CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP011918	Burkholderia cenocepacia strain ST32 chromosome 2, complete sequence	1 crisprs	csa3,cas3,PD-DExK,RT,DinG	0	1
NZ_CP011920	Burkholderia cenocepacia strain ST32 plasmid pBCEN1232, complete sequence	1 crisprs	NA	2	1
NZ_CP011917	Burkholderia cenocepacia strain ST32 chromosome 1, complete sequence	0 crisprs	DEDDh,DinG,RT,csa3,PD-DExK,WYL,cas3	0	6
NZ_CP011919	Burkholderia cenocepacia strain ST32 chromosome 3, complete sequence	0 crisprs	RT	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP011918_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011918_1

173803-173881

Orphan

Consensus_repeat	Method
ATGTCAATGGCGATCACCATTGT	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of NZ_CP011918_1

>merge|NZ_CP011918|1|173803-173881|CRISPRCasFinder
ATGTCAATGGCGATCACCATTGTCTTTGCGGTGCATTGTGTTCGCGCCGCACCGGCATGTCAATGGCGATCACCATCGT

>NZ_CP011918|1|1|173803-173881|CRISPRCasFinder
ATGTCAATGGCGATCACCATTGT	CTTTGCGGTGCATTGTGTTCGCGCCGCACCGGC
ATGTCAATGGCGATCACCATCGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011918.1\|WP_006480371.1\|170941_171475_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224427
NZ_CP011918.1\|WP_058902402.1\|176358_176844_+\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176905
NZ_CP011918.1\|WP_058902398.1\|168103_168973_-\|DUF393-domain-containing-protein	unknown	unknown	gnl\|CDD\|367833
NZ_CP011918.1\|WP_006483953.1\|171642_172845_+\|trans-2-enoyl-CoA-reductase-family-protein	unknown	unknown	gnl\|CDD\|237460
NZ_CP011918.1\|WP_058902403.1\|177455_178571_-\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|226145
NZ_CP011918.1\|WP_006485763.1\|163749_164169_-\|HIT-family-protein	unknown	unknown	gnl\|CDD\|238608
NZ_CP011918.1\|WP_006485758.1\|169066_169537_-\|DUF2269-domain-containing-protein	unknown	unknown	gnl\|CDD\|370783
NZ_CP011918.1\|WP_006488807.1\|175288_175819_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP011918.1\|WP_058902396.1\|165911_166535_-\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|198289
NZ_CP011918.1\|WP_058902401.1\|176021_176387_+\|helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|223713
NZ_CP011918.1\|WP_058902399.1\|169533_170853_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187579
NZ_CP011918.1\|WP_058902397.1\|166607_168107_-\|TIGR01777-family-protein	unknown	unknown	gnl\|CDD\|224015
NZ_CP011918.1\|WP_006496193.1\|179962_181255_-\|CoA-transferase	unknown	unknown	gnl\|CDD\|224717
NZ_CP011918.1\|WP_043205262.1\|172905_173610_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|181335
NZ_CP011918.1\|WP_058902400.1\|174547_175126_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011918.1\|WP_058902404.1\|178572_179880_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|131385
NZ_CP011918.1\|WP_058902405.1\|181251_182238_-\|hydroxymethylglutaryl-CoA-lyase	unknown	unknown	gnl\|CDD\|163676
NZ_CP011918.1\|WP_058902395.1\|164411_165833_+\|serine-hydrolase	unknown	unknown	gnl\|CDD\|224594
NZ_CP011918.1\|WP_058903545.1\|176963_177440_+\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176904
NZ_CP011918.1\|WP_006496201.1\|173923_174508_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|182632

Protein	Function_ID	Function_description	E-value
NZ_CP011918.1\|WP_006480371.1\|170941_171475_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|224427	COG1510, COG1510, Predicted transcriptional regulators [Transcription].	9.65607e-41
NZ_CP011918.1\|WP_058902402.1\|176358_176844_+\|SRPBCC-family-protein	gnl\|CDD\|176905	cd08896, SRPBCC_CalC_Aha1-like_3, Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins. SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of a functionally uncharacterized subgroup of CalC- and Aha1-like proteins. This group shows similarity to the SRPBCC domains of Micromonospora echinospora CalC (a protein which confers resistance to enediynes) and human Aha1 (one of several co-chaperones which regulate the dimeric chaperone Hsp90), and belongs to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands.	1.5556e-81
NZ_CP011918.1\|WP_058902398.1\|168103_168973_-\|DUF393-domain-containing-protein	gnl\|CDD\|367833	pfam04134, DUF393, Protein of unknown function, DUF393. Members of this family have two highly conserved cysteine residues near their N-terminus. The function of these proteins is unknown.	1.92762e-16
NZ_CP011918.1\|WP_006483953.1\|171642_172845_+\|trans-2-enoyl-CoA-reductase-family-protein	gnl\|CDD\|237460	PRK13656, PRK13656, enoyl-[acyl-carrier-protein] reductase FabV.	0
NZ_CP011918.1\|WP_058902403.1\|177455_178571_-\|amidohydrolase-family-protein	gnl\|CDD\|226145	COG3618, COG3618, Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only].	4.29759e-38
NZ_CP011918.1\|WP_006485763.1\|163749_164169_-\|HIT-family-protein	gnl\|CDD\|238608	cd01277, HINT_subgroup, HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides. This subgroup includes members from all three forms of cellular life. Although the biochemical function has not been characterised for many of the members of this subgroup, the proteins from Yeast have been shown to be involved in secretion, peroxisome formation and gene expression.	8.15093e-49
NZ_CP011918.1\|WP_006485758.1\|169066_169537_-\|DUF2269-domain-containing-protein	gnl\|CDD\|370783	pfam10027, DUF2269, Predicted integral membrane protein (DUF2269). Members of this family of bacterial hypothetical integral membrane proteins have no known function.	9.59768e-58
NZ_CP011918.1\|WP_006488807.1\|175288_175819_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	7.25287e-11
NZ_CP011918.1\|WP_058902396.1\|165911_166535_-\|glutathione-S-transferase	gnl\|CDD\|198289	cd03180, GST_C_2, C-terminal, alpha helical domain of an unknown subfamily 2 of Glutathione S-transferases. Glutathione S-transferase (GST) C-terminal domain family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.	1.0464e-46
NZ_CP011918.1\|WP_058902401.1\|176021_176387_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|223713	COG0640, ArsR, Predicted transcriptional regulators [Transcription].	1.12196e-13
NZ_CP011918.1\|WP_058902399.1\|169533_170853_-\|SDR-family-oxidoreductase	gnl\|CDD\|187579	cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, subunit 9, 39 kDa, (NDUFA9) -like, atypical (a) SDRs. This subgroup of extended SDR-like proteins are atypical SDRs. They have a glycine-rich NAD(P)-binding motif similar to the typical SDRs, GXXGXXG, and have the YXXXK active site motif (though not the other residues of the SDR tetrad). Members identified include NDUFA9 (mitochondrial) and putative nucleoside-diphosphate-sugar epimerase. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	4.57612e-51
NZ_CP011918.1\|WP_058902397.1\|166607_168107_-\|TIGR01777-family-protein	gnl\|CDD\|224015	COG1090, COG1090, Predicted nucleoside-diphosphate sugar epimerase [General function prediction only].	3.10976e-103
NZ_CP011918.1\|WP_006496193.1\|179962_181255_-\|CoA-transferase	gnl\|CDD\|224717	COG1804, CaiB, Predicted acyl-CoA transferases/carnitine dehydratase [Energy production and conversion].	2.94897e-125
NZ_CP011918.1\|WP_043205262.1\|172905_173610_-\|SDR-family-oxidoreductase	gnl\|CDD\|181335	PRK08264, PRK08264, SDR family oxidoreductase.	1.55373e-117
NZ_CP011918.1\|WP_058902404.1\|178572_179880_-\|MFS-transporter	gnl\|CDD\|131385	TIGR02332, putative_4-hydroxyphenylacetate_permease, 4-hydroxyphenylacetate permease. This protein is a part of the Major Facilitator Superfamily (pfam07690). Member of this family are found in a number of proteobacterial genomes, but only in the context of having genes for 4-hydroxyphenylacetate (4-HPA) degradation. The protein is characterized by Prieto, et al. ( as 4-hydroxyphenylacetate permease in E. coli, where 3-HPA and 3,4-dihydroxyphenylacetate are shown to competitively inhibit 4-HPA transport and therefore also interact specificially.	1.52065e-86
NZ_CP011918.1\|WP_058902405.1\|181251_182238_-\|hydroxymethylglutaryl-CoA-lyase	gnl\|CDD\|163676	cd07938, DRE_TIM_HMGL, 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain. 3-hydroxy-3-methylglutaryl-CoA lyase (HMGL) catalyzes the cleavage of HMG-CoA to acetyl-CoA and acetoacetate, one of the terminal steps in ketone body generation and leucine degradation, and is a key enzyme in the pathway that supplies metabolic fuel to extrahepatic tissues. Mutations in HMGL cause a human autosomal recessive disorder called primary metabolic aciduria that affects ketogenesis and leucine catabolism and can be fatal due to an inability to tolerate hypoglycemia. HMGL has a TIM barrel domain with a catalytic center containing a divalent cation-binding site formed by a cluster of invariant residues that cap the core of the barrel. The cleavage of HMG-CoA requires the presence of a divalent cation like Mg2+ or Mn2+, and the reaction is thought to involve general acid/base catalysis. This family belongs to the DRE-TIM metallolyase superfamily. DRE-TIM metallolyases include 2-isopropylmalate synthase (IPMS), alpha-isopropylmalate synthase (LeuA), 3-hydroxy-3-methylglutaryl-CoA lyase, homocitrate synthase, citramalate synthase, 4-hydroxy-2-oxovalerate aldolase, re-citrate synthase, transcarboxylase 5S, pyruvate carboxylase, AksA, and FrbC. These members all share a conserved triose-phosphate isomerase (TIM) barrel domain consisting of a core beta(8)-alpha(8) motif with the eight parallel beta strands forming an enclosed barrel surrounded by eight alpha helices. The domain has a catalytic center containing a divalent cation-binding site formed by a cluster of invariant residues that cap the core of the barrel. In addition, the catalytic site includes three invariant residues - an aspartate (D), an arginine (R), and a glutamate (E) - which is the basis for the domain name "DRE-TIM".	9.98599e-131
NZ_CP011918.1\|WP_058902395.1\|164411_165833_+\|serine-hydrolase	gnl\|CDD\|224594	COG1680, AmpC, Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms].	5.15245e-38
NZ_CP011918.1\|WP_058903545.1\|176963_177440_+\|SRPBCC-family-protein	gnl\|CDD\|176904	cd08895, SRPBCC_CalC_Aha1-like_2, Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins. SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of a functionally uncharacterized subgroup of CalC- and Aha1-like proteins. This group shows similarity to the SRPBCC domains of Micromonospora echinospora CalC (a protein which confers resistance to enediynes) and human Aha1 (one of several co-chaperones which regulate the dimeric chaperone Hsp90), and belongs to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands.	2.63894e-72
NZ_CP011918.1\|WP_006496201.1\|173923_174508_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|182632	PRK10668, PRK10668, DNA-binding transcriptional repressor AcrR; Provisional.	9.3309e-11

>NZ_CP011918.1|WP_043205262.1|172905_173610_-|SDR-family-oxidoreductase
MKIEGAVVFVTGANRGLGLEFAKQALARGARKVYAAARDPATVTLPGVVPVKLDVTDPAAVAAAADAARDVTLLINNAGIARLGSLTDDGAPDALRDHFETNVFGMLAMSRAFAGTLAAHGGGAILNILSVASWVNRPILSGYGVSKSAAWALTNGLRHSLREQRTQVVGLHAGFIDTDLTAGLDVPKATPADVVRQAYDAIEAGAEEVSTDEFTRQVKATLSSGVYLEEPAPR
>NZ_CP011918.1|WP_006483953.1|171642_172845_+|trans-2-enoyl-CoA-reductase-family-protein
MIIKPRVRGFICVTTHPVGCEANVKEQIDYVTSHGPIANGPKKVLVIGASTGYGLAARISAAFGSGADTLGVFFERAGSETKPGTAGWYNSAAFEKFATEKGLYARSINGDAFSDKVKQVTIDTIKQDLGKVDLVVYSLAAPRRTHPKTGETISSTLKPVGKAVTFRGLDTDKEVIREVSLEPATQEEIDGTVAVMGGEDWQMWIDALADAGVLADGAKTTAFTYLGEQITHDIYWNGSIGEAKKDLDKKVLSIRDKLAAHGGDARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEKGTHEGCIEQVYGLLKDSLYGATPHVDEEGRLRADYKELDPQVQNQVVAMWDKVTNENLYEMTDFAGYKTEFLRLFGFEIAGVDYDADVNPDVKIPGIIDTTV
>NZ_CP011918.1|WP_006480371.1|170941_171475_-|MarR-family-transcriptional-regulator
MELTPIAERFILHWGEMGSRWGVNRTVSQIHALLYLAGRPVAADEIAETLNVARSNVSTSLKELQAWRLAKVVHVLGDRRDHFETSTDIWELFKLIVEGRRQREIEPTLTVLRDCLTNPEIANESRETEQRIRDTLQFVETLTTWSDEMLRLKPDTLMKALGIGAKISQTVRRKPSK
>NZ_CP011918.1|WP_058902399.1|169533_170853_-|SDR-family-oxidoreductase
MNAALPSTCQPERTGAPGMTVLVCGANGFVGRALCAQLEAGGHRVLRGVRHAAGPYDVAIDFARDVDPQAWLARLNGVDVVINAVGMLADRRGATLDAVHRAAPCALFTACCRAGVRRVIQISALGVERGDTRYFASKHAADRFLQTLPIDFRIVRPALVYGAAGASARFFRMLASLPVHGLPAGGHQRLRPVHVDDLAEVVARLVALAGDSPATGSRVIDVVGGDEVEYREMLAGYRAALGFPPAACVTLPGALVGAAAALFGAWPGAMLTRDTWTMLRAGNTGDPAATAAVLGRPPRGIGSFIGADAATLRRDALAMWRRPLLLGALAIVWIWTAIASAFIHPLHASLALLAPAHVTGLPALIALYAASTLDFAFGIATVVAPSRRLWVAQAALIVAYSAVIAVTMPGLLAEPFGPVLKNVPILAILLILFSEEEHA
>NZ_CP011918.1|WP_006485758.1|169066_169537_-|DUF2269-domain-containing-protein
MNTYLVVKALHILSSVLLVGTGFGTAFYLFFANRTRSVPAIAAVSRLVVRADWWFTTPAVIFQPASGLWLAHTAGWPWHAPWLLASIVLYAVAGACWLPVVWLQLELASMAKLAHANGDAALPERYWRYAKRWERLGYPAFFAMLTVYFLMVVKPM
>NZ_CP011918.1|WP_058902398.1|168103_168973_-|DUF393-domain-containing-protein
MGSSELVLYFDGRCPLCVAEIRRLGARDTRHRLAFVDIAGPGFDPAPLGVDLPALNRELHARLPDGRMLTGIDSIVAAYALVGRRGRVWLLRMPAMRAGFALLYRRLARNRHAVSHWLGYRSQACSEGGACSIGRDSDSAAANRPPRDTPRRIVVSWMYAAALVHLLVGVVMPWIAGASWLDAYHREIERHFWTGTAPEAARVQQVWWLSLIAATVQCAAVWMLALVHLGNRLRKREAWGWLLAGLLIWAPQDMLLSWQAQVWGHVAIDVAALVAMVPPLAWLWRRDTA
>NZ_CP011918.1|WP_058902397.1|166607_168107_-|TIGR01777-family-protein
MNTLPAFDWALNLLIVQGAMGAFDTLYHHELTQDLPHRPRARLELAIHAVRSVLYGLVFASIANVAFHGAWVAAVAAVVLVEVGLTLWDFVVEDRSRKLPATERVLHTLLAVNGGALFGMVAMQLSAWAHEPTALQPIDPGWRGWLLSLFAVGVTVSGVRDGIAACRVAPRAPAANPFAGQRPGNVLVTGGTGFIGETLVNQLLDAGHTVTLLARDPLRAAYLFQGRVRSVTSVEQLQPHARFDTVINLAGAPVLGARWSKRRQLLLLASRVGVTQALMRWVETAEAKPRTWIQASAIGYYGVRPGDERLDERSGAGTGFMSALCRQWEAAAAPLARHGVRAVVLRLGVVFGPGGALRPMLLPHYFGLGGRFGDGAQVLSWIHRDDVLRIVARAMSQAGMHGVYNAVAPVPLTQRAFVQIVSKVLRRRAWLHVPAAPLRAAMGEMAELLLDGQRVVPARLHQDGFMFRFPTAEHALRDLTNRPHTDFAHAACRFPRGRV
>NZ_CP011918.1|WP_058902396.1|165911_166535_-|glutathione-S-transferase
MLRILGKIPSINVRKVLWLCTELNLPFEQEDWGAGFRTTHDPAYLALNPNALVPVIKDDDFVLWESNTIIRYLANRYGGDALYPAEPQARARVDQWIDWQGADLNRSWVGAFLGLVRKSPDHQDPDGIAQSIAGWTKHMHVLNVQLDKTGAYVAGNTFTLADIPIGLSVNRWFGTPFEHPELPAVSRYIERLATREGFKQYGGSANP
>NZ_CP011918.1|WP_058902395.1|164411_165833_+|serine-hydrolase
MTIPLKKLMLRGVALALVAAIGYAAYMLYRLAPIATGYAAKALCSGVFVSGRPAAPVIDVDIMAGVHPLLKLVRPSLDPDHHRAVATFAGFAEREADFRPGLGCTLAVGSPTGAAAATLPAGLPPLPDPAPAQPDPPAPATPPAGIDAHLLQTAIDRAFDEPDPARPRRTRAVVVMWRGQVIAERYAPGFTADTPLPGWSMTKTVTAALVGTLVAQHKLSPDASALLPEWRGSGDPRAAITLDELLRMTSGLQFNEDYDDPLSDVAVMLFTQPDTARFASAKPLVATPGTQWSYSSGTSAIVARVMREALGGNAGDYLALPRRALFAPLGMRSAVFEPDASGTLVSASYMYASARDWARFGQLLLQDGVWNGQRLLPEGWVRYLTRATPQSSRQEFGAQLWVKVPEPFNDRDPHARAMPADAFHAVGHEGQFVSVVPSRQLVVVRLGLSRPEAAWNHEAFLARVLDAVPAPGA
>NZ_CP011918.1|WP_006485763.1|163749_164169_-|HIT-family-protein
MSYDNNNPFAKILRGELPCVKVAEDDATLAIMDLMPQADGHVLVIPKEPAAQIFELSGDAAAAGIRMTQRVAAAVRAALEPDGVFIGQFNGAAAGQTVPHVHFHVIPRWEGAELRMHARDVADAATLEALAQRIRARFV
>NZ_CP011918.1|WP_006496201.1|173923_174508_+|TetR/AcrR-family-transcriptional-regulator
MGVSRQQAAENRSAIVAAAERLFRVRGVDAVGLTELMKEAGFTQGGFYNHFKSKDALVAEVMEKAMHDRADSPNAGSLDAQVAAYLSPAHRDNLEAGCPLSGFAGDAPRLTETARACYAHGLAAYLDRLERMVATDGATSEHTRRDALAVFSQMVGALVLSRAIAGSDPALADEILDAGRDALTGRRGDPVTSA
>NZ_CP011918.1|WP_058902400.1|174547_175126_-|hypothetical-protein
MKRSHVAFALTGLLVALPIAAYALVKPLRVIVPALVPGVSCPRADICTDDAAKLGAAQQLYRDGAARAAAAVGGFRAVPRIVFCATRACADAFGLGTRAALTLGDFGIVIAPRGWQTYFLAHELIHHRQAEVLGNLAVVTKPRWLIEGMAYSLSDDPRHPLAQPFEAWRTQFAAWNAARGAQPLWDAARAIE
>NZ_CP011918.1|WP_006488807.1|175288_175819_-|GNAT-family-N-acetyltransferase
MTEPVTVRRVGASEAMACVDALADVLIDCVEGGASVSFMLPIARSTAVAFWTRVADGVANDERILLVAEDASGRIVGTVQVVTAQPENQPHRADISKMLVSRHARRQGIAARLMAAADAAARDAGKTVLVLDTVTGGDAERLYERAGWQRVGVVPNYALMPDGALCATTVFHKQLA
>NZ_CP011918.1|WP_058902401.1|176021_176387_+|helix-turn-helix-transcriptional-regulator
MDNFQPGISDVFHALADPTRCAIVSALGQGERTVSALAAPFDMALPSFMKHVAVLERSGLVETRKTGRSRTCALVGSRLTEAEAWLAAQRAQWEARSDRLVEFVERRHQEEQDASQPRRTR
>NZ_CP011918.1|WP_058902402.1|176358_176844_+|SRPBCC-family-protein
MPASHVEPAEAHDLVITRTLRAPRQALWRAWTDPDLLKEWWCPKPWTTEVRAFDLRPGGAFHTFMRGPDGGTSDNPGCFLEIVPESRIAFTSMLTGGWRPQEPWMGFTAIITMADDDAGSRYEARVMHPDAATRERHEALGFFEGWNTCITQLDAFAATLR
>NZ_CP011918.1|WP_058903545.1|176963_177440_+|SRPBCC-family-protein
MLHMHTHSTRVSRHLNAPRGRVYRALLDPHAVEQWKVPDGMTCRVHAYDAREGGALRVSLSYDAPAAGTGKTTAHTDTYHGRFVTLVPDQQIVEIDVFETDDPLLRGAMTITITLSDEAGGTRVDAVHDGVPPGVPAADNETGWQMALARLAALVEAG
>NZ_CP011918.1|WP_058902403.1|177455_178571_-|amidohydrolase-family-protein
MTFSIKRRRLIGAAAASLALPAFADTPAPDGASRMTQSNYLAVRPDWLASALEPALEPDLPIVDAHHHFYERPGWIYLLDDYLQDARSGHNIQASVYMQAQTRYRDAGPAELKPVGETAYVAGVTEPLQHGPVAVAKGIVGHADLRLGERVRDVLEAHLEAGRGRFRGVRHLSTWDADPTLANPLSAVPRGLLLDPAYRAGVAQLAPLGLSYDAWLFFPQLPELFELAKANPDTRIIVNHCGGVVRIGSYADKRPEVFARWPASMRTLAQLPNVYVKVGGLGMRINGFDFEKGAKPPSSAQLADAWKPWMMTCIDAFGPGRCMFESNFPVDKGSYSFVNGWNAFKRLTAQAGADERDALFRGTVTHAYRLG
>NZ_CP011918.1|WP_058902404.1|178572_179880_-|MFS-transporter
MTSASPALAADRETDASIEQRAVRKAAWRFIPLLALAYFFNYLDRTSVGFAALTMNRDLGLTATQFGWGAGIMFAGYCVFEVPSNLALYRFGARRWLARIMITWGLMAAATALATGPTSFYAIRLLLGIGEAGFFPGVIFFLAVWFPASYRTRVLAWFTVSTPLSSLIGGPLSTWLLQLDGALGLAGWKWMFIVEGLPACALGFLVLKLLSDSPEHATWLSDDERAALQRAFARDGAAAGRKKRFGVALRDVRVYVLALISFGFTMGSYGIGIWLPQMLKAHGMSTMQTGWLSAVPYFFATVALLWWAKRVDRRGGPVANLAIGLCIGAVALGVSTHFLTLGPALVGITLALIGTIAGRTIFYTLPSRFLSGQAAAGGLALINSIGALGGFAGPYLVGYLKDSFGTFTAGMLGLAIVLAITTLLTLSLYAFDRSE
>NZ_CP011918.1|WP_006496193.1|179962_181255_-|CoA-transferase
MNDRQQAAALPYAGVRVIEMTHMVMGPTCGMLLADLGAEVIKIEPIAGDSTRALRGSGAGFFGMFNRNKKSLAVDVKDPRGLEIVRRLVATADVFSENFKSGTMDRLGLGYAALDALNPRLVYVSHKGFLPGPYEHRTALDEVVQMMGGLAYMTGPEGRPLRAGASVNDIMGGMFGAIGAMAALAQRERTGRGQQVQSSLFENNVFLVAQHMMQFAVTGQAAAPMPSRISAWAVYDVFSVKDDEQIFLAVVSDTQWALFCDAFGLTALKDDPRLATNNLRVQAREWLLPELRSRLAPYSAAEIGAIFESTGLPYAPITKPQDLFDDPHLLATGGLEAVTLPADASSAGRPVDTRTALLPLTLAGERLRLRSAPPALGQDTCALLGELGYTPDDARALIDAGVVAGQYGAAAAAHGDAPGGAPSANEVASA
>NZ_CP011918.1|WP_058902405.1|181251_182238_-|hydroxymethylglutaryl-CoA-lyase
MKLSEHPKVLVSEVGPRDGLQSIEAVMPTAAKLRWITALAAAGLREIEVGSFVPARLLPQMADVREVVAHALAIPGLHVAALAPNLRGAEGAFDAGVHKLTLPVSVTEAHSLANIRKTPAQMIDEVRAIVALRDARFPSVQIEAGVSVAFGCTIAGTVSDDETIAMAVAMAECGVDEIGLSDTSGYANPAQVRRLFTRLQREVGDKAGGAHFHNTRGQGLANVVAALDAGVTTIDASQGGLGGCPYAPGATGNIVTEDLVFLLEAMGYDTGVDVDALLAARAILHAALPSEALYGHVPDAGLPKGFRYADGRAAVAPQPEGCVAGVAR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

27356 : 63988

Wolbachia_phage(33.33%)

transposase,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006494258.1\|27356_28082_-\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_058902332.1\|28078_28945_-	DUF2167 domain-containing protein	NA	NA	NA	NA
WP_058902333.1\|29141_29990_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_034203259.1\|30022_30649_-	LysE family translocator	NA	NA	NA	NA
WP_006494255.1\|30817_31282_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_058902334.1\|31278_32649_-	dihydroorotase	NA	NA	NA	NA
WP_006491343.1\|32652_33213_-	carbonate dehydratase	NA	NA	NA	NA
WP_058902335.1\|33212_33791_-	6-carboxytetrahydropterin synthase	NA	NA	NA	NA
WP_006491344.1\|33784_34705_-	GTP cyclohydrolase I FolE2	NA	NA	NA	NA
WP_048985318.1\|34765_36037_-	GTP-binding protein	NA	NA	NA	NA
WP_105848287.1\|36140_37325_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_058902337.1\|37348_38191_-	hypothetical protein	NA	NA	NA	NA
WP_006491339.1\|38242_38899_-	ABC transporter permease	NA	NA	NA	NA
WP_012493575.1\|38891_40076_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	2.3e-30	35.7
WP_006493142.1\|40094_41507_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_058902338.1\|41517_42348_-	methionine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_006481998.1\|42782_44147_+	2-hydroxycarboxylate transporter family protein	NA	NA	NA	NA
WP_006494245.1\|44267_46172_+	sensor histidine kinase	NA	NA	NA	NA
WP_058902339.1\|46161_47523_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_006484473.1\|47548_47878_+	DUF3579 domain-containing protein	NA	NA	NA	NA
WP_006484487.1\|48116_48968_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_006484477.1\|49079_49520_-	PACE efflux transporter	NA	NA	NA	NA
WP_058902288.1\|49631_50576_-\|transposase	IS110 family transposase	Q75QL1	Wolbachia_phage	1.5e-24	32.7
WP_058902340.1\|50798_51689_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_058902341.1\|51753_52182_-	hypothetical protein	NA	NA	NA	NA
WP_058902342.1\|52309_52906_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_058902343.1\|52996_53410_-	hypothetical protein	NA	NA	NA	NA
WP_058902344.1\|53674_54133_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_105773736.1\|54084_55263_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.2e-42	42.7
WP_058902345.1\|55613_55937_-	hypothetical protein	NA	NA	NA	NA
WP_143272477.1\|55933_56533_-	hypothetical protein	NA	NA	NA	NA
WP_058902346.1\|56507_57512_-	hypothetical protein	NA	NA	NA	NA
WP_105848424.1\|58233_59395_+\|transposase	IS3 family transposase	Q716C2	Shigella_phage	9.5e-85	53.2
WP_095423477.1\|61479_62297_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	1.9e-07	35.9
WP_154641174.1\|62584_62749_-	hypothetical protein	NA	NA	NA	NA
WP_006476181.1\|63022_63988_+\|transposase	IS110-like element ISBcen8 family transposase	Q75QL1	Wolbachia_phage	1.3e-23	34.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP011920

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP011920_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011920_1

31504-31643

Orphan

Consensus_repeat	Method
ATCTTGGCTCGAGCCAAGAC	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP011920_1

>merge|NZ_CP011920|1|31504-31643|PILER-CR
ATCTTGGCTCGAGCCAACTCGTGGGCATCTTGTGAGACTCCCTATGGAAACCCGTCTTGGCTCGAGCCAAGACCGTTTAGAACCGAGGTTCATATGTGACCATTCAACATCGGATCTGCGATCTTGGCTCGGGCCAAGCC

>NZ_CP011920|1|1|31504-31643|PILER-CR
ATCTTGGCTCGAGCCAACTC	GTGGGCATCTTGTGAGACTCCCTATGGAAACCC
GTCTTGGCTCGAGCCAAGAC	CGTTTAGAACCGAGGTTCATATGTGACCATTCAACATCGGATCTGCG
ATCTTGGCTCGGGCCAAGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011920.1\|WP_058904011.1\|27509_28208_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378250
NZ_CP011920.1\|WP_058904010.1\|27276_27483_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011920.1\|WP_058904016.1\|31783_32455_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|349760
NZ_CP011920.1\|WP_058904009.1\|26743_27253_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011920.1\|WP_058904013.1\|28870_29218_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011920.1\|WP_105773736.1\|35773_36952_-\|IS256-family-transposase	unknown	unknown	gnl\|CDD\|307151
NZ_CP011920.1\|WP_058904019.1\|37386_40536_-\|error-prone-DNA-polymerase	unknown	unknown	gnl\|CDD\|235553
NZ_CP011920.1\|WP_058904020.1\|43225_43942_-\|translesion-DNA-synthesis-associated-protein-ImuA	unknown	unknown	gnl\|CDD\|380271
NZ_CP011920.1\|WP_058904017.1\|32454_33420_+\|ParB/RepB/Spo0J-family-partition-protein	unknown	unknown	gnl\|CDD\|272946
NZ_CP011920.1\|WP_058904014.1\|29529_29940_-\|type-II-toxin-antitoxin-system-VapC-family-toxin	unknown	unknown	gnl\|CDD\|350315
NZ_CP011920.1\|WP_058904015.1\|30296_31328_-\|DNA-polymerase	unknown	unknown	gnl\|CDD\|235658
NZ_CP011920.1\|WP_143272455.1\|41144_42343_+\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP011920.1\|WP_058904128.1\|49630_49894_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|367559
NZ_CP011920.1\|WP_058904008.1\|26116_26458_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011920.1\|WP_058904127.1\|29936_30179_-\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|226863
NZ_CP011920.1\|WP_058904007.1\|25003_26089_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011920.1\|WP_058904021.1\|44015_44927_-\|DUF159-family-protein	unknown	unknown	gnl\|CDD\|376837
NZ_CP011920.1\|WP_058904022.1\|45161_48146_-\|Tn3-family-transposase	unknown	unknown	gnl\|CDD\|376561
NZ_CP011920.1\|WP_058904018.1\|34164_35022_+\|TrfA-family-protein	unknown	unknown	gnl\|CDD\|115680
NZ_CP011920.1\|WP_058904012.1\|28393_28723_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP011920.1\|WP_058904011.1\|27509_28208_-\|hypothetical-protein	gnl\|CDD\|378250	pfam09723, Zn-ribbon_8, Zinc ribbon domain. This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.	7.71098e-06
NZ_CP011920.1\|WP_058904022.1\|45161_48146_-\|Tn3-family-transposase	gnl\|CDD\|376561	pfam01526, DDE_Tnp_Tn3, Tn3 transposase DDE domain. This family includes transposases of Tn3, Tn21, Tn1721, Tn2501, Tn3926 transposons from E-coli. The specific binding of the Tn3 transposase to DNA has been demonstrated. Sequence analysis has suggested that the invariant triad of Asp689, Asp765, Glu895 (numbering as in Tn3) may correspond to the D-D-35-E motif previously implicated in the catalysis of numerous transposases.	0
NZ_CP011920.1\|WP_058904016.1\|31783_32455_+\|AAA-family-ATPase	gnl\|CDD\|349760	cd02042, ParAB_family, partition proteins ParAB family. ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in Rhizobium etli symbiotic plasmid. This operon is involved in the plasmid replication and partition.	3.35762e-26
NZ_CP011920.1\|WP_105773736.1\|35773_36952_-\|IS256-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	2.12268e-130
NZ_CP011920.1\|WP_058904019.1\|37386_40536_-\|error-prone-DNA-polymerase	gnl\|CDD\|235553	PRK05672, dnaE2, error-prone DNA polymerase; Validated.	0
NZ_CP011920.1\|WP_058904020.1\|43225_43942_-\|translesion-DNA-synthesis-associated-protein-ImuA	gnl\|CDD\|380271	NF033429, ImuA_translesion, translesion DNA synthesis-associated protein ImuA. A three-gene cassette encoding ImuA, ImuB, and ImuC (""inducible mutagenesis"") is induced by DNA damage, is capable of DNA synthesis across DNA damage lesions, and consequently is associated with mutagenesis. This family, ImuA (previously misnamed SulA in Pseudomonas putida) shows some homology to SulA itself and to RecA. ImuB resembles Y-family polymerases but may be catalytically inactive. ImuC is a C-family polymerase, and catalytically active.	4.02536e-80
NZ_CP011920.1\|WP_058904017.1\|32454_33420_+\|ParB/RepB/Spo0J-family-partition-protein	gnl\|CDD\|272946	TIGR00180, Probable_chromosome-partitioning_protein_ParB, ParB/RepB/Spo0J family partition protein. This model represents the most well-conserved core of a set of chromosomal and plasmid partition proteins related to ParB, including Spo0J, RepB, and SopB. Spo0J has been shown to bind a specific DNA sequence that, when introduced into a plasmid, can serve as partition site. Study of RepB, which has nicking-closing activity, suggests that it forms a transient protein-DNA covalent intermediate during the strand transfer reaction.	7.53556e-18
NZ_CP011920.1\|WP_058904014.1\|29529_29940_-\|type-II-toxin-antitoxin-system-VapC-family-toxin	gnl\|CDD\|350315	cd18748, PIN_VapC4-5_FitB-like, uncharacterized subgroup of the PIN_VapC4-5_FitB-like subfamily of the PIN domain superfamily. The PIN_VapC4-5_FitB-like subfamily includes the Virulence associated protein C (VapC)-like PIN (PilT N terminus) domain of Mycobacterium tuberculosis VapC4 and VapC5 ribonuclease toxins of the VapBC toxin/antitoxin (TA) system, and Neisseria gonorrhoeae FitB toxin of the FitAB TA system. This subfamily belongs to the VapC-like family of the PIN domain nuclease superfamily. VapC is the PIN-domain ribonuclease toxin from prokaryotic VapBC toxin-antitoxin (TA) systems. VapB is a transcription factor-like protein antitoxin acting as an inhibitor. Other members of the VapC-like nuclease family include eukaryotic ribonucleases such as Smg6, ribosome assembly factor NOB1, exosome subunit Rrp44 endoribonuclease and rRNA-processing protein Fcf1. The structural properties of the PIN (PilT N terminus) domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions, in some members, additional metal coordinating residues can be found. Some members of the superfamily lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	4.29347e-69
NZ_CP011920.1\|WP_058904015.1\|30296_31328_-\|DNA-polymerase	gnl\|CDD\|235658	PRK05972, ligD, ATP-dependent DNA ligase; Reviewed.	2.4237e-132
NZ_CP011920.1\|WP_143272455.1\|41144_42343_+\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	5.70728e-63
NZ_CP011920.1\|WP_058904128.1\|49630_49894_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|367559	pfam03551, PadR, Transcriptional regulator PadR-like family. Members of this family are transcriptional regulators that appear to be related to the pfam01047 family. This family includes PadR, a protein that is involved in negative regulation of phenolic acid metabolism.	8.47399e-15
NZ_CP011920.1\|WP_058904127.1\|29936_30179_-\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	gnl\|CDD\|226863	COG4456, VagC, Virulence-associated protein and related proteins [Function unknown].	6.86205e-17
NZ_CP011920.1\|WP_058904021.1\|44015_44927_-\|DUF159-family-protein	gnl\|CDD\|376837	pfam02586, SRAP, SOS response associated peptidase (SRAP). The SRAP family functions as a DNA-associated autoproteolytic switch that recruits diverse repair enzymes onto DNA damage. We propose that the human protein Q96FZ2:UniProtKB, the eukaryotic member of the SRAP family, which has been recently shown to bind specifically to DNA with 5-hydroxymethylcytosine, 5-formylcytosine and 5-carboxycytosine, is a sensor for these oxidized bases generated by the TET (tetrahedral aminopeptidase of the M42 family) enzymes from methylcytosine. Hence, its autoproteolytic activity might help it act as a switch that recruits DNA repair enzymes to remove these oxidized methylcytosine species as part of the DNA demethylation pathway downstream of the TET enzymes.	2.24112e-12
NZ_CP011920.1\|WP_058904018.1\|34164_35022_+\|TrfA-family-protein	gnl\|CDD\|115680	pfam07042, TrfA, TrfA protein. This family consists of several bacterial TrfA proteins. The trfA operon of broad-host-range IncP plasmids is essential to activate the origin of vegetative replication in diverse species. The trfA operon encodes two ORFs. The first ORF is highly conserved and encodes a putative single-stranded DNA binding protein (Ssb). The second, trfA, contains two translational starts as in the IncP alpha plasmids, generating related polypeptides of 406 (TrfA1) and 282 (TrfA2) amino acids. TrfA2 is very similar to the IncP alpha product, whereas the N-terminal region of TrfA1 shows very little similarity to the equivalent region of IncP alpha TrfA1. This region has been implicated in the ability of IncP alpha plasmids to replicate efficiently in Pseudomonas aeruginosa.	2.08346e-33

>NZ_CP011920.1|WP_058904015.1|30296_31328_-|DNA-polymerase
MGRWTSERGIRARTPVARNRRMPEFIEPSLGVLAAEPPTSGEWGYEIKFDGYRMLARIDAGDVRIFTRNGHDWTARLPHLRSALERLPVNGAWLDAEAVWFDTEGRPNFNGLQNAFDRRRTAGISLVVFDLMWLNNNDLRPWTWRERRATLTKLEAEILGNEGRFSEAIDAHPDAMLASACALGLEGIMGKRVDAPYRSGRSDRWIRLKCSKRQEFVIGGFSRCKGATAGVRAVLLGVYEEGGQLRYVGHVAPRFAPRQARVFEDRLASLGRRRSPFVRAPEPDADREFHWLKPEFVAEVAFLEWTPTGQLRHPSFRGLRADKPARSVSREHPLEPKRARNSK
>NZ_CP011920.1|WP_058904127.1|29936_30179_-|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein
MPTHDTRHARLFRNGRSQAVRIPREFELPVSEVTIHREGRRLIIEPVEAAPLRELFAQWTPLDETFPDIEDLPAEPVDIE
>NZ_CP011920.1|WP_058904014.1|29529_29940_-|type-II-toxin-antitoxin-system-VapC-family-toxin
MTLYLLDTNILSNVIRDPRGACAARIGETPPEQVCTSIIVAAELRFGVWKRGSSALAQRVEQLLASLTVLPLQPDADRCYGRLRAELEKQGQLIGANDMLIAAHALAVDAVLVTDNTAEFTRVAGLPVENWLRSAT
>NZ_CP011920.1|WP_058904013.1|28870_29218_-|hypothetical-protein
MTAVQQMFLEWCIGYMKFRIADAMSVGLMSLEAERYDALWTMLQKGRYGFLDDDMIEIGRRLFPDAPNAPDGSGLDAAYERVCTALDDWLPSFIIPPGQISFLPDPEPPDDEPAA
>NZ_CP011920.1|WP_058904012.1|28393_28723_-|hypothetical-protein
MEGEMPLNKDYLQGAYDAFVNSAIQRVARSGDQVYHFNIPANELKDAFGLERLRDETVTEVRNFFARKGVDADYEQGEGFDITLDLNRASLKPANARDLAIALEIESAR
>NZ_CP011920.1|WP_058904011.1|27509_28208_-|hypothetical-protein
MSVLYVYRCPGCGHRGETRRPDDTHDGEGMACPQCGAIAALEWDGGVTLDGLPSGFAGDPLGPHPADAAPAPTAAAFKALRVRGRRTQAQAAALLGVLPRQVQRWEAGEAPIPATAWPLLRRAWGYRYPSDFAPAPGPMTRGCDALRDRPRDTIERGDVVELQPVDGPRLRATVCLDRVHDGLADEESYGAYVTEFVGAADVGDEYRGFFIPERVTFARSNVIHLEQRAPRR
>NZ_CP011920.1|WP_058904010.1|27276_27483_-|hypothetical-protein
MKTAYDLLLDAPDDQVTRCRLAWKAVAAGDWQDAAHFLRNAAEEAGATPWATDARALAEACAAKVASA
>NZ_CP011920.1|WP_058904009.1|26743_27253_-|hypothetical-protein
MNAKTEAIAIADAQLSRAGLYTHSGVLNELRSVLEAVKAGVPETVGYGEIGKPAFAHGWTAAMEHVYGELAAARALLREVDGADRASGEPSTDVDTGLPRDPRAVSAATSGEALHTRLRSALPADYPDSWDVLAPRYQAAFEAAAKGESAQRHGVQKPQDSRGDSVSGK
>NZ_CP011920.1|WP_058904008.1|26116_26458_-|hypothetical-protein
MTEIIKTYDELSDSQLADAQRLFPGTSSDVPFRYVIVAGKVHHRIGATKPIAVRIVDDSGPHFLRTDQVVGITPRTKWGKKGVEVLLRAGAEREPHTLWLAVDPDYVARQIGW
>NZ_CP011920.1|WP_058904007.1|25003_26089_-|hypothetical-protein
MRKEYELQTDVLATVVAATPVTSKHAALLTTFATRTDYRGARYAVTRDEFSERPARVIDADGREIAADYHAWIDAQLDAHGGSVEDVLLAHRDSGYQLVDVPPLLHYFVFDRGGDQDNFVQLEIWEEQEFVEREVFPRSTPWRVPDVHELRSGWHDMPVARFERRTLGSPRYRLEAVIDVKHFAALAETTYNERRQRDGDRELVERNLDTGESRVASVRELTPGYDNQQWRGRRFFDDWAASSAGQAGERVCQRWVFSTEDYTDPRTGRAMDFIPRWTHTRKIAALKNTAKLDVYSLYGKLMQFDERIGHRFAWYFYGLHGNLILSGQMERVLEAAEAGLIVLPEHDCRVLRRWGDDQYGF
>NZ_CP011920.1|WP_058904016.1|31783_32455_+|AAA-family-ATPase
MVITVGAEKGGVGKTRLATHIAALAATNDVDVVLLDTDKQGSAMSWSRIRNEEGVTPAIPVLALPANPARELANLANKYTLVVVDIGAQNYRTMLECALLSDLVLVPCGPDQQEVESTLNVFATLKDMGPRHESGEIPAYVVLTRVSPVEGSKATAELRAYLKSEDIRLFDSQIPQREAWRATGKTGRAVHELKGRDRSKKALDEMEAVYREIIERINGAEVK
>NZ_CP011920.1|WP_058904017.1|32454_33420_+|ParB/RepB/Spo0J-family-partition-protein
MATFKKKAVAVERVAAVEDAASLAPIVGDPRMAPPAATVSQLRGGEVGSSQEPARYEIGQTYEVPVGKIKSNSVNPRAIYTASSVSEMAESLAARGQGQSASAYQDEAGDLVLIDGERRLRGARTAGLPTLRLEIRPKPASERELYEEARAANVERKDQSPLDDAIKWKELLSRKIYPTQAALAKALKLGEDHVSRTLSLSQLPSKIVQAAAEYPELLSLKMLNAIREFWEVKGEDETLDLISEAAKSGMGYRDVAARRKAAAKGTVRRPRSTREQLTFRGAKGEFKSFEEDGRIELKLKGLAPDVAAEISEKILALFPKE
>NZ_CP011920.1|WP_058904018.1|34164_35022_+|TrfA-family-protein
MANSIVDQVKAIAARASSAGVETQSHPTQIPLWPANVRGMPNALARSALFNVNKSNAPRSRMEKALIASVDGVEISFSGEELRQDDADVFLEVLHLARDTQLNEKVEFTGYSLLKSLGWGTSVKCYDRLVTTLERLQAGQVKVRFTGNKKGFVGSLIRKFLWKEGTETGTDGKTRWVAYVEPEIVALFSDDDYTRLAREQRQRLRYELSKWLHTYYHTHAVPFAHSVRFLHRQCGSQTKELFHFRANLKKALDELVKEGFLVSWTIDKSDLVHVVRTSSRGAIAA
>NZ_CP011920.1|WP_105773736.1|35773_36952_-|IS256-family-transposase
MQSKDAESILGESGLAGQLKKQLAERMLAAELSHHLETEAEQGKAGNHRNGTSRKTVLTPNGELTLDIPRDRQATFEPQLVGKYQRRLPGFDDHVISMYARGMSVREIQGHLLELYGLQVSPDLISTVTDEVLADVEQWQQRPLEAMYPIVYFDALRLKIRDEGTVKNKAVYLALGIRADGRKEVLGLWIEQTEGAKFWLKVFNELKNRGLHDILIAVVDGLRGFPEAIEAVYPAAQIQTCIVHLIRNSLNLASWKDRKSLAAAIKPIYQAATAEAAAAALDAFAQSEWGRKFPTVAAMWQRQWEQVIPFFAYPPEVRRIVYTTNAIESMHMQLRKIVKNRGHFPSDEAASKLLFLALRNIEKDWKMPPITWRQAVNQFAILFGERFTAAIS
>NZ_CP011920.1|WP_058904019.1|37386_40536_-|error-prone-DNA-polymerase
MDAGSFGALPAYAELQVASDFSFLHGASRAEEYVARAAQLGYSAIAITDECSLAGVVRAHVEAKAANMQLIIGSHFRLTAADGSPALAFTALAMNRDGYGNLCEFISLGRMRSKKGTYRLAPLDLEHPEAPYTHLRSLPDCIAILSPDFPANEQRLDAQVEWFARVFGDRAWVALTLHARAMDDIHRGAVERVAARHGVPVVATSWPLMHVRSRKPLQDVLTGIRVGRPVTECGYELAPNAERHLRSRLRLANLYPAGALEETVRVARRCTFSLDDLKYEYPDEVVPAGHDPMTYLREQTYIGARERYPAGIPVDVQAQIEHELELIDELNYAPYFLTVYDIVQFARSNGILCQGRGSAANSAICFCLHITSVDPARSNLLFERFISRERNEEPDIDLDVANNRRDEIVQYLYRKYGRDRAALAAAVTTYRPRSALREAGKALGVDPAIVDRVAKQHHWFDSRADLLQRFAEAGLDPDAPLNQQWAGFAAQLLGYPRHLSQHPCGFVLSRGKLTRLVPIENAAMENRSCIQWDKDDLEALGLMKVDVLALGMLTALDRAFTMISEKRGETFELQDIPAEDKATYDMLCDGDSMGVFQVESRAQMSMLPRLRPQCFYDLVIEVAIVRPGPVQGGMVHPFLRRRQGLEPVTYPSPDIATALERTLGVPIFQEQVMQVAMLAAGFSAGEADQLRRAMAAWKRKGGLEPYHDRLVSGMLARGYDREFAEAIFAQIKGFGDYGFPESHAASFALLVYASAWLRRHEPAVFLTALLNSQPMGFYTPSQLLQDAKRRGVEVLPVDVTVSGWDSVIEGPTTSAPVRLGFSLLRGMRAEVAGRIELARSVRPFVDVADLARRAQLDRHDLQVLARANALRALAGGNRRDALWLAAAAAPDRDLLRGTERDDAAPALPQPSEGTEIVTDYRAMGFTLGRHPLALLRDSLARDHLQSAEQLATLRSGQLARACGLVTVRQRPGTANGVLFMTLEDETGTVNVILWPGLLEKFRKEALDAALLAVYGVWQAEGKVRHLIASKLVDRTELLGALPTTARQFC
>NZ_CP011920.1|WP_143272455.1|41144_42343_+|IS3-family-transposase
MEKSMAENAVPRRQYTKEFKVEAVRLAESAGQHEAARRLGVPVATLGNWCRGQRDGGAQATAGPAPAAPSSSRRPVSDLEAEVSRLRKELASAKLDIEILPKGNGVLREGVAVKYAWIDAHRDQYSVSRLCRVLAVSRSGYCQWWVRAPSVRAQAAEALDVEVAAIYRASRGSYGRPRIVRQLRAQGRPVSAERVRRSLQRQGLRPVYKRPYRVTTDSTHRLPVAPNLLDRRFDDWQPNQAWVSDITFVATDEGWVFLAAILDLASRRIVGWSMSERINADLVCQALRSAYWQRKPGLGLLLHSDRGSQYASWGYRNLAAEFGMTVSMSRRANAWDNAPMESFFKTLKVERIYQTRYETRAQARLDIVDWIEGYYNRQRMHTSIGYCTPVEYETLRAAA
>NZ_CP011920.1|WP_058904020.1|43225_43942_-|translesion-DNA-synthesis-associated-protein-ImuA
MHPALAHPEAIHPSLWKASHLPRSGTRGVDTGHPTLSAELPGGGWPAGALVELLAQQPGIGELRLLAPVLARGSGKPVVLIQPPHALQPLALAYWGVDPSGFVALPAPRTADALWAAEQALRAGTCAAVLLWQAHVRTDALRRLNLAAQSGSALFFLFRPAAAARDASPAPLRLALAPKRDGVEVTIVKRRGPARDTPLYVPLFPSPILLNRHAHVDRRASAAPQPRNVPAAIAGAVV
>NZ_CP011920.1|WP_058904021.1|44015_44927_-|DUF159-family-protein
MCYSAKIQANYREYVRRYGADMDIDTFRRLFFARAAGNDIKIPKAVDAAFDGIDEEITVAIAAYRSQRTRKLETDLFEQRTRLAAAEKKLAVKITKKASEDVRIATNKIDAATRGLDDLRRQDLQERDSRIFPGWYAPVLIELDGKRMVVPMRYRCRIPGWTEADERAKDGSYNARADSLSTAWRKVFGFTHGLLLVDTFFENVKRDGQNVVLRFDPTPPQHMQVACLWTRTEIPGGDDLWSFAAITDDPPPEVAAAGHDRCIVPIKSSNVDAWLAPDPSRRAQLREILTDRERPYYEHQLAA
>NZ_CP011920.1|WP_058904022.1|45161_48146_-|Tn3-family-transposase
MTQIHETAYPVLPAELEEAELRTVYTPSAAEIRFVFGQFRQAPTRVLILVQLKLLQRLGYMPVVSDVPPAIIDHMCAALGARPLARTTLARYDRSGSKSRHQKILREYVRIQTVDRAANDWLARVAAYAARTKAELPDIINVMLEELVRRRFELPPLPTLSRIAGHARSQLHEEIYRAFVESLDDAQKARLDDLFLVRGGRTFWDELKREPKRPGPREVASFLEHIEAMNALANGLPPIPDMLSVPKRMQFVVEARALDVHEIRALKPAKRYALAVLFVLAQRQKALDDVVEIFIKTVRNLENTGKLRLQQYQLAHADQLQSLVSQFRDVLNVLQDDETPAAMRIAQMRAALNNDPDAVLNRCNEHIEQAGNHIFPFLLIPYRNLRSLLFQCVESLSLKASSQDDALLKALDWLKMYRSSRREYLLLSDTDLAQLPLGWIPEKWERCVLPDGVSARLLHRKYFELCVFSQIMRELNSGDVYVEGSDQYDDPRVHQVSWDEFRDELPRYRELVDYSVDSRTFVRQLKDELVTLADQVDAGFPENDHVETSEEHGLILHRLDKKPDPPNKSLIVQAMEATMRPVSILDILTETEQWLDLHRLFGPLSGFEAKIDEPRKRFITTLFCYGCNLGPTQTARSVKNLSRKQVAWLNLKYVTEERLDKAIVKVINAYNQFALPKFWGSGKRVSADGTKWNLYEQNLLSEYHIRYGGYGGIGYYHVSDKYIALFSHFIPCGVHEAVYILDGLIKNASDVQPDTVHGDTHAQSAPVFALAHLLGIKLMPRIRDIKDLTFFKADRRRRYKNIESLFRASIDWPLIERHFPDMLRVAISIKAGRMTPSMILRRLGSVSVKNKLYFAFRELGRVIRTMFLLRYINDPEMRQTIHAATNKSEQFNDFAKWLMFGGEVIAENVRHEQRKVIKYNQLVANMVILYNVQWMSRRLKVLQEKGLPVDAEVLQALSPYRKDHINRLGSYLLDLQRRAPPLDPSIDFSFESAA
>NZ_CP011920.1|WP_058904128.1|49630_49894_+|helix-turn-helix-transcriptional-regulator
MGEYGGLIRLHILHHTAEGPVFGLGIIEELRHHGYEMSAGTLYPMLHGMAKKGYLSSHHERTGRRERRVYEITAQGRWALAEATTNV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP011920_1	1.1\|31524\|33\|NZ_CP011920\|PILER-CR	31524-31556	33	NZ_CP011920	Burkholderia cenocepacia strain ST32 plasmid pBCEN1232, complete sequence	31524-31556	0	1.0
NZ_CP011920_1	1.2\|31577\|47\|NZ_CP011920\|PILER-CR	31577-31623	47	NZ_CP011920	Burkholderia cenocepacia strain ST32 plasmid pBCEN1232, complete sequence	31577-31623	0	1.0
NZ_CP011920_1	1.2\|31577\|47\|NZ_CP011920\|PILER-CR	31577-31623	47	NZ_CP011506	Burkholderia pyrrocinia strain DSM 10685 plasmid p2327, complete sequence	27361-27407	2	0.957
NZ_CP011920_1	1.1\|31524\|33\|NZ_CP011920\|PILER-CR	31524-31556	33	NC_008545	Burkholderia cenocepacia HI2424 plasmid unnamed1, complete sequence	94200-94232	3	0.909
NZ_CP011920_1	1.1\|31524\|33\|NZ_CP011920\|PILER-CR	31524-31556	33	NC_011003	Burkholderia cenocepacia J2315 plasmid pBCJ2315, complete sequence	92403-92435	4	0.879

1. spacer 1.1|31524|33|NZ_CP011920|PILER-CR matches to NZ_CP011920 (Burkholderia cenocepacia strain ST32 plasmid pBCEN1232, complete sequence) position: , mismatch: 0, identity: 1.0

gtgggcatcttgtgagactccctatggaaaccc	CRISPR spacer
gtgggcatcttgtgagactccctatggaaaccc	Protospacer
*********************************

2. spacer 1.2|31577|47|NZ_CP011920|PILER-CR matches to NZ_CP011920 (Burkholderia cenocepacia strain ST32 plasmid pBCEN1232, complete sequence) position: , mismatch: 0, identity: 1.0

cgtttagaaccgaggttcatatgtgaccattcaacatcggatctgcg	CRISPR spacer
cgtttagaaccgaggttcatatgtgaccattcaacatcggatctgcg	Protospacer
***********************************************

3. spacer 1.2|31577|47|NZ_CP011920|PILER-CR matches to NZ_CP011506 (Burkholderia pyrrocinia strain DSM 10685 plasmid p2327, complete sequence) position: , mismatch: 2, identity: 0.957

cgtttagaaccgaggttcatatgtgaccattcaacatcggatctgcg	CRISPR spacer
cgttaagaaccgaggttcatacgtgaccattcaacatcggatctgcg	Protospacer
**** ****************.*************************

4. spacer 1.1|31524|33|NZ_CP011920|PILER-CR matches to NC_008545 (Burkholderia cenocepacia HI2424 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.909

gtgggcatcttgtgagactccctatggaaaccc	CRISPR spacer
ttggacatcttgtgagactccctatagaaaccc	Protospacer
 ***.********************.*******

5. spacer 1.1|31524|33|NZ_CP011920|PILER-CR matches to NC_011003 (Burkholderia cenocepacia J2315 plasmid pBCJ2315, complete sequence) position: , mismatch: 4, identity: 0.879

gtgggcatcttgtgagactccctatggaaaccc	CRISPR spacer
ttggacatcttgtgagactccctatagaaaccg	Protospacer
 ***.********************.******

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

962 : 69965

Acinetobacter_phage(11.76%)

transposase,integrase,plate

attL 58831:58846|attR 77655:77670

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_143272455.1\|962_2161_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.0e-49	38.8
WP_058903124.1\|3129_4140_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_058903992.1\|4509_7446_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	2.3e-50	21.8
WP_058903993.1\|7646_7949_-	H-NS histone family protein	NA	NA	NA	NA
WP_058903994.1\|8176_9613_-	DUF2169 domain-containing protein	NA	NA	NA	NA
WP_058904124.1\|9617_11729_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	6.0e-61	29.2
WP_058903995.1\|11862_13740_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_058903996.1\|13740_14313_-	hypothetical protein	NA	NA	NA	NA
WP_058903997.1\|14333_14711_-	DUF3592 domain-containing protein	NA	NA	NA	NA
WP_088925042.1\|15162_16397_-\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	1.1e-102	65.5
WP_058903998.1\|16487_17318_+	hypothetical protein	NA	NA	NA	NA
WP_058903999.1\|17585_18005_+	hypothetical protein	NA	NA	NA	NA
WP_058904000.1\|18011_19031_-	hypothetical protein	NA	NA	NA	NA
WP_063812477.1\|19210_20011_-	FRG domain-containing protein	NA	NA	NA	NA
WP_058904001.1\|20018_20267_-	hypothetical protein	NA	NA	NA	NA
WP_058904002.1\|20434_21379_-	hypothetical protein	NA	NA	NA	NA
WP_058904003.1\|21474_23325_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_058904126.1\|23328_23757_-	hypothetical protein	NA	NA	NA	NA
WP_058904004.1\|24021_24357_-	hypothetical protein	NA	NA	NA	NA
WP_058904005.1\|24367_24613_-	hypothetical protein	NA	NA	NA	NA
WP_077175733.1\|24599_24998_-	hypothetical protein	A0A2H4P7P5	Pseudomonas_phage	5.1e-22	47.5
WP_058904007.1\|25003_26089_-	hypothetical protein	NA	NA	NA	NA
WP_058904008.1\|26116_26458_-	hypothetical protein	NA	NA	NA	NA
WP_058904009.1\|26743_27253_-	hypothetical protein	NA	NA	NA	NA
WP_058904010.1\|27276_27483_-	hypothetical protein	B5UAR3	Ralstonia_phage	2.5e-17	66.7
WP_058904011.1\|27509_28208_-	hypothetical protein	NA	NA	NA	NA
WP_058904012.1\|28393_28723_-	hypothetical protein	NA	NA	NA	NA
WP_058904013.1\|28870_29218_-	hypothetical protein	NA	NA	NA	NA
WP_058904014.1\|29529_29940_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_058904127.1\|29936_30179_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_058904015.1\|30296_31328_-	DNA polymerase	A0A068CDF3	Rhizobium_phage	5.9e-54	36.7
WP_058904016.1\|31783_32455_+	AAA family ATPase	A0A222YXS3	Escherichia_phage	2.9e-17	31.2
WP_058904017.1\|32454_33420_+	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
WP_058904018.1\|34164_35022_+	TrfA family protein	NA	NA	NA	NA
WP_105773736.1\|35773_36952_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.2e-42	42.7
WP_058904019.1\|37386_40536_-	error-prone DNA polymerase	A0A291AVS4	Streptomyces_phage	2.7e-94	27.7
WP_143272455.1\|41144_42342_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.0e-49	38.8
WP_058904020.1\|43225_43942_-	translesion DNA synthesis-associated protein ImuA	NA	NA	NA	NA
WP_058904021.1\|44015_44927_-	DUF159 family protein	NA	NA	NA	NA
WP_058904022.1\|45161_48146_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	5.6e-81	27.1
WP_058904128.1\|49630_49894_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_058904024.1\|50153_50711_+	recombinase family protein	A0A286S1P7	Klebsiella_phage	2.1e-53	58.8
WP_058904025.1\|50750_51566_+	creatininase	NA	NA	NA	NA
WP_058904026.1\|51627_52800_+	hypothetical protein	NA	NA	NA	NA
WP_143272456.1\|52865_53108_-	hypothetical protein	NA	NA	NA	NA
WP_058904027.1\|53287_54709_-	heavy metal sensor histidine kinase	W8CYF6	Bacillus_phage	1.0e-16	25.1
WP_058904028.1\|54705_55377_-	heavy metal response regulator transcription factor	W8CYM9	Bacillus_phage	6.6e-30	34.2
WP_058904030.1\|56206_56506_+	hypothetical protein	NA	NA	NA	NA
WP_058904031.1\|56502_58008_+	TolC family protein	NA	NA	NA	NA
WP_058904032.1\|58009_59305_+	copper oxidase	NA	NA	NA	NA
58831:58846	attL	NA	NA	NA	NA
WP_058904033.1\|59368_59716_+	copper-binding protein	NA	NA	NA	NA
WP_143272461.1\|59782_60154_+	copper homeostasis periplasmic binding protein CopC	NA	NA	NA	NA
WP_058904035.1\|60153_61095_+	copper resistance protein CopD	NA	NA	NA	NA
WP_077021550.1\|61364_61697_+	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_058904036.1\|62412_63927_-	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_077021551.1\|63999_66294_-	heavy metal translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.3e-88	36.1
WP_058904037.1\|66692_66890_-	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_058904038.1\|66921_67353_-	Cu(I)-responsive transcriptional regulator	NA	NA	NA	NA
WP_143272457.1\|68053_68275_-	hypothetical protein	NA	NA	NA	NA
WP_154641512.1\|68267_69965_+\|integrase	tyrosine-type recombinase/integrase	A0A2K9VH72	Gordonia_phage	1.4e-07	24.9
77655:77670	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP011917

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

466 : 68817

Pseudomonas_phage(18.18%)

plate,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088925042.1\|466_1701_-\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	1.1e-102	65.5
WP_058901183.1\|2117_3011_-	chromosome partitioning protein ParB	NA	NA	NA	NA
WP_058902250.1\|3354_4377_+\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	3.5e-83	48.4
WP_058901184.1\|4373_5159_+	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	3.1e-79	58.8
WP_095423477.1\|10199_11016_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	1.9e-07	35.9
WP_058901186.1\|11231_12284_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_058901187.1\|12769_13123_+	hypothetical protein	NA	NA	NA	NA
WP_058901188.1\|13693_14020_-	H-NS histone family protein	NA	NA	NA	NA
WP_058901189.1\|14273_16475_-	hypothetical protein	NA	NA	NA	NA
WP_077021874.1\|16476_17130_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_077021875.1\|17126_17969_-	phosphoadenosine phosphosulfate reductase family protein	A0A0F7L647	uncultured_marine_virus	7.2e-26	34.0
WP_058901190.1\|17961_19242_-	hypothetical protein	NA	NA	NA	NA
WP_088925042.1\|19426_20661_-\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	1.1e-102	65.5
WP_058901191.1\|22630_23560_-	DUF4007 family protein	NA	NA	NA	NA
WP_058901192.1\|24209_24563_-	hypothetical protein	NA	NA	NA	NA
WP_077175671.1\|24682_25282_-	DUF4339 domain-containing protein	NA	NA	NA	NA
WP_058901194.1\|25439_27197_-	hypothetical protein	A0A1L7N0M1	Ralstonia_phage	4.1e-63	35.1
WP_058901195.1\|27389_29399_-	acyltransferase	C6ZR20	Salmonella_phage	2.1e-84	41.6
WP_077021877.1\|29599_29929_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_058901196.1\|30223_33913_+	AAA family ATPase	A0A2P0VMS9	Tetraselmis_virus	2.9e-10	30.9
WP_048989158.1\|34131_34770_-	hypothetical protein	NA	NA	NA	NA
WP_058901197.1\|34772_35072_-	hypothetical protein	NA	NA	NA	NA
WP_058901198.1\|35389_36196_-	DUF4942 domain-containing protein	NA	NA	NA	NA
WP_058901199.1\|37351_38266_-	hypothetical protein	NA	NA	NA	NA
WP_058901200.1\|38317_38533_-	hypothetical protein	NA	NA	NA	NA
WP_058901201.1\|38544_39540_-	endonuclease	A6XMH8	Bacillus_virus	3.9e-55	39.2
WP_058901202.1\|39807_40776_-	DUF932 domain-containing protein	A0A0H4INH5	Stenotrophomonas_phage	2.0e-59	43.3
WP_006486519.1\|40893_41121_-	hypothetical protein	NA	NA	NA	NA
WP_077175672.1\|42689_44660_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_058901204.1\|45065_45572_-	acetone carboxylase subunit gamma	NA	NA	NA	NA
WP_058901205.1\|45611_47936_-	acetone carboxylase subunit alpha	NA	NA	NA	NA
WP_058901206.1\|47947_50092_-	hydantoinase/oxoprolinase family protein	NA	NA	NA	NA
WP_058901207.1\|50531_50738_+	hypothetical protein	NA	NA	NA	NA
WP_058901186.1\|50994_52047_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_006485326.1\|56561_56765_+	hypothetical protein	NA	NA	NA	NA
WP_006485337.1\|56874_57675_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_006485338.1\|57956_58274_+	hypothetical protein	NA	NA	NA	NA
WP_006494425.1\|58355_58691_+	hypothetical protein	NA	NA	NA	NA
WP_006494424.1\|58806_59589_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_006477098.1\|59585_60932_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_034178609.1\|61037_61649_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_043204524.1\|62024_62651_+	hypothetical protein	NA	NA	NA	NA
WP_006484395.1\|62697_63213_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_006484397.1\|63228_64719_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_006477093.1\|64789_65293_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_006477092.1\|65355_65841_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_048986026.1\|65917_67753_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_058901209.1\|67716_68817_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA

DBSCAN-SWA_2

263248 : 334279

uncultured_virus(62.5%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105773736.1\|263248_264427_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.2e-42	42.7
WP_003098996.1\|264836_265337_+	DUF305 domain-containing protein	NA	NA	NA	NA
WP_020924940.1\|268078_269047_-	Dyp-type peroxidase	NA	NA	NA	NA
WP_023106332.1\|269165_269819_-	hypothetical protein	NA	NA	NA	NA
WP_009459591.1\|269938_270232_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_023103878.1\|270254_271145_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_023093406.1\|271628_272843_-	alcohol dehydrogenase catalytic domain-containing protein	NA	NA	NA	NA
WP_028698648.1\|273309_274251_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_020924943.1\|276757_278029_-\|transposase	IS4-like element ISPa45 family transposase	NA	NA	NA	NA
WP_058901262.1\|278522_278720_+	hypothetical protein	NA	NA	NA	NA
WP_105773736.1\|278736_279915_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.2e-42	42.7
WP_154641476.1\|280068_281877_+	excinuclease ABC subunit UvrB	NA	NA	NA	NA
WP_058901263.1\|282027_282933_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_017514126.1\|283087_283495_+	hypothetical protein	NA	NA	NA	NA
WP_007182546.1\|283496_284105_+	N-acetyltransferase	NA	NA	NA	NA
WP_007182547.1\|284101_284992_+	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
WP_007182548.1\|285274_285550_+	formaldehyde-responsive transcriptional repressor FrmR	NA	NA	NA	NA
WP_105773736.1\|286007_287186_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.2e-42	42.7
WP_017514589.1\|288140_288539_+	VOC family protein	NA	NA	NA	NA
WP_023106334.1\|288721_290056_+	DUF3422 domain-containing protein	NA	NA	NA	NA
WP_011871465.1\|290114_290945_+	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_011871464.1\|290961_292269_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_011871462.1\|293690_295556_+	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	5.3e-53	37.6
WP_020924950.1\|295581_298233_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	1.3e-153	33.7
WP_009876620.1\|298313_300158_-	hypothetical protein	NA	NA	NA	NA
WP_009876619.1\|300463_300781_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_009876618.1\|300780_301239_+	type II toxin-antitoxin system YhaV family toxin	NA	NA	NA	NA
WP_011871459.1\|301266_301644_+	DUF3742 family protein	NA	NA	NA	NA
WP_105773736.1\|303028_304207_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.2e-42	42.7
WP_009876615.1\|304568_304928_-	hypothetical protein	NA	NA	NA	NA
WP_023106340.1\|304924_306322_-	integrating conjugative element protein	NA	NA	NA	NA
WP_009876613.1\|306331_307279_-	TIGR03756 family integrating conjugative element protein	NA	NA	NA	NA
WP_011871456.1\|307275_307722_-	TIGR03757 family integrating conjugative element protein	NA	NA	NA	NA
WP_009876611.1\|307880_308375_-	hypothetical protein	NA	NA	NA	NA
WP_011871455.1\|308559_309324_-	thioredoxin domain-containing protein	NA	NA	NA	NA
WP_058901265.1\|309337_312220_-	conjugative transfer ATPase	NA	NA	NA	NA
WP_003158644.1\|312219_312660_-	TIGR03751 family conjugal transfer lipoprotein	NA	NA	NA	NA
WP_011871453.1\|312640_314071_-	TIGR03752 family integrating conjugative element protein	NA	NA	NA	NA
WP_058901266.1\|314060_314978_-	TIGR03749 family integrating conjugative element protein	NA	NA	NA	NA
WP_009876605.1\|314974_315664_-	TIGR03746 family integrating conjugative element protein	NA	NA	NA	NA
WP_003158639.1\|315660_316071_-	TIGR03750 family conjugal transfer protein	NA	NA	NA	NA
WP_009876604.1\|316083_316443_-	TIGR03745 family integrating conjugative element membrane protein	NA	NA	NA	NA
WP_009876603.1\|316459_316693_-	TIGR03758 family integrating conjugative element protein	NA	NA	NA	NA
WP_009876602.1\|316689_317070_-	hypothetical protein	NA	NA	NA	NA
WP_017514686.1\|317206_318109_-	hypothetical protein	NA	NA	NA	NA
WP_011871451.1\|318213_318888_+	hypothetical protein	NA	NA	NA	NA
WP_011871450.1\|319039_320092_+	hypothetical protein	NA	NA	NA	NA
WP_011871449.1\|320192_322817_+	AAA family ATPase	NA	NA	NA	NA
WP_009876598.1\|322846_323596_-	TIGR03747 family integrating conjugative element membrane protein	NA	NA	NA	NA
WP_058901267.1\|323592_325779_-	type IV conjugative transfer system coupling protein TraD	NA	NA	NA	NA
WP_009876596.1\|325783_326332_-	integrating conjugative element protein	NA	NA	NA	NA
WP_009876595.1\|326328_326919_-	transglycosylase SLT domain-containing protein	NA	NA	NA	NA
WP_009876594.1\|326900_327626_-	TIGR03759 family integrating conjugative element protein	NA	NA	NA	NA
WP_009876593.1\|327640_328291_-	hypothetical protein	NA	NA	NA	NA
WP_020924956.1\|328287_328887_-	PilL	NA	NA	NA	NA
WP_011871446.1\|329109_330894_+	AAA family ATPase	NA	NA	NA	NA
WP_077021940.1\|330880_332695_+	ATP-dependent helicase	A0A1P8DIG0	Virus_Rctr197k	5.2e-05	24.7
WP_058901268.1\|333019_334279_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	5.1e-44	45.0

DBSCAN-SWA_3

345200 : 396682

uncultured_virus(30.0%)

holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105773736.1\|345200_346379_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.2e-42	42.7
WP_009876567.1\|347406_347730_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_009876566.1\|347734_348229_+	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	5.0e-27	43.5
WP_011871431.1\|348239_349310_+	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
WP_009876564.1\|349312_350545_+	MFS transporter	NA	NA	NA	NA
WP_009876563.1\|350541_350964_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	6.3e-55	75.7
WP_011871430.1\|350956_351679_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.0e-92	71.7
WP_006482189.1\|352879_354358_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.6e-15	36.5
WP_048989498.1\|354542_355475_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_006497713.1\|355569_356118_-	N-acetyltransferase	NA	NA	NA	NA
WP_058901270.1\|356168_356789_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_058901271.1\|356936_357173_+	ParD-like family protein	NA	NA	NA	NA
WP_006482199.1\|357172_357979_+	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_006482190.1\|358099_358603_-	GAF domain-containing protein	NA	NA	NA	NA
WP_105773736.1\|358918_360097_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.2e-42	42.7
WP_006476181.1\|360281_361247_+\|transposase	IS110-like element ISBcen8 family transposase	Q75QL1	Wolbachia_phage	1.3e-23	34.2
WP_048989496.1\|361263_362181_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006482192.1\|362292_363159_+	pirin family protein	NA	NA	NA	NA
WP_006482188.1\|363300_363792_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_006491689.1\|363814_364684_-	cytochrome c oxidase assembly protein	NA	NA	NA	NA
WP_006488671.1\|364694_365141_-	copper chaperone PCu(A)C	NA	NA	NA	NA
WP_006497709.1\|365149_365785_-	SCO family protein	NA	NA	NA	NA
WP_006488667.1\|366063_366816_+	trehalose-phosphatase	NA	NA	NA	NA
WP_058901272.1\|366812_368198_+	alpha,alpha-trehalose-phosphate synthase (UDP-forming)	NA	NA	NA	NA
WP_058901273.1\|368280_370107_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.0e-38	28.7
WP_006476459.1\|370671_371736_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_006491691.1\|371971_372775_+	hypothetical protein	NA	NA	NA	NA
WP_006497708.1\|372814_373279_+	DUF2214 family protein	NA	NA	NA	NA
WP_034200817.1\|373359_374712_-	glucarate dehydratase	NA	NA	NA	NA
WP_006484310.1\|375070_375820_+	FadR family transcriptional regulator	NA	NA	NA	NA
WP_006497706.1\|375958_377107_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_006484309.1\|377478_379623_-\|holin	phospholipase C, phosphocholine-specific	NA	NA	NA	NA
WP_006484315.1\|379900_380761_-	pyridoxal kinase PdxY	NA	NA	NA	NA
WP_058901274.1\|380945_382007_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_006492947.1\|382043_383042_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_058901275.1\|383680_384856_+	glycosyltransferase	NA	NA	NA	NA
WP_058901276.1\|385011_386433_+	hopanoid biosynthesis associated radical SAM protein HpnJ	NA	NA	NA	NA
WP_006493052.1\|386436_387321_+	hopanoid biosynthesis-associated protein HpnK	NA	NA	NA	NA
WP_006497701.1\|387317_388367_+	membrane protein	NA	NA	NA	NA
WP_058901277.1\|388455_389010_+	hypothetical protein	NA	NA	NA	NA
WP_006488734.1\|389377_390067_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_006488739.1\|390063_390777_+	ABC transporter permease	NA	NA	NA	NA
WP_006488736.1\|390797_391598_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	8.4e-24	36.2
WP_006488743.1\|391620_392661_+	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_034200813.1\|394159_395410_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_058901279.1\|395449_396682_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.6e-42	45.6

DBSCAN-SWA_4

2819571 : 2892389

Burkholderia_phage(66.67%)

plate,tail,holin,transposase,integrase

attL 2869763:2869793|attR 2892458:2892488

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006477367.1\|2819571_2819925_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_006484031.1\|2820027_2821446_-	adenosylhomocysteinase	S4VPF6	Pandoravirus	9.9e-44	30.1
WP_006484033.1\|2821697_2822432_-	RNA polymerase sigma factor FliA	NA	NA	NA	NA
WP_006491878.1\|2822454_2823273_-	flagellar biosynthesis protein FlhG	NA	NA	NA	NA
WP_058901981.1\|2823265_2825050_-	flagellar biosynthesis protein FlhF	NA	NA	NA	NA
WP_058901982.1\|2825046_2827149_-	flagellar biosynthesis protein FlhA	NA	NA	NA	NA
WP_006485884.1\|2827145_2828345_-	flagellar type III secretion system protein FlhB	NA	NA	NA	NA
WP_006485888.1\|2828774_2829272_-	VOC family protein	NA	NA	NA	NA
WP_006497451.1\|2829436_2830675_-	DUF3443 family protein	NA	NA	NA	NA
WP_012492269.1\|2830691_2831195_-	DUF2844 domain-containing protein	NA	NA	NA	NA
WP_006497453.1\|2831454_2832186_-	protein phosphatase CheZ	NA	NA	NA	NA
WP_006485893.1\|2832188_2832584_-	chemotaxis protein CheY	Q56AR1	Bacillus_thuringiensis_phage	6.0e-07	31.9
WP_012492268.1\|2832651_2833743_-	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
WP_006497454.1\|2833739_2834498_-	chemoreceptor glutamine deamidase CheD	NA	NA	NA	NA
WP_058901983.1\|2834494_2835487_-	chemotaxis protein CheR	NA	NA	NA	NA
WP_058901984.1\|2835490_2837467_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.5e-10	45.0
WP_006486165.1\|2837504_2838020_-	chemotaxis protein CheW	NA	NA	NA	NA
WP_058901985.1\|2838067_2840323_-	chemotaxis protein CheA	NA	NA	NA	NA
WP_006482646.1\|2840356_2840734_-	response regulator	NA	NA	NA	NA
WP_058901986.1\|2840758_2841778_-	flagellar motor protein MotB	NA	NA	NA	NA
WP_006482649.1\|2841791_2842652_-	flagellar motor stator protein MotA	NA	NA	NA	NA
WP_006493184.1\|2842832_2843387_-	flagellar transcriptional regulator FlhC	NA	NA	NA	NA
WP_006477348.1\|2843479_2843833_-	flagellar transcriptional regulator FlhD	NA	NA	NA	NA
WP_006489318.1\|2844464_2845529_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_006489320.1\|2845632_2845929_-	H-NS histone family protein	F8TUP5	EBPR_podovirus	1.9e-10	41.1
WP_006489324.1\|2846228_2846972_+	aquaporin Z	A0A1B1ISL4	uncultured_Mediterranean_phage	8.1e-05	50.8
WP_112750434.1\|2847089_2848453_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.7e-78	54.0
WP_006489316.1\|2848563_2849388_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_034201116.1\|2850548_2851151_+	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_058902303.1\|2851235_2852471_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_058901987.1\|2852700_2854824_+	TonB-dependent receptor	NA	NA	NA	NA
WP_006401410.1\|2854990_2855203_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_058901988.1\|2855733_2856888_+	flagellin	NA	NA	NA	NA
WP_058901989.1\|2857020_2858529_+	flagellar filament capping protein FliD	NA	NA	NA	NA
WP_006484091.1\|2858554_2858854_+	flagellar protein FliT	NA	NA	NA	NA
WP_058901990.1\|2859111_2861454_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_058901991.1\|2861478_2862627_+	DegT/DnrJ/EryC1/StrS family aminotransferase	A9YVU0	Ostreococcus_tauri_virus	7.3e-13	24.9
WP_058901992.1\|2864510_2864924_+	hypothetical protein	NA	NA	NA	NA
WP_058901993.1\|2865031_2865784_-	WbqC family protein	NA	NA	NA	NA
WP_058901994.1\|2865850_2867770_-	glycosyltransferase family protein	NA	NA	NA	NA
WP_058901995.1\|2868009_2869629_-	TIGR04222 domain-containing membrane protein	NA	NA	NA	NA
2869763:2869793	attL	NA	NA	NA	NA
WP_006484103.1\|2870190_2870397_+\|tail	tail protein	E5E3W5	Burkholderia_phage	5.1e-18	64.7
WP_006484093.1\|2870413_2870758_+	membrane protein	A4JWU2	Burkholderia_virus	5.7e-38	77.9
WP_006484102.1\|2870759_2871026_+\|holin	phage holin family protein	E5E3W3	Burkholderia_phage	6.2e-24	65.5
WP_063822421.1\|2871022_2871880_+	DUF3380 domain-containing protein	A4JWZ0	Burkholderia_virus	2.9e-91	65.8
WP_154641491.1\|2871804_2872380_-	hypothetical protein	NA	NA	NA	NA
WP_058901998.1\|2872433_2872883_+\|tail	phage tail protein	E5E3V9	Burkholderia_phage	1.5e-30	54.2
WP_058901999.1\|2873397_2874084_+\|plate	phage baseplate assembly protein V	K4NXJ5	Burkholderia_phage	1.3e-81	68.7
WP_034201129.1\|2874080_2874443_+\|plate	baseplate assembly protein	K4PAX6	Burkholderia_phage	3.4e-41	69.2
WP_006484106.1\|2874439_2875354_+\|plate	baseplate assembly protein	E5FFH3	Burkholderia_phage	1.5e-117	72.6
WP_006484097.1\|2875346_2875889_+\|tail	phage tail protein I	E5FFH2	Burkholderia_phage	5.2e-70	70.9
WP_058902000.1\|2875895_2878223_+\|tail	phage tail protein	E5E3V2	Burkholderia_phage	2.0e-259	61.2
WP_006491896.1\|2878238_2878964_+\|tail	caudovirales tail fiber assembly protein	E5E3V1	Burkholderia_phage	1.8e-89	84.2
WP_058902001.1\|2879018_2880191_+\|tail	phage tail sheath protein	A4JWS7	Burkholderia_virus	8.7e-187	81.5
WP_077175722.1\|2880225_2880729_+\|tail	phage major tail tube protein	E5E3U9	Burkholderia_phage	2.2e-70	74.3
WP_006484110.1\|2880805_2881177_+\|tail	phage tail assembly protein	K4NXA3	Burkholderia_phage	2.2e-27	65.5
WP_006484104.1\|2881185_2881299_+\|tail	GpE family phage tail protein	A0A089FGX3	Burkholderia_phage	1.1e-09	85.7
WP_058902002.1\|2881314_2883885_+	hypothetical protein	E5E3U6	Burkholderia_phage	1.7e-134	46.7
WP_034201134.1\|2883907_2884339_+\|tail	phage tail protein	K4NXK5	Burkholderia_phage	8.2e-42	67.4
WP_006485451.1\|2884335_2885406_+	phage late control D family protein	K4PAY4	Burkholderia_phage	1.1e-135	70.6
WP_006485449.1\|2885593_2885890_-	hypothetical protein	E5E3U3	Burkholderia_phage	1.6e-12	50.5
WP_077175721.1\|2886207_2886663_-	helix-turn-helix transcriptional regulator	E5E3U2	Burkholderia_phage	3.2e-44	62.9
WP_006485450.1\|2886789_2887005_+	hypothetical protein	E5E3U1	Burkholderia_phage	4.4e-20	80.0
WP_006485448.1\|2887186_2887435_+	ogr/Delta-like zinc finger family protein	K4PAZ0	Burkholderia_phage	3.5e-37	91.5
WP_034201136.1\|2887562_2887820_+	hypothetical protein	A4JWQ9	Burkholderia_virus	2.1e-13	56.0
WP_034201137.1\|2887825_2890618_+	hypothetical protein	E5E3N5	Burkholderia_phage	0.0e+00	91.0
WP_077021587.1\|2890614_2890986_+	hypothetical protein	A0A089FGR9	Burkholderia_phage	6.6e-08	50.6
WP_059721111.1\|2891037_2891310_-	hypothetical protein	NA	NA	NA	NA
WP_006484045.1\|2891312_2892389_+\|integrase	site-specific integrase	A0A1S5NNJ1	Burkholderia_phage	7.2e-164	81.7
2892458:2892488	attR	NA	NA	NA	NA

DBSCAN-SWA_5

3040313 : 3099623

Paenibacillus_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095423477.1\|3040313_3041131_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	1.9e-07	35.9
WP_006495415.1\|3041543_3042425_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_058902046.1\|3042527_3043043_-	DUF2628 domain-containing protein	NA	NA	NA	NA
WP_058902047.1\|3044016_3044277_+	hypothetical protein	NA	NA	NA	NA
WP_058902048.1\|3044308_3044638_+	hypothetical protein	NA	NA	NA	NA
WP_006487296.1\|3044656_3044902_+	hypothetical protein	NA	NA	NA	NA
WP_058902049.1\|3045097_3045415_+	hypothetical protein	NA	NA	NA	NA
WP_095423477.1\|3045921_3046738_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	1.9e-07	35.9
WP_006495421.1\|3046919_3047678_-	anti-sigma factor	NA	NA	NA	NA
WP_058902050.1\|3047674_3048196_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_058902051.1\|3048354_3049443_+	catalase family peroxidase	NA	NA	NA	NA
WP_058902052.1\|3049439_3049973_+	cytochrome b	NA	NA	NA	NA
WP_154641492.1\|3052237_3052399_+	hypothetical protein	NA	NA	NA	NA
WP_105773736.1\|3055455_3056634_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.2e-42	42.7
WP_058902053.1\|3057106_3057370_-	PAAR domain-containing protein	NA	NA	NA	NA
WP_139349397.1\|3057522_3057987_-	hypothetical protein	NA	NA	NA	NA
WP_058902055.1\|3057983_3063941_-	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_077021643.1\|3064425_3064671_-	type I toxin-antitoxin system SymE family toxin	NA	NA	NA	NA
WP_143258264.1\|3064868_3065648_-	hypothetical protein	NA	NA	NA	NA
WP_077175760.1\|3065611_3066292_-	HNH endonuclease	NA	NA	NA	NA
WP_058902056.1\|3067683_3069522_+	SAM-dependent DNA methyltransferase	A0A220A2U5	Liberibacter_phage	1.1e-34	28.0
WP_077021594.1\|3069518_3070895_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_058902058.1\|3070891_3071824_+	hypothetical protein	NA	NA	NA	NA
WP_105848468.1\|3074995_3075397_+	hypothetical protein	NA	NA	NA	NA
WP_105848424.1\|3075448_3076610_+\|transposase	IS3 family transposase	Q716C2	Shigella_phage	9.5e-85	53.2
WP_006492556.1\|3076782_3078051_+\|transposase	IS256-like element ISBcen18 family transposase	A0A0K2CZ57	Paenibacillus_phage	2.5e-30	26.8
WP_077188661.1\|3078031_3078382_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_058902060.1\|3078488_3079685_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_006476662.1\|3079755_3080193_-	transcription antitermination factor NusB	NA	NA	NA	NA
WP_006476661.1\|3080189_3080705_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	6.2e-20	38.0
WP_048985375.1\|3080758_3081901_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	2.2e-49	36.7
WP_058902061.1\|3082058_3082577_-	DUF1993 domain-containing protein	NA	NA	NA	NA
WP_058902062.1\|3082906_3083536_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.8e-29	40.4
WP_006484247.1\|3083550_3084672_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2I2L4R9	Orpheovirus	5.2e-48	34.3
WP_058902063.1\|3084687_3085971_-	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
WP_006484248.1\|3086152_3086605_-	hypothetical protein	NA	NA	NA	NA
WP_058902064.1\|3086854_3088072_+	Bcr/CflA family multidrug efflux MFS transporter	S4TR35	Salmonella_phage	4.2e-27	26.6
WP_006484254.1\|3088176_3090105_-	bifunctional transcriptional regulator/glucokinase	NA	NA	NA	NA
WP_006496597.1\|3090082_3090763_-	6-phosphogluconolactonase	NA	NA	NA	NA
WP_006491174.1\|3090851_3092321_-	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	3.9e-75	36.1
WP_006491170.1\|3092753_3094001_+	carbohydrate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011544827.1\|3094139_3095078_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_006496594.1\|3095067_3095925_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_006496593.1\|3096037_3097156_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	5.3e-24	35.3
WP_077613735.1\|3098354_3099623_-\|transposase	IS256-like element ISBcen18 family transposase	A0A0K2CZ57	Paenibacillus_phage	3.3e-30	26.5

DBSCAN-SWA_6

3512994 : 3522045

Hokovirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006484920.1\|3512994_3514947_+	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	2.5e-146	50.3
WP_006476837.1\|3515200_3516337_+	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	5.0e-22	26.9
WP_058902158.1\|3516340_3518263_+	bifunctional anthranilate synthase component I family protein/class IV aminotransferase	S4VT78	Pandoravirus	5.2e-56	37.2
WP_006485002.1\|3518374_3519190_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	1.8e-37	34.2
WP_006484932.1\|3519233_3519920_-	deoxynucleoside kinase	A0A0M3UL55	Enterococcus_phage	7.2e-08	26.4
WP_006476832.1\|3519916_3520459_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_006484964.1\|3520494_3522045_-	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	9.5e-24	31.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP011919

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

935121 : 983927

Mycobacterium_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006482428.1\|935121_936147_+\|transposase	IS110-like element ISBcen4 family transposase	NA	NA	NA	NA
WP_058903937.1\|938786_939362_-	hypothetical protein	NA	NA	NA	NA
WP_058903938.1\|939654_941121_+	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_058903939.1\|941299_942781_-	MFS transporter	A0A0M3UL24	Mycobacterium_phage	1.1e-32	32.1
WP_006483275.1\|942831_943428_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_058903940.1\|943559_945032_-	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_034178445.1\|945142_945634_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_034203509.1\|945719_947120_-	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_006498158.1\|947280_948207_-	glyoxylate/hydroxypyruvate reductase A	NA	NA	NA	NA
WP_058903941.1\|948219_949080_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_034203511.1\|949484_950153_+	haloacid dehalogenase type II	NA	NA	NA	NA
WP_006482802.1\|950592_952176_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_006482806.1\|952255_953209_+	ABC transporter permease	NA	NA	NA	NA
WP_058903942.1\|953239_954199_+	ABC transporter permease	NA	NA	NA	NA
WP_058903943.1\|954198_956067_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	4.8e-14	31.1
WP_077175825.1\|956206_957541_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_034203514.1\|957564_957996_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_058903944.1\|958115_958850_+	cupin domain-containing protein	NA	NA	NA	NA
WP_058903945.1\|958852_960178_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_006498168.1\|960271_961741_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_058903946.1\|961810_962998_+	amidohydrolase	NA	NA	NA	NA
WP_006498170.1\|963103_964624_-	GGDEF domain-containing protein	NA	NA	NA	NA
WP_006481900.1\|964949_966245_+	MFS transporter	Q6JIH2	Burkholderia_virus	8.1e-61	35.7
WP_006481888.1\|966303_967086_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_058903947.1\|967110_968439_-	C4-dicarboxylate transporter DctA	NA	NA	NA	NA
WP_058903948.1\|968473_969397_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006481878.1\|969552_969744_-	hypothetical protein	NA	NA	NA	NA
WP_058903949.1\|970303_972448_+	hypothetical protein	NA	NA	NA	NA
WP_058903950.1\|972481_973717_+	hypothetical protein	NA	NA	NA	NA
WP_006498175.1\|973823_974837_+	hypothetical protein	NA	NA	NA	NA
WP_006481895.1\|975016_975331_-	hypothetical protein	NA	NA	NA	NA
WP_058902288.1\|975549_976494_+\|transposase	IS110 family transposase	Q75QL1	Wolbachia_phage	1.5e-24	32.7
WP_058903124.1\|976798_977809_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_058903124.1\|979913_980924_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_058903951.1\|981084_982623_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.0e-49	38.0
WP_058903124.1\|982916_983927_-\|transposase	IS110 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP011918

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP011920

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP011917

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP011919

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection