CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP008857	Pseudomonas aeruginosa strain F30658 chromosome, complete genome	1 crisprs	WYL,PD-DExK,csa3,DinG,DEDDh,cas3	0	0	11	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP008857_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP008857_1

3743746-3743840

Orphan

Consensus_repeat	Method
GCCGACAACGGCAGCGAGCAGACCGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP008857_1

>merge|NZ_CP008857|1|3743746-3743840|CRISPRCasFinder
GCCGACAACGGCAGCGAGCAGACCGTCGACCGCCTGCACAAGGACATGACCAAGGCCGAAGCCCGCCTGGCCGACAACGGCAGCGAACAGACCGT

>NZ_CP008857|1|1|3743746-3743840|CRISPRCasFinder
GCCGACAACGGCAGCGAGCAGACCGT	CGACCGCCTGCACAAGGACATGACCAAGGCCGAAGCCCGCCTG
GCCGACAACGGCAGCGAACAGACCGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP008857.1\|WP_003095483.1\|3738058_3738598_+\|MOSC-domain-containing-protein	unknown	unknown	gnl\|CDD\|225167
NZ_CP008857.1\|WP_003095526.1\|3753007_3753511_+\|urease-accessory-protein-UreE	unknown	unknown	gnl\|CDD\|237322
NZ_CP008857.1\|WP_003095503.1\|3742807_3743341_+\|bacterioferritin	unknown	unknown	gnl\|CDD\|225104
NZ_CP008857.1\|WP_003095479.1\|3737487_3737904_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|183165
NZ_CP008857.1\|WP_003095515.1\|3746194_3746884_+\|heavy-metal-response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|130454
NZ_CP008857.1\|WP_025297607.1\|3750889_3751990_-\|ferredoxin-reductase	unknown	unknown	gnl\|CDD\|99812
NZ_CP008857.1\|WP_003095513.1\|3745433_3746057_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP008857.1\|WP_003095488.1\|3738686_3739031_+\|osmotically-inducible-lipoprotein-OsmE	unknown	unknown	gnl\|CDD\|183058
NZ_CP008857.1\|WP_003112308.1\|3744001_3744769_-\|molybdopterin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|239026
NZ_CP008857.1\|WP_003099398.1\|3736047_3737313_+\|Hsp70-family-protein	unknown	unknown	gnl\|CDD\|212673
NZ_CP008857.1\|WP_015647955.1\|3744765_3745380_-\|cytochrome-b/b6-domain-containing-protein	unknown	unknown	gnl\|CDD\|226602
NZ_CP008857.1\|WP_003121132.1\|3749780_3750893_-\|fatty-acid-desaturase	unknown	unknown	gnl\|CDD\|225779
NZ_CP008857.1\|WP_015647956.1\|3740442_3742512_-\|AsmA-family-protein	unknown	unknown	gnl\|CDD\|225529
NZ_CP008857.1\|WP_003095519.1\|3748244_3749561_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341030
NZ_CP008857.1\|WP_003095496.1\|3739628_3740441_+\|c-di-GMP-binding-multidrug-transporter-transcriptional-regulator-BrlR	unknown	unknown	gnl\|CDD\|226231
NZ_CP008857.1\|WP_003121125.1\|3734976_3735840_-\|oxaloacetate-decarboxylase	unknown	unknown	gnl\|CDD\|225311
NZ_CP008857.1\|WP_003121124.1\|3734270_3734885_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP008857.1\|WP_003107570.1\|3752148_3752778_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|236881
NZ_CP008857.1\|WP_015647954.1\|3746862_3748254_+\|heavy-metal-sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|273593
NZ_CP008857.1\|WP_003095492.1\|3739074_3739482_-\|Rho-termination-factor-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|377850

Protein	Function_ID	Function_description	E-value
NZ_CP008857.1\|WP_003095483.1\|3738058_3738598_+\|MOSC-domain-containing-protein	gnl\|CDD\|225167	COG2258, COG2258, Uncharacterized protein conserved in bacteria [Function unknown].	5.52525e-29
NZ_CP008857.1\|WP_003095526.1\|3753007_3753511_+\|urease-accessory-protein-UreE	gnl\|CDD\|237322	PRK13261, ureE, urease accessory protein UreE; Provisional.	2.44267e-58
NZ_CP008857.1\|WP_003095503.1\|3742807_3743341_+\|bacterioferritin	gnl\|CDD\|225104	COG2193, Bfr, Bacterioferritin (cytochrome b1) [Inorganic ion transport and metabolism].	1.01703e-50
NZ_CP008857.1\|WP_003095479.1\|3737487_3737904_-\|hypothetical-protein	gnl\|CDD\|183165	PRK11505, PRK11505, phosphate starvation-inducible protein PsiF.	1.76735e-18
NZ_CP008857.1\|WP_003095515.1\|3746194_3746884_+\|heavy-metal-response-regulator-transcription-factor	gnl\|CDD\|130454	TIGR01387, Transcriptional_regulatory_protein_PcoR, heavy metal response regulator. Members of this family contain a response regulator receiver domain (pfam00072) and an associated transcriptional regulatory region (pfam00486). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc. Most members encoded by genes adjacent to genes for encoding a member of the heavy metal sensor histidine kinase family (TIGRFAMs:TIGR01386), its partner in the two-component response regulator system. [Regulatory functions, DNA interactions].	2.43467e-112
NZ_CP008857.1\|WP_025297607.1\|3750889_3751990_-\|ferredoxin-reductase	gnl\|CDD\|99812	cd06216, FNR_iron_sulfur_binding_2, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.	8.42632e-88
NZ_CP008857.1\|WP_003095488.1\|3738686_3739031_+\|osmotically-inducible-lipoprotein-OsmE	gnl\|CDD\|183058	PRK11251, PRK11251, osmotically-inducible lipoprotein OsmE.	1.90142e-51
NZ_CP008857.1\|WP_003112308.1\|3744001_3744769_-\|molybdopterin-dependent-oxidoreductase	gnl\|CDD\|239026	cd02108, bact_SO_family_Moco, bacterial subgroup of the sulfite oxidase (SO) family of molybdopterin binding domains. This domain is found in a variety of oxidoreductases. Common features of all known members of this family, like sulfite oxidase and nitrite reductase, are that they contain one single pterin cofactor and part of the coordination of the metal (Mo) is a cysteine ligand of the protein and that they catalyze the transfer of an oxygen to or from a lone pair of electrons on the substrate. The specific function of this subgroup is unknown.	5.57634e-96
NZ_CP008857.1\|WP_003099398.1\|3736047_3737313_+\|Hsp70-family-protein	gnl\|CDD\|212673	cd10231, YegD_like, Escherichia coli YegD, a putative chaperone protein, and related proteins. This bacterial subfamily includes the uncharacterized Escherichia coli YegD. It belongs to the heat shock protein 70 (HSP70) family of chaperones that assist in protein folding and assembly and can direct incompetent "client" proteins towards degradation. Typically, HSP70s have a nucleotide-binding domain (NBD) and a substrate-binding domain (SBD). The nucleotide sits in a deep cleft formed between the two lobes of the NBD. The two subdomains of each lobe change conformation between ATP-bound, ADP-bound, and nucleotide-free states. ATP binding opens up the substrate-binding site; substrate-binding increases the rate of ATP hydrolysis. YegD lacks the SBD. HSP70 chaperone activity is regulated by various co-chaperones: J-domain proteins and nucleotide exchange factors (NEFs). Some family members are not chaperones but instead, function as NEFs for their Hsp70 partners, other family members function as both chaperones and NEFs.	0
NZ_CP008857.1\|WP_015647955.1\|3744765_3745380_-\|cytochrome-b/b6-domain-containing-protein	gnl\|CDD\|226602	COG4117, COG4117, Thiosulfate reductase cytochrome B subunit (membrane anchoring protein) [Energy production and conversion].	2.81233e-70
NZ_CP008857.1\|WP_015647956.1\|3740442_3742512_-\|AsmA-family-protein	gnl\|CDD\|225529	COG2982, AsmA, Uncharacterized protein involved in outer membrane biogenesis [Cell envelope biogenesis, outer membrane].	0
NZ_CP008857.1\|WP_003121132.1\|3749780_3750893_-\|fatty-acid-desaturase	gnl\|CDD\|225779	COG3239, DesA, Fatty acid desaturase [Lipid metabolism].	7.76501e-66
NZ_CP008857.1\|WP_003095496.1\|3739628_3740441_+\|c-di-GMP-binding-multidrug-transporter-transcriptional-regulator-BrlR	gnl\|CDD\|226231	COG3708, COG3708, Uncharacterized protein conserved in bacteria [Function unknown].	1.65802e-48
NZ_CP008857.1\|WP_003121125.1\|3734976_3735840_-\|oxaloacetate-decarboxylase	gnl\|CDD\|225311	COG2513, PrpB, PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism].	1.3777e-87
NZ_CP008857.1\|WP_015647954.1\|3746862_3748254_+\|heavy-metal-sensor-histidine-kinase	gnl\|CDD\|273593	TIGR01386, Probable_sensor_protein_PcoS, heavy metal sensor kinase. Members of this family contain a sensor histidine kinase domain (pfam00512) and a domain found in bacterial signal proteins (pfam00672). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc.	0
NZ_CP008857.1\|WP_003107570.1\|3752148_3752778_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|236881	PRK11202, PRK11202, HTH-type transcriptional repressor FabR.	4.59942e-41
NZ_CP008857.1\|WP_003095519.1\|3748244_3749561_-\|MFS-transporter	gnl\|CDD\|341030	cd17477, MFS_YcaD_like, YcaD and similar transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MFS-type transporter YcaD, Bacillus subtilis MFS-type transporter YfkF, and similar proteins. They are uncharacterized transporters belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	8.70918e-108
NZ_CP008857.1\|WP_003095492.1\|3739074_3739482_-\|Rho-termination-factor-N-terminal-domain-containing-protein	gnl\|CDD\|377850	pfam07498, Rho_N, Rho termination factor, N-terminal domain. The Rho termination factor disengages newly transcribed RNA from its DNA template at certain, specific transcripts. It it thought that two copies of Rho bind to RNA and that Rho functions as a hexamer of protomers. This domain is found to the N-terminus of the RNA binding domain (pfam07497).	0.000208897

>NZ_CP008857.1|WP_003095503.1|3742807_3743341_+|bacterioferritin
MTTVQLTDVQTLRDRARKNIQEGAVTEGYSADRQTVLRLLNEALATELVCFLRYKRHYFMATGLKASIAAAEFLEHANQEMQHADQLAERIMQLGGEPDFNPRGLEERSHAEYVEGKTLKDMVTENLIAERIAIDSYREIITYLGNDDPTTRRIFEEILAQEEEHADDMADILDDLA
>NZ_CP008857.1|WP_015647956.1|3740442_3742512_-|AsmA-family-protein
MTRGRKILTWSLASLVLLLAALVVFIATFDWNLIKPTLNEKVSAALNRPFAINGNLAVAWRREEGEEGWRAWIPWPRFSAEDITLGNPEWTAGKTKASEFASLERIEFRLAPLPLLWQTIRIPQIKLTQPRADLLRLADGRANWDFDLPASDSDEPSAWQLDIREIGFDKGSVSLDDQRLKTRLEVLVDPLGKPVPFGQLAGKALATGDAANAQDYVFGWKVKGTYKGQALAGSGKVGGMLALQDASKPFPLQAEVSAGSTRAAVVGTLTDPLNLGALDLRLKLSGTSMANLYPLTGITLPDTPAYSTDGHLLARLKEEGGALFRYENFNGKVGASDLHGSLTFVARQPRPKLSGKLTSEQLRFADLGPLIGADSNAEKQKRGQTSRQPGDKVLPVEEFRTERWRDMDADVEFTGKRIVHSDQLPISDLYTHLVLNDGLLRLEPLRFGVAGGKLESDIRLDGGKQPMQSRVKMSARGFKLKQLFPGFAPMQTSFGELNGDASLSGSGNSVAKILGGADGELKMLINDGAISKGLTEIAGLNVGNYLVTKLFGDDEVKINCAAADFGLQKGLMTSRLFVFDTENALVNVDGTVNFANEKLDLDVTPHSKGLRIFSLRSPLYVRGTFAKPDAGVHAGPLVARGAGMIALGVTVGPAASLLALVAPSKSDDNQCTALLQRMRLPAKVPAGKR
>NZ_CP008857.1|WP_003095496.1|3739628_3740441_+|c-di-GMP-binding-multidrug-transporter-transcriptional-regulator-BrlR
MLTIGQLARIFEISTKTLRHYDAIGLFVPARTGSDNGYRYYQPEQIEQLSRILALRRLDVPLEAIDRLKRDGALDDPQRLRHFLQRHQHTLREEISARQRLLAELDRTLATLAHWRIRNMHARIVERPAFSVVGMEYFGSAPGDTIGQLWERFIPREHEIAGKHDPEVSYGICAQQPNGEFHYVAGFEVQEGWPVPEGMVRFQVPAQKYAVFTHKGTAPQIAESFQAIYSHLLAERGLEPKAGVDFEYYDQRFRGPLDPNSQVDLYIPIY
>NZ_CP008857.1|WP_003095492.1|3739074_3739482_-|Rho-termination-factor-N-terminal-domain-containing-protein
MPRGDKSKYSDKQQRKAEHIEESYKAKGVSESEAEARAWATVNKQSGGGERKGGSGRAKSETAKRADRKDSAHRAAQARSGRPANRGSASRGKRQGSTSVSEMTREELMQLARKRDIRGRSTMRKAELIEALSRA
>NZ_CP008857.1|WP_003095488.1|3738686_3739031_+|osmotically-inducible-lipoprotein-OsmE
MYKQSLAALFVMATLAGCASTKVQNPVNYITFRNEPLVKDVEKGMSQQEVLRIGGTPSGTQKRLMKPGSCNSYILNKDGQQQPFYVSFDGSGKVDGSGFLSCSELDRHERDARP
>NZ_CP008857.1|WP_003095483.1|3738058_3738598_+|MOSC-domain-containing-protein
MQQVIAVSLCATHAFSKQVRPAIRLLKGLGVEGDAHHGVTVKHRSRVRQDPTQPNLRQVHLIHEELHDELRASGFAIGPGTMGENITTRGVDLLGLPTGTRLRLGESALVELTGLRNPCSQLDNYQPGLTAAVLGRDEQGNLIRKAGVMAIVLEDGEVRPGDAIDIQLPPLPHRALEKV
>NZ_CP008857.1|WP_003095479.1|3737487_3737904_-|hypothetical-protein
MNILRIPMFVLAMAVSAHGFAATAQQEKMTACNAEATTKALKGDERKAFMSGCLKAGAPAGGKATAQQEKMKSCNADASAKSLKGDERKAFMSSCLKAGGSAKAATQQEKMKTCNADATAKALKGDERKAFMSTCLKK
>NZ_CP008857.1|WP_003099398.1|3736047_3737313_+|Hsp70-family-protein
MNPSTAARALGIDFGTSNSTVGWWRPEVEPLIELEDGKITLPSVVFFNVEERRPVYGRQALGEYLEGYEGRLMRSLKSLLGSKLLKSETTVLGSALPFKDLLGLFIGQLKARGEAAAGQAFDAVVLGRPVFFVDDDPEADREAQDTLVQVANKLGFKEVSFQYEPIAAAFDYERCIQREELVLIVDIGGGTSDFSLVRLAPERRNLAERQDDILATGGVHIGGTDFDKQLSLEGVMPLFGYGSRMKSDAFMPTSYHLNLATWHTINAVYAQKSQLALKNMRYDIVDSTGIDRLFRLIEERAGHWLAMQVEDSKIRLTETERLHLSLERIEAGLGVELTRGLFENAVDGLLERVRNSVAQLLASAGVDPDRVDTVFFTGGSSGIPALRRSVSAMLPNARHVEGNLFGSIGSGLAIEAKKRYG
>NZ_CP008857.1|WP_003121125.1|3734976_3735840_-|oxaloacetate-decarboxylase
MHRASHHELRAMFRALLDSSRCYHTASVFDPMSARIAADLGFECGILGGSVASLQVLAAPDFALITLSEFVEQATRIGRVARLPVIADADHGYGNALNVMRTVVELERAGIAALTIEDTLLPAQFGRKSTDLICVEEGVGKIRAALEARVDPALTIIARTNAELIDVDAVIQRTLAYQEAGADGICLVGVRDFAHLEAIAEHLHIPLMLVTYGNPQLRDDARLARLGVRVVVNGHAAYFAAIKATYDCLREERGAVASDLTASELSKKYTFPEEYQAWARDYMEVKE
>NZ_CP008857.1|WP_003121124.1|3734270_3734885_+|hypothetical-protein
MMGPFRRLAHLIDQGRQLDAALAGDPFALPAPEDRYSVRQLHGLYPRRHPGLYAPLLGSLALLLGAAPLGLAALRLALPEAPLRPLGWLSALPLLAAWLWLIALLSRGASLGPRLARDASLLLVATGLLLRLASGETSGLVALGGGACAWLLFNSRAMQRYMELVYAQRLYRAQSANRPGSAQRRLANQAAYRERKRRERSGRS
>NZ_CP008857.1|WP_003112308.1|3744001_3744769_-|molybdopterin-dependent-oxidoreductase
MKGPEKKRAKIAIDPSSERQMVDLQRRLLLRGGLSLGALAMLSGCRLQDGDSVDKVLWAMSRWNDRVQAWLFSRTRLAPTFDPSQVASPFPFNAFYPAYNVPEIDLPEYRLQVSGRVRDKRPWSLEQLRRLPQASQVTQLICIEGWSAIGQWSGVPLRTFLELVGADTSAKYVGFKCADRYYSSLDMPSALHPQTLLALEMSGQALPEENGYPLRLRIPTKLGFKNAKHVVEIFVSNSNPGGYWEDQGYNWFSGV
>NZ_CP008857.1|WP_015647955.1|3744765_3745380_-|cytochrome-b/b6-domain-containing-protein
MNRALHAWPVRLCHWLNAYAMACLIGSGWGIYNASPLLDFRFPAWATLGGWLGGSIAWHLAAMWLLLGNGLCYLAYGLSSGHFRRDFLPLSAAGVWRDLRLALGLRLVHEPGRYNAVQRLLYWLVLGLGALLVLSGLAIWKPVQLHGLTVLFGGFQGARWVHFLAMAGVVGFVVVHLLLVLLVPRTLLPMIIGREWRRGRRSEG
>NZ_CP008857.1|WP_003095513.1|3745433_3746057_-|hypothetical-protein
MLRLKASPALLFGLLLASAASFAAQPPAGMLQPLRGTIQQAADDHLQLKARNGQQLTVRLTDKTAIRAVSLAKPEDIQPDSFIGTAAVPQPDGTLKALEVHVFAPSLRGSGEGHRPWENADGSASTMTNGTVGNLVVSQGRRMTVKYGDGEKTVVVPDDVPIVSLEPGERSLLKPGAKVVLFPQKGADGSLTALAISVGKDGVTPPM
>NZ_CP008857.1|WP_003095515.1|3746194_3746884_+|heavy-metal-response-regulator-transcription-factor
MRILVIEDDTKTGEYLKKGLGESGYAVDWSQHGADGLYLALENRYDLVVLDVMLPGLDGWQIMEVLRKKHDVPVLFLTARDQLQDRIRGLELGADDYLVKPFSFTELLLRIRTLLRRGVVREAEQVQLADLQLDVLRRKVSRQGQVIALTNKEFALLHLLMRREGEVLSRTLIASEVWDMNFDSDTNVVDVAIKRLRAKVDNPFPNKLIHTVRGIGYVCEERPCPPAAP
>NZ_CP008857.1|WP_015647954.1|3746862_3748254_+|heavy-metal-sensor-histidine-kinase
MPARRSLTLYAALLFAAVAALVVSAVGFYLYRSVEEAMLRRSDVMVAGRVEHFRNLLRDNLTLAELKARPRLFENMLGNEQDILLLGQPGEAPIVAVNPRHERLPSLRVVAAGQALNPSVVHAALTHDGVPMRVLAAEVLVGGREPLQITAAHLLLGETRMLAQYRDRVIAAVLLAFLGTALLGWLVLRHGLRPLRTLAAKAAEIHPTSLDTRLDVAAAPAELQQVAQSFNAMLERLDDGYQRLQQFSADLAHEIRTPIGSLMGHGQVALRQPRSNEEYQALIASNQEELERIARMVESILFLARADDVRAAVERSRLDLGEELRRQAEYFEGLAEERGLSLDVQVSGQLRADPQLFRRALSNLLANAIRYASADSLIEVRGLRRSGEFLLSVENACDRLPAEPLSRLFDRFYRGDAARSDAQSSGLGLAIVQAIMRLHGGRAEASAPAPGRIRFDLAFPAQD
>NZ_CP008857.1|WP_003095519.1|3748244_3749561_-|MFS-transporter
MFSPLVTFPALYTATLLMLAGSGLFTTYIGLRLTQEGAGDLWVGGLMASYYFGLVCGGKFGHKLIASFGHIRSYVACAGIATVTVLLHALVDQLEVWLLLRFITGAVMMNQYMVIESWLNEQAESHQRGKVFAGYMVAVDLGLVLGQGLLALSPTLDYKPLLLVAICFASCLIPLAMTRRVHPAKLVAAPLEVRFFWQRVPQALGTIFIAGLMVGAFYGLAPVYANRNGLDASQSSFFVGMCIVAGFCAQWPLGWLSDRLDRSWLIRGNAVLLCLASIPMWGLVTLPYWLLLANGFVTGMLLFTLYPLAVALANDHVEQPRRVALSAMLLTTYGVGACIGPLVAGALMRHFGPGLFYMLVSGYAVLLVFWVQPKRVTGEHRVDEAPLQHVAMPDTVSPMAATLDPRVEEVPEELVVEAPANIGRSDGEPDAGEKPAQS
>NZ_CP008857.1|WP_003121132.1|3749780_3750893_-|fatty-acid-desaturase
MNRPASPAMRDDRELTPEQLAAFGAELDALRLRTLADLGADDARYIRRVRAAVRVCCWSGRALLMFGWLPPTWLLGSLLLGLGKILENMELGHNVMHGQYDWMNDPEFAGRAYEWDIAGPSDFWRHTHNHIHHTYTNVLGKDDDVGYGVVRLFPEQRWKPFYRWQPLWVTLQALLFQYAVAIQHLRLDKYAKGRLDKAELMPLLRRLRAKLGRQWTKDYLLFPLLGLFAGGFGAVFVGNLLANVLRNLWTFTVIFCGHFTEKAVVFPPSVLEGETRGHWYLRQLRGSSNLEGGPLFHILTGNLSHQIEHHLYPDLPARRYAALSREVREIARRYGQTYNSGRLGRQFLTVLRRIWVYRLPPREPLPAGRG
>NZ_CP008857.1|WP_025297607.1|3750889_3751990_-|ferredoxin-reductase
MALLPLALLTPLLAPLRRLAARGWLREVDVDGLLRHAHPLASLNRHYARVEARYWVADDMLALALRTAPGWPPVRPGQHIQLLAERDGVRVGRSYSLTRVVGERLEIAVKRHPDGLLSPWLCEHLAVGQRVELQPAQGDLRWPMQAEAVCLLAAGSGLTPLLGLLREALENGYRGPVLWLHYVRHPGQRAWLGELEALAARHPNLELRWSLTRGARADGCLEGHFQPRHLDGWAADLARSQALACGPAAFVEAVGEQLGARFAGLQTESFSVPRWRSGEAPREVRLRFARSQREVSGDSAASLLEQAEAHGLRPAHGCRQGICASCTCVLLSGCVRDLRSGALCSEPGQPIRLCVSAAHGDLALDL
>NZ_CP008857.1|WP_003107570.1|3752148_3752778_+|TetR-family-transcriptional-regulator
MSSPRAEQKQQTRHALMSAARHLMESGRGFGSLSLREVTRAAGIVPAGFYRHFSDMDQLGLALVAEVDETFRATLRAVRRNEFELGGLIDASVRIFLDAVGANRSQFLFLAREQYGGSLPIRQAIASLRQRITDDLAADLALLNKMPHLDGAALDVFADLVVKTVFATLPELIDPPAADLPPHLMPAAKITHQLRFIMIGGKHWHGLPG
>NZ_CP008857.1|WP_003095526.1|3753007_3753511_+|urease-accessory-protein-UreE
MLVIHQRLPARSPRWDEELHLTYEARSKSRLRCFAASGEEVGLFLERGQPPLADGDCLEARDGRLVRVVARSERLLHVTCASPLELTRAAYHLGNRHVALQVGDGWLRLLDDYVLKAMLEQLGATVEAIEAPFQPEHGAYGGGHHHSHHGEAEFNYAPRLHQFGVRR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

100408 : 182716

Escherichia_phage(16.67%)

transposase,tRNA,integrase,protease

attL 89164:89181|attR 178392:178409

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
89164:89181	attL	NA	NA	NA	NA
WP_011914409.1\|100408_102574_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011914410.1\|102570_103590_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_059319034.1\|103880_104318_-	translesion error-prone DNA polymerase V autoproteolytic subunit	O64339	Escherichia_phage	2.3e-07	31.9
WP_059319035.1\|104631_106905_-	ATP-dependent DNA helicase	NA	NA	NA	NA
WP_059319036.1\|106901_108542_-	VRR-NUC domain-containing protein	NA	NA	NA	NA
WP_128688249.1\|108897_109182_+	hypothetical protein	NA	NA	NA	NA
WP_059319037.1\|109196_109916_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_059319038.1\|109940_110909_-	metallophosphoesterase	V9QL63	Rhizobium_phage	5.1e-07	28.9
WP_059319039.1\|112013_113075_+	ADP-ribosylglycohydrolase family protein	NA	NA	NA	NA
WP_095461360.1\|113182_113467_+	hydrolase	NA	NA	NA	NA
WP_079760958.1\|113648_114545_+	WYL domain-containing protein	NA	NA	NA	NA
WP_059319042.1\|114541_115312_+	hypothetical protein	NA	NA	NA	NA
WP_023127677.1\|115304_115850_+	DUF1788 domain-containing protein	NA	NA	NA	NA
WP_059319043.1\|115913_119378_+	BREX system P-loop protein BrxC	NA	NA	NA	NA
WP_059319044.1\|119377_122920_+	N-6 DNA methylase	NA	NA	NA	NA
WP_059319045.1\|122922_123900_+	DUF932 domain-containing protein	NA	NA	NA	NA
WP_059319046.1\|123896_125690_+	DUF262 domain-containing protein	NA	NA	NA	NA
WP_057391036.1\|125706_126810_+	AAA family ATPase	A0A077SLJ9	Escherichia_phage	5.7e-15	22.6
WP_059319047.1\|126806_127490_+	DUF4276 family protein	NA	NA	NA	NA
WP_059319048.1\|127504_129823_+	BREX-1 system phosphatase PglZ type B	NA	NA	NA	NA
WP_104064747.1\|129829_131872_+\|protease	protease Lon-related BREX system protein BrxL	NA	NA	NA	NA
WP_059319050.1\|131880_133125_+	hypothetical protein	NA	NA	NA	NA
WP_057391040.1\|133121_133721_+	hypothetical protein	NA	NA	NA	NA
WP_059319166.1\|133720_136492_+	hypothetical protein	NA	NA	NA	NA
WP_059319051.1\|136488_137475_+	hypothetical protein	NA	NA	NA	NA
WP_059319052.1\|137575_137758_-	hypothetical protein	NA	NA	NA	NA
WP_059319053.1\|137768_138266_-	DNA repair protein RadC	NA	NA	NA	NA
WP_059319054.1\|138237_139188_-	hypothetical protein	NA	NA	NA	NA
WP_059319055.1\|139279_140284_-	YqaJ viral recombinase family protein	A6XMH8	Bacillus_virus	5.5e-49	39.0
WP_003285520.1\|140440_140671_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_009408500.1\|140670_141075_+\|tRNA	tRNA(fMet)-specific endonuclease VapC	NA	NA	NA	NA
WP_059319056.1\|141161_142130_-	DUF932 domain-containing protein	A0A0H4INH5	Stenotrophomonas_phage	3.9e-60	43.2
WP_017940252.1\|143402_144446_+	WYL domain-containing protein	NA	NA	NA	NA
WP_059319057.1\|144442_146005_+	hypothetical protein	NA	NA	NA	NA
WP_059319058.1\|146027_146663_+	hypothetical protein	NA	NA	NA	NA
WP_059319059.1\|146675_147698_+	hypothetical protein	NA	NA	NA	NA
WP_078463402.1\|147751_148048_+	YkgJ family cysteine cluster protein	NA	NA	NA	NA
WP_023127699.1\|149044_149317_+	CopG family ribbon-helix-helix protein	NA	NA	NA	NA
WP_078463403.1\|149304_149598_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_023127700.1\|149591_151001_-\|integrase	site-specific integrase	A0A2H4IYX8	uncultured_Caudovirales_phage	1.2e-54	37.5
WP_015649025.1\|151859_153785_+	SAM-dependent DNA methyltransferase	A0A220A2U5	Liberibacter_phage	7.9e-44	30.2
WP_015649024.1\|153774_155142_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_025297974.1\|155292_157488_+	anti-phage defense ZorAB system ZorA	NA	NA	NA	NA
WP_015649022.1\|157501_158239_+	OmpA family protein	NA	NA	NA	NA
WP_015649021.1\|158239_159883_+	hypothetical protein	NA	NA	NA	NA
WP_015649020.1\|159882_163134_+	DEAD/DEAH box helicase	A0A160DHD3	Gordonia_phage	6.8e-32	27.2
WP_033895419.1\|163204_166057_+	AAA family ATPase	K4I1H4	Acidithiobacillus_phage	2.2e-34	43.9
WP_045175673.1\|166110_167361_+	McrC family protein	NA	NA	NA	NA
WP_025297899.1\|167382_170484_+	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	2.2e-64	28.1
WP_104064744.1\|170622_171785_-\|transposase	IS3 family transposase	Q716C2	Shigella_phage	6.1e-84	53.2
WP_003114399.1\|171989_172214_-	type I toxin-antitoxin system SymE family toxin	NA	NA	NA	NA
WP_015649013.1\|172535_173885_-	hypothetical protein	NA	NA	NA	NA
WP_033954799.1\|173881_180178_-	DUF4011 domain-containing protein	NA	NA	NA	NA
178392:178409	attR	NA	NA	NA	NA
WP_004344339.1\|180192_180831_-	4Fe-4S cluster-binding domain-containing protein	NA	NA	NA	NA
WP_003122571.1\|180832_182716_-\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A2L0V0F4	Agrobacterium_phage	4.4e-39	32.3

DBSCAN-SWA_2

305325 : 312219

uncultured_Caudovirales_phage(83.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003097631.1\|305325_306606_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	8.2e-98	45.4
WP_025297439.1\|306607_308005_+	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_003097628.1\|308009_308984_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_003097625.1\|309071_310055_-	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	3.5e-141	74.0
WP_003119979.1\|310051_310387_-	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	1.5e-38	69.4
WP_003090391.1\|310383_310689_-	sulfurtransferase complex subunit TusB	NA	NA	NA	NA
WP_012613994.1\|310688_311048_-	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	3.1e-34	61.7
WP_003090387.1\|311044_311440_-	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	2.7e-47	72.1
WP_003090386.1\|311550_312219_-	Bax inhibitor-1/YccA family protein	A0A2H4JFM9	uncultured_Caudovirales_phage	1.5e-90	82.1

DBSCAN-SWA_3

460604 : 518057

Pseudomonas_phage(69.84%)

transposase,tail,terminase,integrase,holin

attL 462467:462483|attR 521649:521665

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033955183.1\|460604_463490_+	transporter substrate-binding domain-containing protein	A0A1V0SGX0	Hokovirus	1.9e-33	27.4
462467:462483	attL	NA	NA	NA	NA
WP_003099002.1\|463580_464114_+	hypothetical protein	NA	NA	NA	NA
WP_031639986.1\|464575_465640_-\|integrase	tyrosine-type recombinase/integrase	A0A2H4JDJ8	uncultured_Caudovirales_phage	5.2e-114	58.4
WP_003158549.1\|465641_465875_-	DUF4224 domain-containing protein	A0A2H4JF29	uncultured_Caudovirales_phage	5.6e-13	50.7
WP_057391168.1\|465931_466318_-	hypothetical protein	L7TJJ9	Pseudomonas_virus	1.0e-64	99.2
WP_061447309.1\|466429_467128_-	hypothetical protein	L7TKP8	Pseudomonas_virus	2.6e-29	39.3
WP_057391167.1\|467237_469004_-	DEAD/DEAH box helicase	A0A0U1UNQ7	Pseudomonas_phage	0.0e+00	99.5
WP_057391166.1\|469000_469381_-	hypothetical protein	A0A0U1UNQ6	Pseudomonas_phage	1.1e-63	97.6
WP_023115858.1\|469377_469701_-	DUF4406 domain-containing protein	H2BD42	Pseudomonas_phage	6.1e-58	100.0
WP_057391169.1\|469697_470192_-	DUF550 domain-containing protein	L7TI87	Pseudomonas_virus	3.3e-87	94.5
WP_057391165.1\|470341_470770_-	hypothetical protein	A0A0U1T4M5	Pseudomonas_phage	5.2e-73	96.5
WP_057391164.1\|470766_472677_-	DNA cytosine methyltransferase	A0A0U1T6D1	Pseudomonas_phage	7.0e-287	92.6
WP_124201434.1\|473223_473610_+	hypothetical protein	NA	NA	NA	NA
WP_024928604.1\|473619_474081_-	hypothetical protein	A0A2H4J101	uncultured_Caudovirales_phage	2.2e-53	64.1
WP_043501402.1\|474077_474305_-	hypothetical protein	NA	NA	NA	NA
WP_057391162.1\|474353_476096_-	AAA family ATPase	H2BD46	Pseudomonas_phage	6.5e-239	76.9
WP_057391161.1\|476099_476864_-	hypothetical protein	J7I0T4	Pseudomonas_phage	8.3e-122	77.7
WP_009314053.1\|476874_477075_-	hypothetical protein	J7I437	Pseudomonas_phage	1.9e-30	100.0
WP_023130710.1\|477081_477900_-	hypothetical protein	H2BD49	Pseudomonas_phage	2.1e-155	99.3
WP_057391160.1\|477911_478715_-	PD-(D/E)XK nuclease family protein	H2BD50	Pseudomonas_phage	4.4e-150	96.3
WP_003116743.1\|478722_478860_-	hypothetical protein	J7I432	Pseudomonas_phage	8.3e-17	100.0
WP_057391159.1\|478843_479497_-	hypothetical protein	NA	NA	NA	NA
WP_016263322.1\|479489_479672_-	hypothetical protein	Q9MC67	Pseudomonas_phage	2.7e-23	96.6
WP_003099037.1\|479668_479890_-	hypothetical protein	H2BD53	Pseudomonas_phage	1.2e-33	100.0
WP_166803927.1\|479873_480026_-	hypothetical protein	J7HXJ0	Pseudomonas_phage	2.6e-11	100.0
WP_057391158.1\|480601_480973_-	carbon storage regulator CsrA	J7I430	Pseudomonas_phage	2.5e-63	99.2
WP_057391157.1\|481021_481285_-	hypothetical protein	A0A127KNM4	Pseudomonas_phage	6.9e-44	95.4
WP_033992580.1\|482010_482343_+	DUF1654 domain-containing protein	H2BD60	Pseudomonas_phage	1.0e-44	88.9
WP_031300117.1\|482620_483070_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_073660449.1\|483266_483692_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_071537930.1\|483828_484188_-	DUF4440 domain-containing protein	NA	NA	NA	NA
WP_049246861.1\|484526_485099_-	S24 family peptidase	H2BD63	Pseudomonas_phage	5.5e-86	91.1
WP_003451709.1\|485476_485695_+	helix-turn-helix domain-containing protein	A0A2D1GND2	Pseudomonas_phage	2.9e-19	64.7
WP_031634268.1\|485726_486299_+	hypothetical protein	H2BD67	Pseudomonas_phage	4.6e-101	98.9
WP_079276375.1\|486301_487264_+	hypothetical protein	A0A2H4JCW9	uncultured_Caudovirales_phage	3.6e-13	47.4
WP_031652669.1\|487391_487805_+	hypothetical protein	NA	NA	NA	NA
WP_019396730.1\|487797_488241_+	RusA family crossover junction endodeoxyribonuclease	J7I4J7	Pseudomonas_phage	2.1e-77	99.3
WP_033992585.1\|488269_489139_+	hypothetical protein	J7HXH6	Pseudomonas_phage	3.4e-164	97.2
WP_023105198.1\|489275_489467_-	hypothetical protein	NA	NA	NA	NA
WP_023105199.1\|489551_489935_+	hypothetical protein	J7I0R6	Pseudomonas_phage	3.5e-60	98.4
WP_023083724.1\|489927_490212_+\|holin	phage holin family protein	H2BD74	Pseudomonas_phage	2.7e-41	98.9
WP_022579916.1\|490220_490817_+\|terminase	terminase small subunit	H2BD75	Pseudomonas_phage	4.4e-46	60.5
WP_057391132.1\|490803_492099_+\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	9.7e-147	59.5
WP_057391131.1\|492101_493457_+	DUF4055 domain-containing protein	A0A0H5AWC7	Pseudomonas_phage	6.2e-96	45.6
WP_023101099.1\|493453_494533_+	hypothetical protein	A0A0S2SY77	Pseudomonas_phage	2.3e-202	98.6
WP_003103389.1\|494661_495405_+	hypothetical protein	A0A0H5AWD1	Pseudomonas_phage	2.2e-87	75.5
WP_003103391.1\|495414_496386_+	hypothetical protein	A0A0M3LQL5	Mannheimia_phage	9.3e-110	64.7
WP_034004075.1\|496426_496912_+	hypothetical protein	NA	NA	NA	NA
WP_034004073.1\|496895_497360_+	hypothetical protein	H9EB35	Vibrio_phage	3.0e-10	36.4
WP_034004070.1\|497359_497749_+	hypothetical protein	A0A2H4JAS3	uncultured_Caudovirales_phage	2.8e-33	55.0
WP_034004067.1\|497750_497978_+	hypothetical protein	NA	NA	NA	NA
WP_057391130.1\|497981_498656_+	hypothetical protein	A0A0S2SY81	Pseudomonas_phage	2.5e-114	95.5
WP_022579906.1\|498652_499063_+	DUF4128 domain-containing protein	A0A1B0VMI0	Pseudomonas_phage	3.0e-25	44.1
WP_042853830.1\|499130_499784_+\|tail	phage tail protein	A0A2H4IZV5	uncultured_Caudovirales_phage	7.7e-60	52.3
WP_019396742.1\|499793_500174_+\|tail	phage tail assembly chaperone	A0A2H4IYQ5	uncultured_Caudovirales_phage	3.1e-29	51.2
WP_012075338.1\|500236_500500_+	DUF1799 domain-containing protein	A0A2R3UAE2	Siphoviridae_environmental_samples	1.4e-15	46.0
WP_057391129.1\|500496_503721_+\|tail	phage tail tape measure protein	A0A0S2SYD9	Pseudomonas_phage	6.0e-113	36.6
WP_023130692.1\|503726_504065_+\|tail	phage tail protein	A0A0S2SYI2	Pseudomonas_phage	2.2e-58	96.4
WP_023130691.1\|504061_504811_+\|tail	phage minor tail protein L	A0A0S2SY57	Pseudomonas_phage	2.5e-147	99.2
WP_023101106.1\|504813_505569_+	C40 family peptidase	A0A0S2SY75	Pseudomonas_phage	3.3e-147	98.8
WP_104064761.1\|505594_505774_+	hypothetical protein	A0A0S2SYE8	Pseudomonas_phage	2.3e-22	98.1
WP_010794468.1\|505815_507042_+\|transposase	IS256-like element ISPa1328 family transposase	A0A218MNI5	uncultured_virus	8.0e-50	47.1
WP_023101107.1\|507162_507393_-	hypothetical protein	A0A0S2SY71	Pseudomonas_phage	4.8e-17	97.7
WP_124130527.1\|507429_507750_-	hypothetical protein	A0A0S2SYA2	Pseudomonas_phage	1.0e-41	98.8
WP_128551610.1\|507959_508523_+	hypothetical protein	A0A0S2SYF4	Pseudomonas_phage	1.4e-30	98.5
WP_033959056.1\|508593_509178_+\|tail	tail assembly protein	A0A0S2SYS2	Pseudomonas_phage	4.3e-102	97.9
WP_057391128.1\|509737_513298_+	DUF1983 domain-containing protein	A0A0S2SYC5	Pseudomonas_phage	0.0e+00	76.1
WP_071557737.1\|513294_513579_+	hypothetical protein	NA	NA	NA	NA
WP_031674996.1\|514468_515236_+	hypothetical protein	A0A2H4J1J6	uncultured_Caudovirales_phage	2.7e-56	51.8
WP_057391127.1\|515279_515909_+	glycoside hydrolase family 19 protein	J7I4M6	Pseudomonas_phage	1.9e-111	95.7
WP_057391126.1\|515905_516274_+	hypothetical protein	H2BDA0	Pseudomonas_phage	7.7e-49	89.3
WP_057391125.1\|516270_516534_+	hypothetical protein	A0A125RNP3	Pseudomonas_phage	2.9e-34	90.5
WP_057391124.1\|516569_516836_+	hypothetical protein	L7TP56	Pseudomonas_virus	1.6e-43	95.5
WP_057391123.1\|516817_517504_-	SOS response-associated peptidase	A0A2K8I970	Pseudomonas_phage	2.7e-119	89.0
WP_003102458.1\|517541_518057_-	hypothetical protein	L7TIE6	Pseudomonas_virus	5.8e-95	94.7
521649:521665	attR	NA	NA	NA	NA

DBSCAN-SWA_4

780828 : 820171

Planktothrix_phage(33.33%)

tail,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015648865.1\|780828_782106_-\|tail	pyoverdine-tailoring periplasmic protein PvdN	NA	NA	NA	NA
WP_012614138.1\|782117_783476_-\|tail	pyoverdine-tailoring dipeptidase-like protein PvdM	NA	NA	NA	NA
WP_025297422.1\|783690_785328_+	pyoverdine maturation tyrosinase PvdP	NA	NA	NA	NA
WP_031757762.1\|785376_786801_-	pyoverdine export/recycling transporter outer membrane subunit OmpQ	NA	NA	NA	NA
WP_003131508.1\|786806_788798_-	pyoverdine export/recycling transporter ATP-binding/permease subunit PvdT	G9BWD6	Planktothrix_phage	6.9e-35	39.3
WP_015648862.1\|788797_789973_-	pyoverdine export/recycling transporter periplasmic adaptor subunit PvdR	NA	NA	NA	NA
WP_015648861.1\|790073_791069_-	FecR family protein	NA	NA	NA	NA
WP_003103620.1\|791232_791712_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_015648860.1\|791844_793176_+	L-ornithine N(5)-monooxygenase	NA	NA	NA	NA
WP_003144019.1\|793298_795587_+	acylase	NA	NA	NA	NA
WP_003089535.1\|795767_796091_+	transcriptional repressor	NA	NA	NA	NA
WP_003114511.1\|796132_797053_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_033895540.1\|797149_798301_+	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
WP_003089526.1\|798367_798610_-	DUF1654 domain-containing protein	NA	NA	NA	NA
WP_003104944.1\|798904_799141_+	hypothetical protein	NA	NA	NA	NA
WP_003089521.1\|799407_799878_+	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_025297421.1\|799874_802190_+	xanthine dehydrogenase family protein molybdopterin-binding subunit	NA	NA	NA	NA
WP_023085259.1\|802606_803812_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003110901.1\|804012_804654_-	response regulator transcription factor	NA	NA	NA	NA
WP_003089513.1\|804930_805326_+	DUF4280 domain-containing protein	NA	NA	NA	NA
WP_015648858.1\|805348_805885_-	toxin-antitoxin system YwqK family antitoxin	NA	NA	NA	NA
WP_025297420.1\|805895_807899_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	4.5e-42	29.6
WP_003116945.1\|807905_808691_-	hypothetical protein	NA	NA	NA	NA
WP_003116944.1\|808760_809636_-	hypothetical protein	NA	NA	NA	NA
WP_019371762.1\|809726_812276_-	type VI secretion system ATPase TssH	H6X3M6	Enterobacteria_phage	4.2e-77	29.4
WP_025297419.1\|812277_813294_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_025297418.1\|813257_815051_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_003122696.1\|815034_815460_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_003089495.1\|815472_815970_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_003089494.1\|816043_817528_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_003089493.1\|817550_818096_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_003089492.1\|818303_818780_+	hypothetical protein	NA	NA	NA	NA
WP_031629011.1\|818839_820171_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA

DBSCAN-SWA_5

2569289 : 2576552

Pseudomonas_phage(100.0%)

integrase

attL 2568883:2568913|attR 2578668:2578698

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2568883:2568913	attL	NA	NA	NA	NA
WP_057390935.1\|2569289_2570285_-\|integrase	tyrosine-type recombinase/integrase	Q56VN7	Pseudomonas_phage	2.9e-98	54.3
WP_033980047.1\|2570284_2571577_-	hypothetical protein	Q56VN8	Pseudomonas_phage	2.9e-252	96.3
WP_057390934.1\|2571834_2573097_-	hypothetical protein	Q56VN9	Pseudomonas_phage	6.0e-117	55.9
WP_003159569.1\|2573098_2573449_-	DUF2523 domain-containing protein	Q56VP0	Pseudomonas_phage	5.5e-20	41.1
WP_003163344.1\|2573458_2574067_-	hypothetical protein	NA	NA	NA	NA
WP_019725828.1\|2574710_2574929_-	hypothetical protein	NA	NA	NA	NA
WP_003124954.1\|2574942_2575194_-	hypothetical protein	NA	NA	NA	NA
WP_031635504.1\|2575314_2575749_-	hypothetical protein	Q56VP5	Pseudomonas_phage	7.9e-61	97.9
WP_033878965.1\|2576264_2576552_-	DUF5447 family protein	Q56VP7	Pseudomonas_phage	1.4e-53	96.8
2578668:2578698	attR	NA	NA	NA	NA

DBSCAN-SWA_6

2740238 : 2806548

Pseudomonas_phage(57.14%)

capsid,transposase,protease,integrase

attL 2798743:2798763|attR 2810036:2810056

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014819593.1\|2740238_2742308_+\|protease	BREX system Lon protease-like protein BrxL	NA	NA	NA	NA
WP_019485325.1\|2742312_2744889_+	hypothetical protein	NA	NA	NA	NA
WP_019485323.1\|2746133_2749409_+	AAA family ATPase	A0A1D7RG78	Synechococcus_phage	2.2e-06	24.8
WP_025991815.1\|2749416_2750802_+	hypothetical protein	NA	NA	NA	NA
WP_019485321.1\|2750803_2751553_-	TIGR03747 family integrating conjugative element membrane protein	NA	NA	NA	NA
WP_016851988.1\|2751549_2753706_-	type IV conjugative transfer system coupling protein TraD	NA	NA	NA	NA
WP_003141015.1\|2753714_2754248_-	integrating conjugative element protein	NA	NA	NA	NA
WP_013982131.1\|2754244_2754865_-	lytic transglycosylase	NA	NA	NA	NA
WP_016851990.1\|2754849_2755569_-	TIGR03759 family integrating conjugative element protein	NA	NA	NA	NA
WP_016851991.1\|2755655_2756303_-	hypothetical protein	NA	NA	NA	NA
WP_016851992.1\|2756299_2756869_-	PilL N-terminal domain-containing protein	NA	NA	NA	NA
WP_016851993.1\|2757066_2759340_-	DEAD/DEAH box helicase	NA	NA	NA	NA
WP_016851994.1\|2759439_2759745_-	hypothetical protein	NA	NA	NA	NA
WP_031641641.1\|2759846_2760956_-	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_031641642.1\|2761021_2761672_-	hypothetical protein	NA	NA	NA	NA
WP_013982123.1\|2761756_2762122_-	hypothetical protein	NA	NA	NA	NA
WP_010792165.1\|2762211_2762823_-	DUF3275 family protein	NA	NA	NA	NA
WP_010792166.1\|2762878_2763430_-	DUF3577 domain-containing protein	NA	NA	NA	NA
WP_029578154.1\|2763773_2764139_-	DUF3085 domain-containing protein	NA	NA	NA	NA
WP_013982120.1\|2764204_2765002_-	hypothetical protein	NA	NA	NA	NA
WP_013982119.1\|2765292_2766009_-	hypothetical protein	NA	NA	NA	NA
WP_003141051.1\|2766259_2766652_-	hypothetical protein	NA	NA	NA	NA
WP_013982118.1\|2766677_2766914_-	hypothetical protein	NA	NA	NA	NA
WP_013982117.1\|2767696_2769712_-	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	5.4e-27	27.6
WP_004362284.1\|2770006_2770390_-	single-stranded DNA-binding protein	NA	NA	NA	NA
WP_031641644.1\|2770386_2770935_-	DUF3158 family protein	NA	NA	NA	NA
WP_013982115.1\|2770931_2771711_-	TIGR03761 family integrating conjugative element protein	NA	NA	NA	NA
WP_011805449.1\|2771834_2772026_-	hypothetical protein	NA	NA	NA	NA
WP_009618209.1\|2772054_2772342_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_009618210.1\|2772328_2772628_-	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_013982114.1\|2772755_2773949_-	hypothetical protein	NA	NA	NA	NA
WP_013982113.1\|2773951_2774512_-	DUF2857 domain-containing protein	NA	NA	NA	NA
WP_013982112.1\|2774529_2776188_-	ParB family protein	NA	NA	NA	NA
WP_013982111.1\|2776180_2776417_-	type II toxin-antitoxin system HicA family toxin	NA	NA	NA	NA
WP_013982110.1\|2776400_2777267_-	ParA family protein	NA	NA	NA	NA
WP_023084999.1\|2777307_2777526_-	AlpA family transcriptional regulator	NA	NA	NA	NA
WP_003454930.1\|2777667_2778426_-	hypothetical protein	NA	NA	NA	NA
WP_012761385.1\|2778965_2779874_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_016852010.1\|2779995_2780148_+	hypothetical protein	NA	NA	NA	NA
WP_016446187.1\|2780190_2780367_+\|transposase	transposase	NA	NA	NA	NA
WP_016446188.1\|2780480_2780858_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_016852012.1\|2781459_2782029_+	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_016852013.1\|2782123_2784973_+	heat shock survival AAA family ATPase ClpK	K4FB40	Cronobacter_phage	4.5e-128	40.8
WP_023084997.1\|2784989_2786420_+	cardiolipin synthase	NA	NA	NA	NA
WP_033949142.1\|2786447_2788265_+\|protease	ATP-dependent zinc metalloprotease FtsH	C7U047	Ostreococcus_tauri_virus	8.3e-104	41.3
WP_019485494.1\|2788352_2788811_+	small heat shock protein sHSP20-GI	NA	NA	NA	NA
WP_019485495.1\|2788833_2789748_+	heat resistance protein YfdX1	NA	NA	NA	NA
WP_033949139.1\|2789850_2790738_+	heat resistance protein YfdX2	NA	NA	NA	NA
WP_003285392.1\|2790834_2791446_+	heat resistance membrane protein HdeD-GI	NA	NA	NA	NA
WP_033949134.1\|2791525_2792671_+	hypothetical protein	NA	NA	NA	NA
WP_012761376.1\|2792660_2793101_+	heat resistance system thioredoxin Trx-GI	A0A1J0GW78	Streptomyces_phage	5.8e-11	38.5
WP_003141082.1\|2793104_2794820_+	heat resistance system K+/H+ antiporter KefB-GI	NA	NA	NA	NA
WP_023084996.1\|2794816_2795248_+	phosphate-starvation-inducible PsiE family protein	NA	NA	NA	NA
WP_003141083.1\|2795291_2796257_+\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_012761372.1\|2796281_2797433_+	trypsin-like peptidase domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	2.8e-28	31.0
WP_003141085.1\|2797665_2798574_+	LysR family transcriptional regulator	NA	NA	NA	NA
2798743:2798763	attL	NA	NA	NA	NA
WP_128651447.1\|2798881_2799106_+	hypothetical protein	NA	NA	NA	NA
WP_057391002.1\|2799089_2800085_-\|integrase	tyrosine-type recombinase/integrase	Q56VN7	Pseudomonas_phage	3.6e-93	52.6
WP_029611054.1\|2800084_2801377_-	hypothetical protein	Q56VN8	Pseudomonas_phage	1.4e-246	94.0
WP_057391001.1\|2801606_2802881_-	zonular occludens toxin family protein	Q56VN9	Pseudomonas_phage	2.6e-200	87.2
WP_003114150.1\|2802884_2803241_-	DUF2523 domain-containing protein	Q56VP0	Pseudomonas_phage	7.9e-59	100.0
WP_025297677.1\|2803245_2804526_-	hypothetical protein	Q56VP1	Pseudomonas_phage	2.4e-49	56.7
WP_033896067.1\|2804673_2804922_-\|capsid	major capsid protein	Q56VP2	Pseudomonas_phage	3.4e-32	91.5
WP_003115979.1\|2804934_2805186_-	hypothetical protein	NA	NA	NA	NA
WP_023087663.1\|2805307_2805742_-	hypothetical protein	Q56VP5	Pseudomonas_phage	7.1e-62	98.6
WP_079760962.1\|2806257_2806548_-	DUF5447 family protein	Q56VP7	Pseudomonas_phage	1.8e-53	93.8
2810036:2810056	attR	NA	NA	NA	NA

DBSCAN-SWA_7

4085814 : 4176676

105

Pseudomonas_virus(64.58%)

lysis,tail,terminase,tRNA,protease,plate,portal,capsid,head,integrase,holin

attL 4137043:4137088|attR 4173011:4173056

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003104666.1\|4085814_4086276_+\|tRNA	tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL	NA	NA	NA	NA
WP_003096050.1\|4086334_4086826_-	protein-export chaperone SecB	NA	NA	NA	NA
WP_003096057.1\|4086862_4087117_-	glutaredoxin 3	V9QKN6	Rhizobium_phage	1.6e-13	43.4
WP_003096058.1\|4087118_4087538_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_003114478.1\|4087862_4089410_+	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
WP_015647884.1\|4089723_4090542_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_014603392.1\|4090691_4091978_+	murein hydrolase activator EnvC	G9BW84	Planktothrix_phage	2.9e-10	39.8
WP_003096067.1\|4092006_4093317_+	S41 family peptidase	A0A0R6PIZ1	Moraxella_phage	3.9e-26	29.0
WP_003096069.1\|4093316_4094090_+	divergent polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_023085833.1\|4094158_4095640_+	hypothetical protein	NA	NA	NA	NA
WP_003096075.1\|4095676_4096432_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003106330.1\|4096581_4097334_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003106332.1\|4097424_4098171_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003106334.1\|4098342_4099113_-	imidazole glycerol phosphate synthase subunit HisF	NA	NA	NA	NA
WP_003106336.1\|4099123_4099861_-	1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase	NA	NA	NA	NA
WP_003112624.1\|4099909_4100170_-	DUF2164 domain-containing protein	NA	NA	NA	NA
WP_003096087.1\|4100173_4100812_-	imidazole glycerol phosphate synthase subunit HisH	NA	NA	NA	NA
WP_003096088.1\|4100811_4101405_-	imidazoleglycerol-phosphate dehydratase HisB	NA	NA	NA	NA
WP_003112623.1\|4101565_4101964_+	acetyl-CoA sensor PanZ family protein	NA	NA	NA	NA
WP_003112622.1\|4102000_4102237_+	hypothetical protein	NA	NA	NA	NA
WP_025297620.1\|4102233_4103340_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003105535.1\|4103433_4105686_+	AsmA family protein	NA	NA	NA	NA
WP_003096098.1\|4105682_4106750_+	A/G-specific adenine glycosylase	NA	NA	NA	NA
WP_003096100.1\|4106793_4107066_+	oxidative damage protection protein	NA	NA	NA	NA
WP_003123651.1\|4107093_4108176_+	oxidoreductase	NA	NA	NA	NA
WP_003096103.1\|4108529_4108979_+	DUF4102 domain-containing protein	C6ZR22	Salmonella_phage	2.4e-12	43.8
WP_003096105.1\|4108965_4110174_+\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A1B0VMI6	Pseudomonas_phage	7.6e-178	76.9
WP_023098865.1\|4112139_4113288_+	RHS repeat protein	NA	NA	NA	NA
WP_057391150.1\|4113302_4116065_+	RHS repeat protein	A0A2H4JHK7	uncultured_Caudovirales_phage	5.1e-20	49.5
WP_071536284.1\|4116093_4116330_+	hypothetical protein	NA	NA	NA	NA
WP_003096116.1\|4116467_4116704_-	hypothetical protein	NA	NA	NA	NA
WP_003096120.1\|4117023_4117266_+	hypothetical protein	NA	NA	NA	NA
WP_057391151.1\|4117725_4118232_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003096124.1\|4118818_4119118_-	hypothetical protein	NA	NA	NA	NA
WP_003096126.1\|4119222_4120041_-	hypothetical protein	NA	NA	NA	NA
WP_057391152.1\|4120297_4120594_-	hypothetical protein	NA	NA	NA	NA
WP_014604112.1\|4120593_4122144_-	DUF3631 domain-containing protein	NA	NA	NA	NA
WP_003096131.1\|4122140_4122515_-	hypothetical protein	NA	NA	NA	NA
WP_003096133.1\|4122511_4122802_-	hypothetical protein	A0A1B0VMJ4	Pseudomonas_phage	3.1e-21	56.8
WP_003096135.1\|4122804_4123110_-	hypothetical protein	NA	NA	NA	NA
WP_003096138.1\|4123106_4123376_-	hypothetical protein	NA	NA	NA	NA
WP_003096141.1\|4123372_4123606_-	hypothetical protein	NA	NA	NA	NA
WP_015649790.1\|4123598_4123847_-	hypothetical protein	NA	NA	NA	NA
WP_023098867.1\|4124122_4124347_-	AlpA family phage regulatory protein	A0A1B0VNF0	Pseudomonas_phage	9.5e-18	70.8
WP_123822971.1\|4124458_4124971_-	hypothetical protein	NA	NA	NA	NA
WP_003096148.1\|4125738_4126476_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_003105540.1\|4126634_4127324_+	DUF502 domain-containing protein	NA	NA	NA	NA
WP_003096153.1\|4127572_4128346_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.3e-20	31.1
WP_003096156.1\|4128360_4129113_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003105543.1\|4129174_4129870_+	ABC transporter permease	NA	NA	NA	NA
WP_003096163.1\|4129866_4130559_+	ABC transporter permease	NA	NA	NA	NA
WP_010792271.1\|4130627_4131848_+	methyltransferase	NA	NA	NA	NA
WP_003110596.1\|4132246_4132717_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_010793674.1\|4132720_4134199_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_003110594.1\|4134213_4135398_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_059319120.1\|4135408_4136938_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
4137043:4137088	attL	NA	NA	NA	NA
WP_023101692.1\|4137926_4138982_-\|portal	phage portal protein	Q9ZXM6	Pseudomonas_virus	7.5e-198	97.4
WP_031635534.1\|4138981_4140742_-\|terminase	terminase ATPase subunit family protein	Q9ZXM5	Pseudomonas_virus	0.0e+00	99.8
WP_023101694.1\|4140897_4141719_+\|capsid	GPO family capsid scaffolding protein	Q9ZXM4	Pseudomonas_virus	2.0e-129	99.6
WP_023101695.1\|4141754_4142771_+\|capsid	phage major capsid protein, P2 family	Q9ZXM3	Pseudomonas_virus	1.5e-190	98.8
WP_023083461.1\|4142776_4143478_+\|terminase	terminase endonuclease subunit	Q9ZXM2	Pseudomonas_virus	6.2e-124	98.7
WP_003098377.1\|4143581_4144043_+\|head	head completion/stabilization protein	Q9ZXM1	Pseudomonas_virus	2.8e-80	99.3
WP_003098378.1\|4144042_4144255_+\|tail	tail protein X	Q9ZXL9	Pseudomonas_virus	4.9e-32	94.1
WP_003098379.1\|4144279_4144633_+	hypothetical protein	Q9ZXL8	Pseudomonas_virus	6.0e-59	100.0
WP_003098380.1\|4144634_4144907_+\|holin	phage holin family protein	Q9ZXL7	Pseudomonas_virus	2.6e-38	97.8
WP_022580430.1\|4144903_4145710_+	N-acetylmuramidase family protein	Q9ZXL6	Pseudomonas_virus	5.3e-143	96.9
WP_022580429.1\|4145706_4145949_+	hypothetical protein	NA	NA	NA	NA
WP_022580428.1\|4145945_4146407_+\|lysis	LysB family phage lysis regulatory protein	Q9ZXL5	Pseudomonas_virus	9.9e-70	94.1
WP_022580427.1\|4146484_4147021_+\|tail	phage tail protein	Q9ZXL3	Pseudomonas_virus	3.6e-95	98.9
WP_022580426.1\|4147013_4147472_+	phage virion morphogenesis protein	Q9ZXL2	Pseudomonas_virus	1.2e-67	90.0
WP_022580425.1\|4147541_4148114_+\|plate	phage baseplate assembly protein V	Q9ZXL0	Pseudomonas_virus	7.9e-93	90.5
WP_022580424.1\|4148110_4148455_+	GPW/gp25 family protein	Q9ZXK9	Pseudomonas_virus	1.6e-56	98.2
WP_022580423.1\|4148451_4149369_+\|plate	baseplate assembly protein	Q9ZXK8	Pseudomonas_virus	4.9e-145	87.5
WP_022580422.1\|4149365_4149983_+\|tail	phage tail protein I	A0A2H4JAU2	uncultured_Caudovirales_phage	1.6e-86	75.8
WP_022580420.1\|4151806_4152241_+\|tail	phage tail protein	A0A291LAV4	Bordetella_phage	1.5e-27	51.1
WP_022580419.1\|4152341_4153517_+\|tail	phage tail sheath protein	Q9ZXK4	Pseudomonas_virus	2.8e-217	98.0
WP_022580418.1\|4153573_4154089_+\|tail	phage major tail tube protein	Q9ZXK3	Pseudomonas_virus	7.1e-93	98.2
WP_023093078.1\|4154142_4154481_+\|tail	phage tail assembly protein	Q9ZXK2	Pseudomonas_virus	2.3e-39	84.3
WP_022580416.1\|4154489_4154609_+\|tail	GpE family phage tail protein	Q9ZXK1	Pseudomonas_virus	6.7e-15	97.4
WP_023101696.1\|4154598_4157313_+\|tail	phage tail tape measure protein	Q9ZXK0	Pseudomonas_virus	0.0e+00	98.7
WP_015967206.1\|4157318_4157759_+\|tail	phage tail protein	Q9ZXJ9	Pseudomonas_virus	6.1e-77	100.0
WP_022580414.1\|4157755_4159033_+	phage late control D family protein	Q9ZXJ8	Pseudomonas_virus	1.3e-233	97.9
WP_071536253.1\|4159041_4159557_-	hypothetical protein	NA	NA	NA	NA
WP_023101697.1\|4159642_4160503_-	DNA adenine methylase	NA	NA	NA	NA
WP_023101698.1\|4160575_4161901_-	hypothetical protein	NA	NA	NA	NA
WP_022580412.1\|4162065_4162518_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_020750421.1\|4162562_4162793_+	phage-associated protein, BcepMu gp16 family	NA	NA	NA	NA
WP_171947378.1\|4162822_4163293_+	hypothetical protein	Q9ZXJ2	Pseudomonas_virus	1.6e-75	97.4
WP_003098408.1\|4163289_4163583_+	ogr/Delta-like zinc finger family protein	Q9ZXJ1	Pseudomonas_virus	1.1e-50	99.0
WP_022580410.1\|4163579_4163930_+	hypothetical protein	NA	NA	NA	NA
WP_003098410.1\|4164000_4164234_+	hypothetical protein	Q9ZXI9	Pseudomonas_virus	7.8e-39	100.0
WP_023101699.1\|4164230_4166951_+	toprim domain-containing protein	Q9ZXI8	Pseudomonas_virus	0.0e+00	99.4
WP_022580408.1\|4166995_4167268_+	hypothetical protein	NA	NA	NA	NA
WP_022580407.1\|4167327_4167681_+	hypothetical protein	Q9ZXI7	Pseudomonas_virus	3.2e-60	94.9
WP_022580406.1\|4167692_4167899_+	TraR/DksA family transcriptional regulator	Q9ZXI6	Pseudomonas_virus	1.8e-31	95.6
WP_023101700.1\|4167958_4168210_+	hypothetical protein	Q9ZXI5	Pseudomonas_virus	3.3e-35	92.8
WP_022580404.1\|4168202_4170113_+	DNA cytosine methyltransferase	A0A0U1T6D1	Pseudomonas_phage	5.1e-261	89.1
WP_022580403.1\|4170109_4171342_+	phosphoadenosine phosphosulfate reductase family protein	R9TRT5	Rhizobium_phage	1.3e-172	70.8
WP_022580402.1\|4171352_4171541_+	hypothetical protein	Q38017	Pseudomonas_virus	5.9e-05	70.6
WP_022580401.1\|4171537_4171753_+	DUF4224 domain-containing protein	NA	NA	NA	NA
WP_022580400.1\|4171749_4172892_+\|integrase	integrase	V9IQN0	Stenotrophomonas_phage	6.3e-73	40.4
WP_003096179.1\|4173289_4174348_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.0e-85	47.9
4173011:4173056	attR	NA	NA	NA	NA
WP_015649800.1\|4174344_4175253_+	dTDP-4-dehydrorhamnose reductase	NA	NA	NA	NA
WP_003161206.1\|4175249_4176131_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	2.1e-100	60.6
WP_003096184.1\|4176130_4176676_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	2.5e-51	54.0

DBSCAN-SWA_8

4319622 : 4356197

Shigella_phage(33.33%)

transposase,integrase

attL 4326302:4326319|attR 4360364:4360381

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004352797.1\|4319622_4320489_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	4.6e-60	47.3
WP_012077888.1\|4320485_4320779_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_086008398.1\|4320809_4321963_-\|transposase	IS3 family transposase	Q716C2	Shigella_phage	1.9e-85	53.9
WP_010794468.1\|4322137_4323364_+\|transposase	IS256-like element ISPa1328 family transposase	A0A218MNI5	uncultured_virus	8.0e-50	47.1
WP_021263740.1\|4323401_4326443_-	DEAD/DEAH box helicase	Q2NP48	Hyphantria_cunea_nuclear_polyhedrosis_virus	1.9e-28	26.4
4326302:4326319	attL	NA	NA	NA	NA
WP_023096322.1\|4326443_4328456_-	hypothetical protein	NA	NA	NA	NA
WP_012077892.1\|4328452_4329217_-	OmpA family protein	NA	NA	NA	NA
WP_012077893.1\|4329216_4331343_-	anti-phage defense ZorAB system ZorA	NA	NA	NA	NA
WP_012077894.1\|4331395_4332472_-	DUF91 domain-containing protein	NA	NA	NA	NA
WP_012077895.1\|4332489_4334133_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_012077896.1\|4334129_4335599_-	SAM-dependent DNA methyltransferase	J7I0U9	Acinetobacter_phage	7.9e-28	33.9
WP_012077897.1\|4335601_4336543_-	HNH endonuclease	NA	NA	NA	NA
WP_012077898.1\|4336959_4339326_-	DEAD/DEAH box helicase family protein	A0A2I5ARD8	Synechococcus_phage	1.8e-05	27.2
WP_012077900.1\|4339718_4340366_-	hypothetical protein	NA	NA	NA	NA
WP_025297754.1\|4340431_4340719_-	hypothetical protein	NA	NA	NA	NA
WP_012077903.1\|4342433_4343450_+	WYL domain-containing protein	NA	NA	NA	NA
WP_012077904.1\|4343508_4345221_+	dynamin family protein	NA	NA	NA	NA
WP_012077905.1\|4345234_4347478_+	dynamin family protein	NA	NA	NA	NA
WP_012077906.1\|4347474_4349565_+	hypothetical protein	NA	NA	NA	NA
WP_160328552.1\|4350474_4351290_+	UvrD-helicase domain-containing protein	NA	NA	NA	NA
WP_153565776.1\|4351363_4351906_+	hypothetical protein	NA	NA	NA	NA
WP_169311248.1\|4352369_4353524_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_124083333.1\|4353739_4354249_-	hypothetical protein	NA	NA	NA	NA
WP_010794470.1\|4354232_4356197_-\|integrase	integrase	NA	NA	NA	NA
4360364:4360381	attR	NA	NA	NA	NA

DBSCAN-SWA_9

4734278 : 4792729

Dishui_lake_phycodnavirus(20.0%)

transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033954923.1\|4734278_4734971_+\|transposase	transposase	NA	NA	NA	NA
WP_023874766.1\|4735093_4735606_+	hypothetical protein	NA	NA	NA	NA
WP_123809523.1\|4735829_4736036_+	hypothetical protein	NA	NA	NA	NA
WP_153175540.1\|4736192_4738838_+	DUF637 domain-containing protein	NA	NA	NA	NA
WP_050397970.1\|4739383_4739869_+	S-layer family protein	NA	NA	NA	NA
WP_023098295.1\|4739910_4740603_+\|transposase	transposase	NA	NA	NA	NA
WP_063896703.1\|4740859_4741180_+	hypothetical protein	NA	NA	NA	NA
WP_003083536.1\|4741766_4742162_+	hypothetical protein	NA	NA	NA	NA
WP_004347041.1\|4742426_4743836_-	MgtC/SapB family protein	NA	NA	NA	NA
WP_003118491.1\|4743999_4745373_+	T3SS effector bifunctional cytotoxin exoenzyme T	NA	NA	NA	NA
WP_003104306.1\|4745868_4746555_+	CsgG/HfaB family protein	NA	NA	NA	NA
WP_003083569.1\|4746585_4746939_+	DUF4810 domain-containing protein	NA	NA	NA	NA
WP_003083573.1\|4746935_4747601_+	DUF799 domain-containing protein	NA	NA	NA	NA
WP_003104304.1\|4747615_4747999_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003083577.1\|4748280_4749789_-	hypothetical protein	NA	NA	NA	NA
WP_003083582.1\|4750551_4750692_+	hypothetical protein	NA	NA	NA	NA
WP_003083584.1\|4750753_4750891_+	hypothetical protein	NA	NA	NA	NA
WP_003111526.1\|4751515_4753348_+	asparagine synthase (glutamine-hydrolyzing)	A0A2K9R7N5	Dishui_lake_phycodnavirus	2.7e-17	28.3
WP_003083588.1\|4753400_4753829_-	cupin domain-containing protein	NA	NA	NA	NA
WP_017148779.1\|4754037_4754586_-	RNA 2'-phosphotransferase	A0A2R2ZGT8	Clostridioides_phage	6.7e-33	41.0
WP_003083593.1\|4754624_4755131_-	DUF1993 family protein	NA	NA	NA	NA
WP_010793595.1\|4755196_4756117_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003083599.1\|4756224_4757112_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_015647792.1\|4757174_4757879_+	DsbA family protein	NA	NA	NA	NA
WP_003118563.1\|4757962_4758418_+	OsmC family protein	NA	NA	NA	NA
WP_003114662.1\|4758528_4758762_+	DUF1161 domain-containing protein	NA	NA	NA	NA
WP_003083612.1\|4758773_4759211_-	hypothetical protein	NA	NA	NA	NA
WP_003083614.1\|4759267_4759684_-	hypothetical protein	NA	NA	NA	NA
WP_003118564.1\|4759775_4760903_+	aminopeptidase	NA	NA	NA	NA
WP_003118565.1\|4760910_4761894_-	hypothetical protein	NA	NA	NA	NA
WP_003106611.1\|4761926_4762592_-	HAD family hydrolase	NA	NA	NA	NA
WP_003106612.1\|4762584_4763127_-	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_003083621.1\|4763204_4765250_+	oligopeptidase A	A0A1V0SD92	Indivirus	4.6e-34	21.3
WP_003083624.1\|4765246_4765522_+	YheV family putative metal-binding protein	NA	NA	NA	NA
WP_003118567.1\|4765610_4766669_+	PA0069 family radical SAM protein	NA	NA	NA	NA
WP_003106614.1\|4766898_4767813_-	hypothetical protein	NA	NA	NA	NA
WP_003106615.1\|4767874_4769587_-	SUMF1/EgtB/PvdO family nonheme iron enzyme	NA	NA	NA	NA
WP_025297266.1\|4769579_4770779_-	ABC transporter permease	NA	NA	NA	NA
WP_003114657.1\|4770778_4771498_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.1e-18	36.3
WP_016252829.1\|4771494_4774593_-	protein kinase	M1PCM5	Moumouvirus	1.6e-22	27.4
WP_003083639.1\|4774600_4775329_-	serine/threonine-protein phosphatase	NA	NA	NA	NA
WP_003142363.1\|4775338_4776019_-	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_009875647.1\|4776015_4779546_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_003115051.1\|4779542_4780892_-	DotU family type VI secretion system protein	NA	NA	NA	NA
WP_003115052.1\|4780898_4782233_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_003083660.1\|4782248_4782713_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_004351966.1\|4782757_4784257_-	type VI secretion system-associated FHA domain protein TagH	NA	NA	NA	NA
WP_003104975.1\|4784624_4785659_+	type VI secretion system protein TssA	NA	NA	NA	NA
WP_003083666.1\|4785747_4786266_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_003104973.1\|4786278_4787775_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_003083670.1\|4787850_4788339_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_003119488.1\|4788506_4789352_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_003104971.1\|4789353_4789863_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_003083676.1\|4789859_4791719_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_003104969.1\|4791682_4792729_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA

DBSCAN-SWA_10

5314815 : 5367450

uncultured_Caudovirales_phage(28.0%)

tail,tRNA,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003099590.1\|5314815_5315841_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.4e-108	58.1
WP_003085061.1\|5315919_5316489_-	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_003099587.1\|5316572_5316926_+	dihydroneopterin aldolase	NA	NA	NA	NA
WP_003099585.1\|5316916_5317459_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_003099584.1\|5317431_5318664_-	multifunctional CCA addition/repair protein	A0A076G5T8	Escherichia_phage	2.6e-77	43.1
WP_003099582.1\|5318707_5319214_-	DUF4136 domain-containing protein	NA	NA	NA	NA
WP_003099581.1\|5319307_5320861_-	SpoVR family protein	NA	NA	NA	NA
WP_003099579.1\|5320857_5322129_-	YeaH/YhbH family protein	A0A140HLI1	Bacillus_phage	4.2e-09	37.2
WP_003085078.1\|5322229_5324152_-	PrkA family serine protein kinase	NA	NA	NA	NA
WP_003099577.1\|5324430_5324763_-	thiosulfate sulfurtransferase GlpE	NA	NA	NA	NA
WP_003113213.1\|5324806_5325658_-	symmetrical bis(5'-nucleosyl)-tetraphosphatase	A0A2H4J0P0	uncultured_Caudovirales_phage	1.1e-08	33.3
WP_003085085.1\|5325657_5326038_-	Co2+/Mg2+ efflux protein ApaG	NA	NA	NA	NA
WP_003161932.1\|5326074_5326881_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_057391017.1\|5326996_5327983_-	4-hydroxythreonine-4-phosphate dehydrogenase PdxA	NA	NA	NA	NA
WP_003109024.1\|5327979_5329272_-	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_023129218.1\|5329252_5332024_-	LPS-assembly protein LptD	NA	NA	NA	NA
WP_003129200.1\|5332150_5333167_+	phosphotransferase	NA	NA	NA	NA
WP_025297296.1\|5333163_5333838_+	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_059319134.1\|5333839_5334598_+	DnaJ domain-containing protein	NA	NA	NA	NA
WP_003117961.1\|5334598_5335660_-	alpha/beta hydrolase family protein	NA	NA	NA	NA
WP_015649714.1\|5335811_5338205_+	sensor histidine kinase	NA	NA	NA	NA
WP_003085103.1\|5338250_5338883_+	response regulator transcription factor	NA	NA	NA	NA
WP_003085106.1\|5339011_5340046_+	polyamine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003085109.1\|5340279_5341389_+	polyamine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.8e-28	34.4
WP_003109043.1\|5341444_5342491_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_014604087.1\|5342605_5343853_+	ABC transporter permease	NA	NA	NA	NA
WP_003085119.1\|5343958_5344789_+	ABC transporter permease	NA	NA	NA	NA
WP_003085122.1\|5344912_5345587_+	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_003099532.1\|5345586_5346405_+	phosphoglycolate phosphatase	NA	NA	NA	NA
WP_015649712.1\|5346477_5347956_+	anthranilate synthase component I	NA	NA	NA	NA
WP_003121843.1\|5348142_5348457_-	pyocin activator PrtN family protein	NA	NA	NA	NA
WP_003113202.1\|5348556_5349327_-	helix-turn-helix transcriptional regulator	A0A1B0Z078	Pseudomonas_phage	1.4e-71	59.1
WP_003085132.1\|5349784_5349985_+	repressor PtrB	W6ATC1	Enterobacter_phage	3.7e-05	58.3
WP_003459419.1\|5350032_5350392_+	hypothetical protein	NA	NA	NA	NA
WP_003118908.1\|5350754_5351204_+	hypothetical protein	B5TK61	Pseudomonas_phage	5.0e-26	53.3
WP_015649710.1\|5351225_5351741_+	hypothetical protein	A0A2H4J881	uncultured_Caudovirales_phage	4.9e-33	44.0
WP_003085141.1\|5351737_5352295_+\|plate	phage baseplate assembly protein V	A0A2H4JG06	uncultured_Caudovirales_phage	4.6e-45	71.1
WP_003085143.1\|5352447_5352774_+	GPW/gp25 family protein	A0A2H4JA09	uncultured_Caudovirales_phage	3.2e-30	60.2
WP_015649709.1\|5352770_5353658_+\|plate	baseplate J/gp47 family protein	S4TNY7	Salmonella_phage	7.0e-88	59.8
WP_010895511.1\|5353650_5354184_+\|tail	phage tail protein I	Q9ZXK7	Pseudomonas_virus	3.0e-62	64.6
WP_015649708.1\|5354185_5356294_+\|tail	phage tail protein	Q9ZXK6	Pseudomonas_virus	1.4e-224	52.1
WP_003085172.1\|5356302_5356743_+\|tail	tail fiber assembly protein	NA	NA	NA	NA
WP_003109051.1\|5356785_5357946_+\|tail	phage tail sheath family protein	Q38068	Phage_PS17	2.7e-188	83.4
WP_003085175.1\|5357958_5358462_+\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	8.0e-65	73.5
WP_003085178.1\|5358476_5358821_+\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_025297297.1\|5358990_5361228_+\|tail	phage tail length tape measure protein	NA	NA	NA	NA
WP_003085182.1\|5361237_5362110_+\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	3.9e-75	51.7
WP_003101635.1\|5362084_5362291_+\|tail	tail protein X	A0A2H4J9Z9	uncultured_Caudovirales_phage	2.3e-18	64.2
WP_003101637.1\|5362348_5363338_+	phage late control D family protein	A0A2H4JBF6	uncultured_Caudovirales_phage	2.2e-106	55.8
WP_003085188.1\|5363370_5364000_+	glycoside hydrolase family 19 protein	A0A125RNP1	Pseudomonas_phage	3.2e-87	78.5
WP_003101639.1\|5363996_5364359_+	hypothetical protein	H2BDA0	Pseudomonas_phage	1.9e-15	47.9
WP_003118919.1\|5364355_5364613_+	hypothetical protein	A0A125RNP3	Pseudomonas_phage	8.3e-18	64.6
WP_003101640.1\|5364960_5365566_+	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	6.0e-75	65.8
WP_003085203.1\|5365567_5366617_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.8e-111	57.8
WP_003085205.1\|5366613_5367450_+	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	2.1e-70	56.9

DBSCAN-SWA_11

6661074 : 6669527

Salmonella_phage(50.0%)