypothetical protein	NA	NA	NA	NA
WP_162922000.1\|1206310_1206820_+	hypothetical protein	NA	NA	NA	NA
WP_058906805.1\|1206822_1207638_+	recombinase RecT	A8ATY6	Listeria_phage	7.9e-62	53.0
WP_080396927.1\|1207657_1208419_+	PD-(D/E)XK nuclease-like domain-containing protein	E9LUM4	Lactobacillus_phage	3.5e-48	40.7
WP_058906806.1\|1208498_1209404_+	DnaD domain protein	NA	NA	NA	NA
WP_058906807.1\|1209417_1209918_+	hypothetical protein	O03915	Lactobacillus_phage	5.0e-83	88.6
WP_058906808.1\|1209914_1210292_+	endodeoxyribonuclease	NA	NA	NA	NA
WP_058906809.1\|1210288_1210723_+	hypothetical protein	A0A288TZS1	Enterococcus_phage	3.6e-29	48.8
WP_058906810.1\|1210722_1210953_+	hypothetical protein	O03916	Lactobacillus_phage	3.5e-23	61.8
WP_058906811.1\|1211412_1211724_+	hypothetical protein	A0A2P0ZLB4	Lactobacillus_phage	3.6e-47	89.3
WP_162922001.1\|1212632_1212797_+	hypothetical protein	Q597S5	Lactobacillus_virus	4.6e-14	86.5
WP_080396929.1\|1212941_1213373_+	hypothetical protein	K4I239	Lactobacillus_phage	2.1e-37	60.0
WP_058906812.1\|1213369_1213783_+	DUF1642 domain-containing protein	E9LUP3	Lactobacillus_phage	1.3e-36	58.7
WP_080396930.1\|1213779_1213947_+	hypothetical protein	E9LUP4	Lactobacillus_phage	2.8e-14	91.5
WP_058906813.1\|1214074_1214536_+	transcriptional regulator	D6PSV8	Lactobacillus_phage	6.9e-39	57.0
WP_022638321.1\|1214901_1215246_+	hypothetical protein	NA	NA	NA	NA
WP_058906814.1\|1215307_1215553_+	hypothetical protein	NA	NA	NA	NA
WP_053267733.1\|1215549_1215813_+	hypothetical protein	A0A1S5RCN3	Lactobacillus_phage	2.4e-28	69.8
WP_080396931.1\|1216420_1217710_+\|terminase	PBSX family phage terminase large subunit	G8FUZ2	Pediococcus_virus	8.3e-207	79.9
WP_058906965.1\|1217736_1219275_+\|portal	phage portal protein	G8FUZ1	Pediococcus_virus	1.7e-190	66.0
WP_058906816.1\|1219192_1219999_+\|capsid	minor capsid protein	G8FUZ0	Pediococcus_virus	6.5e-101	66.4
WP_058906817.1\|1220014_1220236_+	hypothetical protein	NA	NA	NA	NA
WP_058906818.1\|1220378_1220969_+	DUF4355 domain-containing protein	Q597V6	Lactobacillus_virus	9.2e-20	45.7
WP_058906819.1\|1220988_1221849_+	hypothetical protein	K4I067	Lactobacillus_virus	1.9e-143	89.9
WP_119724049.1\|1221869_1222124_+	Ig-like domain-containing protein	G8FUY7	Pediococcus_virus	1.0e-15	63.5
WP_058906820.1\|1222183_1222522_+\|head,tail	phage head-tail connector protein	K4I470	Lactobacillus_virus	3.3e-46	78.6
WP_058906821.1\|1222518_1222797_+	hypothetical protein	G8FUY5	Pediococcus_virus	3.8e-32	75.0
WP_058906822.1\|1222789_1223164_+	HK97 gp10 family phage protein	G8FUY4	Pediococcus_virus	4.0e-37	62.9
WP_058906823.1\|1223163_1223517_+	hypothetical protein	K4I072	Lactobacillus_virus	9.6e-41	70.9
WP_058906824.1\|1223536_1224325_+\|tail	phage major tail protein, TP901-1 family	Q597U9	Lactobacillus_virus	7.8e-99	92.1
WP_058906825.1\|1224345_1224759_+	hypothetical protein	A0A2K9VBY8	Lactobacillus_phage	6.2e-39	59.9
WP_058906827.1\|1225079_1228520_+\|tail	phage tail tape measure protein	A0A2P0ZL32	Lactobacillus_phage	8.6e-17	53.6
WP_058906828.1\|1228532_1229918_+\|tail	phage tail family protein	A0A2P0ZL23	Lactobacillus_phage	1.2e-123	50.7
WP_058906829.1\|1232145_1234155_+\|plate	BppU family phage baseplate upper protein	A0A2P0ZKZ2	Lactobacillus_phage	2.5e-72	73.4
WP_058906830.1\|1234167_1234551_+	hypothetical protein	A0A2P0ZLF7	Lactobacillus_phage	2.3e-64	92.9
WP_058906831.1\|1234553_1234748_+	hypothetical protein	A0A2P0ZLG4	Lactobacillus_phage	4.2e-22	92.2
WP_058906832.1\|1234747_1235032_+\|lysis	lysis protein	A0A2P0ZLE8	Lactobacillus_phage	6.6e-40	94.7
WP_058906833.1\|1235031_1236102_+	LysM peptidoglycan-binding domain-containing protein	A0A2P0ZLG2	Lactobacillus_phage	3.1e-98	77.1
WP_058906834.1\|1236289_1237204_-	hypothetical protein	NA	NA	NA	NA
WP_003646619.1\|1237995_1238187_+	hypothetical protein	NA	NA	NA	NA
WP_058906835.1\|1238591_1240586_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	7.2e-32	41.3
WP_003642762.1\|1240603_1242181_+	glycosyltransferase	NA	NA	NA	NA
WP_003642763.1\|1242152_1243916_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.8e-96	40.9
WP_003639252.1\|1244855_1244999_+	hypothetical protein	NA	NA	NA	NA
WP_011101805.1\|1245521_1245665_+	hypothetical protein	NA	NA	NA	NA
WP_058906836.1\|1246352_1249079_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_013355761.1\|1249178_1251155_+	hypothetical protein	NA	NA	NA	NA
WP_003642771.1\|1251209_1251695_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_003642772.1\|1251743_1252016_-	hypothetical protein	NA	NA	NA	NA
WP_003642773.1\|1252040_1252274_-	hypothetical protein	NA	NA	NA	NA
WP_003642774.1\|1252686_1252893_+	hypothetical protein	NA	NA	NA	NA
WP_058906837.1\|1253244_1254366_-\|integrase	site-specific integrase	D6PSS4	Lactobacillus_phage	8.4e-46	32.1
WP_058906838.1\|1254543_1255407_-	DUF3037 domain-containing protein	NA	NA	NA	NA
WP_058906839.1\|1255373_1256414_-	hypothetical protein	NA	NA	NA	NA
WP_003642778.1\|1256597_1256774_-	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	2.6e-10	51.7
1256469:1256540	attR	NA	NA	NA	NA
WP_022638129.1\|1257149_1257431_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_022638128.1\|1257461_1257821_-	hypothetical protein	NA	NA	NA	NA
WP_021356373.1\|1257847_1258225_-	large-conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
WP_022638127.1\|1258679_1259243_-	hypothetical protein	NA	NA	NA	NA
WP_022638126.1\|1259269_1260349_-	hypothetical protein	NA	NA	NA	NA
WP_013355756.1\|1261033_1261753_-	hypothetical protein	NA	NA	NA	NA
WP_058906840.1\|1261859_1262282_-	ImmA/IrrE family metallo-endopeptidase	A0A0S2SXM3	Bacillus_phage	1.1e-11	34.4
WP_013355754.1\|1262296_1262800_-	helix-turn-helix transcriptional regulator	S6C481	Thermus_phage	1.7e-22	42.6
WP_033099030.1\|1262945_1263200_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013355753.1\|1263256_1263571_-	hypothetical protein	NA	NA	NA	NA
WP_011101085.1\|1263608_1263845_-	helix-turn-helix transcriptional regulator	A0A0K2CNE2	Brevibacillus_phage	8.5e-09	30.7
WP_011101086.1\|1263991_1264192_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003642792.1\|1264350_1264521_+	hypothetical protein	NA	NA	NA	NA
WP_058906841.1\|1264532_1264838_+	DUF771 domain-containing protein	NA	NA	NA	NA
WP_022638124.1\|1264905_1265418_+	helix-turn-helix transcriptional regulator	D6PST4	Lactobacillus_phage	2.0e-23	39.4
WP_022638122.1\|1265788_1266169_+	hypothetical protein	NA	NA	NA	NA
WP_058906842.1\|1266171_1267059_+	recombinase RecT	E9LUM3	Lactobacillus_phage	2.0e-63	53.7
WP_162922002.1\|1267090_1267843_+	PD-(D/E)XK nuclease-like domain-containing protein	A0A0P0IZH9	Lactobacillus_phage	1.1e-73	52.2
WP_058906844.1\|1267921_1268830_+	DnaD domain protein	NA	NA	NA	NA
WP_013355745.1\|1268826_1269114_+	hypothetical protein	NA	NA	NA	NA
WP_011101096.1\|1269110_1269641_+	hypothetical protein	NA	NA	NA	NA
WP_013355744.1\|1269637_1270156_+	hypothetical protein	O03915	Lactobacillus_phage	4.5e-55	69.1
WP_013355743.1\|1270152_1270533_+	endodeoxyribonuclease	NA	NA	NA	NA
WP_058906845.1\|1270617_1271109_+	methyltransferase domain-containing protein	O03918	Lactobacillus_phage	2.5e-87	93.1
WP_154698893.1\|1271176_1271350_+	hypothetical protein	NA	NA	NA	NA
WP_058906846.1\|1271352_1271571_+	hypothetical protein	A0A2P0ZLC3	Lactobacillus_phage	2.3e-13	87.8
WP_058906847.1\|1271563_1271989_+	hypothetical protein	K4I239	Lactobacillus_phage	4.2e-75	95.7
WP_058906848.1\|1271991_1272372_+	hypothetical protein	NA	NA	NA	NA
WP_058906849.1\|1272368_1272815_+	hypothetical protein	A0A2P0ZLB8	Lactobacillus_phage	9.7e-22	39.4
WP_080396932.1\|1272929_1273097_+	hypothetical protein	E9LUP4	Lactobacillus_phage	4.1e-10	76.6
WP_058906850.1\|1273223_1273685_+	transcriptional regulator	D6PSV8	Lactobacillus_phage	9.0e-39	56.3
WP_119724041.1\|1273907_1274075_+	BC1881 family protein	NA	NA	NA	NA
WP_058906851.1\|1274071_1274281_-	KTSC domain-containing protein	NA	NA	NA	NA
WP_013355741.1\|1274571_1275348_-	hypothetical protein	NA	NA	NA	NA
WP_013355740.1\|1275475_1275682_+	hypothetical protein	E9LUP6	Lactobacillus_phage	7.6e-06	56.5
WP_013355739.1\|1275915_1276443_+\|terminase	terminase small subunit	O03926	Lactobacillus_phage	4.5e-58	75.7
WP_033098955.1\|1276432_1277671_+\|terminase	PBSX family phage terminase large subunit	M1PG09	Streptococcus_phage	1.9e-139	61.3
WP_013355738.1\|1277682_1279191_+\|portal	phage portal protein	V5US18	Oenococcus_phage	1.8e-136	52.0
WP_024971552.1\|1279120_1279417_+\|protease	ribosomal-processing cysteine protease Prp	D2J003	Enterococcus_phage	1.1e-10	40.2
WP_013355736.1\|1279563_1281249_+\|capsid	minor capsid protein	V5US81	Oenococcus_phage	6.5e-119	58.0
WP_003642815.1\|1281223_1281502_+	hypothetical protein	NA	NA	NA	NA
WP_013355734.1\|1281553_1281760_+	hypothetical protein	NA	NA	NA	NA
WP_013355733.1\|1281932_1282610_+	DUF4355 domain-containing protein	Q6SE80	Lactobacillus_prophage	6.0e-15	32.1
WP_013355732.1\|1282624_1282972_+	hypothetical protein	V5UTH9	Oenococcus_phage	4.4e-30	63.8
WP_003642819.1\|1282991_1284014_+\|capsid	major capsid protein	V5US24	Oenococcus_phage	3.7e-117	62.5
WP_003642820.1\|1284026_1284203_+	hypothetical protein	NA	NA	NA	NA
WP_013355731.1\|1284214_1284547_+\|head,tail	phage head-tail connector protein	V9QJ97	Oenococcus_phage	1.8e-12	45.3
WP_003642822.1\|1284546_1284894_+	hypothetical protein	V5US85	Oenococcus_phage	3.2e-36	62.3
WP_013355730.1\|1284895_1285447_+	HK97 gp10 family phage protein	V5URV0	Oenococcus_phage	2.0e-64	62.3
WP_013355729.1\|1285446_1285812_+	hypothetical protein	V5UQS4	Oenococcus_phage	3.0e-29	53.4
WP_099447638.1\|1285913_1286297_+\|tail	phage tail protein	V5USQ9	Oenococcus_phage	1.8e-37	58.4
WP_003642826.1\|1286396_1286795_+	hypothetical protein	V9QJA0	Oenococcus_phage	3.0e-46	74.8
WP_031275283.1\|1286902_1287166_+	hypothetical protein	V9QKH3	Oenococcus_phage	2.3e-23	65.4
WP_057138638.1\|1287181_1293013_+	hypothetical protein	V5URV5	Oenococcus_phage	6.6e-227	40.9
WP_058906852.1\|1293026_1293389_+	hypothetical protein	V5UQS8	Oenococcus_phage	3.3e-44	70.3
WP_058906853.1\|1293403_1298674_+	hypothetical protein	Q6SE68	Lactobacillus_prophage	3.7e-144	59.4
WP_003642831.1\|1298680_1299130_+	DUF1617 family protein	A0A2P0ZLE0	Lactobacillus_phage	6.1e-24	40.5
WP_003642832.1\|1299132_1299567_+	hypothetical protein	NA	NA	NA	NA
WP_013355723.1\|1299745_1300861_+	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	1.7e-46	64.2
WP_016511341.1\|1300861_1301158_+	hypothetical protein	A0A1I9KK55	Lactobacillus_phage	4.4e-39	77.6
WP_058906854.1\|1301144_1301528_+\|holin	holin	A0A2H4PBB2	Lactobacillus_phage	2.9e-14	85.4
WP_003644667.1\|1302623_1303475_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_003641420.1\|1303697_1304090_+	YxeA family protein	NA	NA	NA	NA
WP_003644665.1\|1304313_1306044_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.6e-46	27.6

DBSCAN-SWA_4

2136041 : 2148819

Lactobacillus_phage(70.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013355474.1\|2136041_2136986_-	glycosyltransferase family 2 protein	V5USA4	Oenococcus_phage	2.0e-72	45.5
WP_013355473.1\|2137010_2137676_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_021356352.1\|2138385_2139078_+	response regulator transcription factor	W8CYM9	Bacillus_phage	5.3e-35	37.6
WP_022638019.1\|2139070_2140438_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	3.4e-25	31.0
WP_013355470.1\|2140828_2141269_+	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	1.2e-75	97.9
WP_013355469.1\|2141339_2141900_-	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	6.5e-100	98.4
WP_022638021.1\|2141987_2144426_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.6
WP_003643097.1\|2144428_2145043_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_003643099.1\|2145385_2146333_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
WP_013355468.1\|2146518_2147490_+	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	3.5e-181	98.5
WP_013355467.1\|2147580_2148819_-	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	2.4e-219	98.7

DBSCAN-SWA_5

2825741 : 2834365

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013355240.1\|2825741_2826737_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	2.0e-51	38.5
WP_003640969.1\|2826875_2827661_-	acyl-ACP thioesterase	NA	NA	NA	NA
WP_013355239.1\|2827664_2828561_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	4.4e-82	55.7
WP_003640967.1\|2828659_2829007_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
WP_058906925.1\|2829031_2830051_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
WP_003640965.1\|2830067_2830397_-	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_011101140.1\|2830393_2831059_-	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
WP_003640957.1\|2831456_2831708_-	YaaL family protein	NA	NA	NA	NA
WP_003637790.1\|2831722_2832322_-	recombination protein RecR	NA	NA	NA	NA
WP_003640956.1\|2832337_2832646_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_013355236.1\|2832667_2834365_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.0e-55	37.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP012123

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

16675 : 24379

Enterococcus_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112260613.1\|16675_17451_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
WP_013356283.1\|17558_18461_-	YitT family protein	M1Q1P6	Streptococcus_phage	6.3e-52	40.3
WP_046783566.1\|18547_19180_-	recombinase family protein	A0A286S1P7	Klebsiella_phage	3.6e-14	33.2
WP_112260612.1\|19293_20106_+\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	6.3e-11	29.5
WP_046811155.1\|20233_21184_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	1.2e-98	54.3
WP_010623241.1\|21198_22125_-	ribonucleotide-diphosphate reductase subunit beta	A0A2H4P8A9	Corynebacterium_phage	5.9e-37	32.1
WP_029508458.1\|22231_24379_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	9.4e-256	60.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP012122

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP012123

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection