CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP013987	Pseudomonas oryzihabitans strain USDA-ARS-USMARC-56511 chromosome, complete genome	2 crisprs	csa3,DinG,DEDDh,cas3,WYL	0	0	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013987_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013987_1

2566125-2566266

Orphan

Consensus_repeat	Method
CCCGTTGGGCTTCGACGATGGAGCCGTTTCAGCCCAACCTACG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013987_1

>merge|NZ_CP013987|1|2566125-2566266|CRISPRCasFinder
CCCGTTGGGCTTCGACGATGGAGCCGTTTCAGCCCAACCTACGGTAAAGGTAGGTTGGGCTGAGCATAGCGAAGCCCAACACATCCAGACTCGGTGCCTCCCGTTGGCCTTCGACGATGGAGCCGTTTCAGCCCAACCTACG

>NZ_CP013987|1|1|2566125-2566266|CRISPRCasFinder
CCCGTTGGGCTTCGACGATGGAGCCGTTTCAGCCCAACCTACG	GTAAAGGTAGGTTGGGCTGAGCATAGCGAAGCCCAACACATCCAGACTCGGTGCCT
CCCGTTGGCCTTCGACGATGGAGCCGTTTCAGCCCAACCTACG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013987.1\|WP_059315033.1\|2567811_2569218_-\|cytosine-permease	unknown	unknown	gnl\|CDD\|271377
NZ_CP013987.1\|WP_059315037.1\|2572050_2573532_+\|aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143432
NZ_CP013987.1\|WP_059315038.1\|2573547_2574033_+\|flavin-reductase-family-protein	unknown	unknown	gnl\|CDD\|214900
NZ_CP013987.1\|WP_082696339.1\|2561486_2562821_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340877
NZ_CP013987.1\|WP_059315035.1\|2570610_2571201_+\|amino-acid-synthesis-family-protein	unknown	unknown	gnl\|CDD\|369036
NZ_CP013987.1\|WP_059316886.1\|2556868_2557444_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013987.1\|WP_059315041.1\|2575327_2576437_+\|bifunctional-3,4-dihydroxy-2-butanone-4-phosphate-synthase/GTP-cyclohydrolase-II	unknown	unknown	gnl\|CDD\|171535
NZ_CP013987.1\|WP_059315029.1\|2562839_2563640_+\|HpcH/HpaI-aldolase/citrate-lyase-family-protein	unknown	unknown	gnl\|CDD\|226356
NZ_CP013987.1\|WP_059315040.1\|2574961_2575249_-\|DUF1330-domain-containing-protein	unknown	unknown	gnl\|CDD\|377765
NZ_CP013987.1\|WP_059315036.1\|2571214_2572054_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|131480
NZ_CP013987.1\|WP_059316888.1\|2565546_2566113_+\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|239948
NZ_CP013987.1\|WP_059315034.1\|2569489_2570527_+\|LLM-class-flavin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|366009
NZ_CP013987.1\|WP_059315039.1\|2574161_2574917_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_CP013987.1\|WP_059315028.1\|2560280_2561465_+\|L-rhamnonate-dehydratase	unknown	unknown	gnl\|CDD\|185337
NZ_CP013987.1\|WP_059315025.1\|2556138_2556513_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|320084
NZ_CP013987.1\|WP_059315027.1\|2558968_2560267_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340877
NZ_CP013987.1\|WP_059315031.1\|2565196_2565421_+\|DUF2188-domain-containing-protein	unknown	unknown	gnl\|CDD\|378323
NZ_CP013987.1\|WP_059315030.1\|2563653_2565087_+\|aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143407
NZ_CP013987.1\|WP_059315026.1\|2557840_2558788_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176126
NZ_CP013987.1\|WP_059315032.1\|2566313_2567759_-\|NADP-dependent-succinate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|183050

Protein	Function_ID	Function_description	E-value
NZ_CP013987.1\|WP_059315033.1\|2567811_2569218_-\|cytosine-permease	gnl\|CDD\|271377	cd11484, SLC-NCS1sbd_CobB-like, nucleobase-cation-symport-1 (NCS1) transporter CobB-like; solute-binding domain. This NCS1 subfamily includes Escherichia coli CodB (cytosine permease), and the Saccharomyces cerevisiae transporters: Fcy21p (Purine-cytosine permease), and vitamin B6 transporter Tpn1. NCS1s are essential components of salvage pathways for nucleobases and related metabolites; their known substrates include allantoin, uracil, thiamine, and nicotinamide riboside. NCS1s belong to a superfamily which also contains the solute carrier 5 family sodium/glucose transporters (SLC5s), and solute carrier 6 family neurotransmitter transporters (SLC6s).	3.13474e-60
NZ_CP013987.1\|WP_059315037.1\|2572050_2573532_+\|aldehyde-dehydrogenase	gnl\|CDD\|143432	cd07114, ALDH_DhaS, Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like. Uncharacterized aldehyde dehydrogenase from Candidatus pelagibacter (DhaS) and other related sequences are present in this CD.	0
NZ_CP013987.1\|WP_059315038.1\|2573547_2574033_+\|flavin-reductase-family-protein	gnl\|CDD\|214900	smart00903, Flavin_Reduct, Flavin reductase like domain. This entry represents the FMN-binding domain found in NAD(P)H-flavin oxidoreductases (flavin reductases), a class of enzymes capable of producing reduced flavin for bacterial bioluminescence and other biological processes. This domain is also found in various other oxidoreductase and monooxygenase enzymes... This domain consists of a beta-barrel with Greek key topology, and is related to the ferredoxin reductase-like FAD-binding domain. The flavin reductases have a different dimerisation mode than that found in the PNP oxidase-like family, which also carries an FMN-binding domain with a similar topology.	1.69933e-53
NZ_CP013987.1\|WP_082696339.1\|2561486_2562821_+\|MFS-transporter	gnl\|CDD\|340877	cd17319, MFS_ExuT_GudP_like, Hexuronate transporter, Glucarate transporter, and similar transporters of the Major Facilitator Superfamily. This family is composed of predominantly bacterial transporters for hexuronate (ExuT), glucarate (GudP), galactarate (GarP), and galactonate (DgoT). They mediate the uptake of these compounds into the cell. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.25269e-88
NZ_CP013987.1\|WP_059315035.1\|2570610_2571201_+\|amino-acid-synthesis-family-protein	gnl\|CDD\|369036	pfam06684, AA_synth, Amino acid synthesis. This family of proteins is structurally similar to proteins with the Bacillus chorismate mutase-like (BCM-like) fold. This structure, combined with its genomic context, suggest that it has a role in amino acid synthesis.	4.79673e-88
NZ_CP013987.1\|WP_059315041.1\|2575327_2576437_+\|bifunctional-3,4-dihydroxy-2-butanone-4-phosphate-synthase/GTP-cyclohydrolase-II	gnl\|CDD\|171535	PRK12485, PRK12485, bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II.	0
NZ_CP013987.1\|WP_059315029.1\|2562839_2563640_+\|HpcH/HpaI-aldolase/citrate-lyase-family-protein	gnl\|CDD\|226356	COG3836, HpcH, 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase [Carbohydrate transport and metabolism].	1.71876e-124
NZ_CP013987.1\|WP_059315040.1\|2574961_2575249_-\|DUF1330-domain-containing-protein	gnl\|CDD\|377765	pfam07045, DUF1330, Domain of unknown function (DUF1330). This family consists of several hypothetical bacterial proteins of around 90 residues in length. The function of this family is unknown.	3.76054e-38
NZ_CP013987.1\|WP_059315036.1\|2571214_2572054_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|131480	TIGR02427, b-ketoadipate_enol-lactone_hydrolase, 3-oxoadipate enol-lactonase. Members of this family are 3-oxoadipate enol-lactonase. Note that the substrate is known as 3-oxoadipate enol-lactone, 2-oxo-2,3-dihydrofuran-5-acetate, 4,5-Dihydro-5-oxofuran-2-acetate, and 5-oxo-4,5-dihydrofuran-2-acetate. The enzyme the catalyzes the fourth step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA. 4-hydroxybenzoate, 3-hydroxybenzoate, and vanillate all can be converted in one step to protocatechuate. This enzyme also acts in catechol degradation. In genomes that catabolize both catechol and protocatechuate, two forms of this enzyme may be found. All members of the seed alignment for this model were chosen from within protocatechuate degradation operons of at least three genes of the pathway, from genomes with the complete pathway through beta-ketoadipate. [Energy metabolism, Other].	4.21484e-49
NZ_CP013987.1\|WP_059316888.1\|2565546_2566113_+\|NUDIX-hydrolase	gnl\|CDD\|239948	cd04511, Nudix_Hydrolase_4, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, U=I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	4.42672e-70
NZ_CP013987.1\|WP_059315034.1\|2569489_2570527_+\|LLM-class-flavin-dependent-oxidoreductase	gnl\|CDD\|366009	pfam00296, Bac_luciferase, Luciferase-like monooxygenase.	7.52691e-59
NZ_CP013987.1\|WP_059315039.1\|2574161_2574917_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	1.10123e-41
NZ_CP013987.1\|WP_059315028.1\|2560280_2561465_+\|L-rhamnonate-dehydratase	gnl\|CDD\|185337	PRK15440, PRK15440, L-rhamnonate dehydratase; Provisional.	0
NZ_CP013987.1\|WP_059315025.1\|2556138_2556513_-\|transcriptional-regulator	gnl\|CDD\|320084	cd16170, MvaT_DBD, DNA-binding domain of the bacterial xenogeneic silencer MvaT. MvaT is a xenogeneic silencer conserved in Pseudomonas which assists in distinguishing foreign from self DNA. It prefers binding to flexible DNA segments with multiple TpA steps, and forms nucleoprotein filaments through cooperative polymerization.	1.07893e-18
NZ_CP013987.1\|WP_059315027.1\|2558968_2560267_+\|MFS-transporter	gnl\|CDD\|340877	cd17319, MFS_ExuT_GudP_like, Hexuronate transporter, Glucarate transporter, and similar transporters of the Major Facilitator Superfamily. This family is composed of predominantly bacterial transporters for hexuronate (ExuT), glucarate (GudP), galactarate (GarP), and galactonate (DgoT). They mediate the uptake of these compounds into the cell. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.48228e-88
NZ_CP013987.1\|WP_059315031.1\|2565196_2565421_+\|DUF2188-domain-containing-protein	gnl\|CDD\|378323	pfam09954, DUF2188, Uncharacterized protein conserved in bacteria (DUF2188). This domain, found in various hypothetical bacterial proteins, has no known function.	3.19405e-07
NZ_CP013987.1\|WP_059315030.1\|2563653_2565087_+\|aldehyde-dehydrogenase	gnl\|CDD\|143407	cd07088, ALDH_LactADH-AldA, Escherichia coli lactaldehyde dehydrogenase AldA-like. Lactaldehyde dehydrogenase from Escherichia coli (AldA, LactADH, EC=1.2.1.22), an NAD(+)-dependent enzyme involved in the metabolism of L-fucose and L-rhamnose, and other similar sequences are present in this CD.	0
NZ_CP013987.1\|WP_059315026.1\|2557840_2558788_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176126	cd08435, PBP2_GbpR, The C-terminal substrate binding domain of galactose-binding protein regulator contains the type 2 periplasmic binding fold. Galactose-binding protein regulator (GbpR), a member of the LysR family of bacterial transcriptional regulators, regulates the expression of chromosomal virulence gene chvE. The chvE gene is involved in the uptake of specific sugars, in chemotaxis to these sugars, and in the VirA-VirG two-component signal transduction system. In the presence of an inducing sugar such as L-arabinose, D-fucose, or D-galactose, GbpR activates chvE expression, while in the absence of an inducing sugar, GbpR represses expression. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	5.02159e-50
NZ_CP013987.1\|WP_059315032.1\|2566313_2567759_-\|NADP-dependent-succinate-semialdehyde-dehydrogenase	gnl\|CDD\|183050	PRK11241, gabD, NADP-dependent succinate-semialdehyde dehydrogenase I.	0

>NZ_CP013987.1|WP_059316888.1|2565546_2566113_+|NUDIX-hydrolase
MNSSPRFCCQCGSAELLRRRPAGDSHERLLCGACGHVLYDNPRVIAGCLVEHEGRYLLCRRAIEPRRGYWTLPAGFMENDESAEQAALRETWEESGVRARILAPYSIFNAAGVNQVYLIFRAELVEIDAEAGIETLERRFFAPDELPWADLAYPSIRQILERRLQEQVQGHHGLYFGTAEAGQLHTLG
>NZ_CP013987.1|WP_059315031.1|2565196_2565421_+|DUF2188-domain-containing-protein
MQNYHIVPTDTGWEFKEEHGDRALLKASTKDAIVHQAAQYLDGKTGSVKIHTSDGRIEEERTYPRSADPAQSKG
>NZ_CP013987.1|WP_059315030.1|2563653_2565087_+|aldehyde-dehydrogenase
MADLPLYQNYIDGRFLPAAEDFLVHNPATGEALAWVPASSREDVDQAIAAARRAQKAWARKPAIERAGYLRRIAAKLREHAPRLARTIVAEQGKVHDLAEVEVNFTADYLDYMAEWARRIEGEIITSDRPDEQIFLLRKPLGVVAGILPWNFPFFLIARKLAPALITGNTIVIKPSEETPINAHEFARLVAETDLPPGVFNLVSGAGAVGGQLSAHAGIDMVSFTGSVGTGSRIMAAASPNLTKLNLELGGKAPAIVLADADLDLAVRAIRDSRIINTGQVCNCAERVYVERAVAEDFIERIGRAMAATRYGDPQADAGVEMGPLINAAGLDKVAAKVDVALGQGARLVTGGSRADLGRGFHFQPTVLADCRAEMPIMREEIFGPVLPIQVVDDLDEAIALANDCEYGLTSSVYTRSLSKAMHAMREIDFGETYINRENFEAMQGFHAGVRKSGIGGADGKHGLYEYTHTQVVYLQG
>NZ_CP013987.1|WP_059315029.1|2562839_2563640_+|HpcH/HpaI-aldolase/citrate-lyase-family-protein
MDLPRNPFKARLAGSDTLYGLWAGFATGYAAEIAASTGYDWLLIDGEHAPNTVPSILAQLQAVAPYSTAPVVRCVTGDAVLIKQLLDIGVQTLMVPMVETAEQARALVRAMRYPPHGIRGVGGGLARATRWDAVPDYLHTAHRELCLIVQVESRLGSDNVAEIAAVEGVDAVFVGPADLSSGLGHAGNPGHPEVQARIRAAIEATRAAGKVAGILAPQEDDARRYRDWGCQFVAVGIDISLFRQAALANLARYRPLEAPQAPSRTY
>NZ_CP013987.1|WP_082696339.1|2561486_2562821_+|MFS-transporter
MKATQDTLVTPVPNARPAATPLPPKSARLKRVQVVALALLVLAGFVNYLDRSTLAIANQTISGELGFTPTEMGLLLSAFAWAYAFAQLPIGGVLDRFGARLTLGLGICLWSIAQGVLGLLSSLHLMILARIGLGIGEAPQFPAGAKVVSEWFNVRERGLPSGIFNLSSSLGPAISQPILTALLLWLGWRQMFIAMGVLGVLVAALWYLSYRDRVQVALDAAERAHLDAGLPPQDAGMRLTFADWLGLFRRRLTWGVVIGYVGIIYMLSLFLTWLPAYLERVHHLSLSQAGWVASLPFLAGACGVISGGLLVDRLTRSGRSLAFSRKLPICGGLAAAGLFALCSAGVTGIGSVILCFSLALFSLNVAVAGTWSLVSVAVPSHQVASLASIQNFGGYFGGAFAPVITGMIVQQTGSFGLALGIAAAVAVAGALSYGLLVRLPDTPS
>NZ_CP013987.1|WP_059315028.1|2560280_2561465_+|L-rhamnonate-dehydratase
MTLPTIKQVRAYTLRGGGADYHDQGDGHWIDDHIATPMAKYPEYRQSRRSFGINVLGTLVVEVEASDGTVGFAVTTGGELGAFIVERHLARFLEGAKVTDLEKIWDQMYLSTLYYGRKGIVLNTISGVDLALWDLLGKLRQEPVHQLLGGAVRDELQFYATGARPDLAKEMGFIGGKLPLQHGPAEGEEGLRKNLEALATMRERVGDDFWLMLDCWMSLDLNYATRLAQGAHEFGLKWIEEALPPDDYWGYAELRRNVPRGMLVTTGEHEATRWGFRLLLEMGCCDILQPDVGWCGGLTELIRISALADAHNALVVPHGSSVYSYHFVITRTNSPFAEFLMMAPKADEVVPMFHPQLLDEPVPVRGRMRASALDRPGFGVRLNPECALERPYSH
>NZ_CP013987.1|WP_059315027.1|2558968_2560267_+|MFS-transporter
MHTSLSPGLVAKVTRRLLPFLLLMYVMAFLDRANVGFAKVAFQADTGISDAAFALGAGIFFVGYAFLEIPSNLIMHRVGARLWMCRIMVTWGLISAAMMFAHTATAFYVLRFLLGVAEAGFFPGVILYLTYWFPSRYRARALGFFYFGAPLAFIFGSPLSGLLLEFDGFGGLHGWQWMFLVEGALASLVGVWAWFYLDNRPRDARWLSDAEKQALQQALDAEDAAKPHHGGLLRLLGQPRILLLCSIYLLIQASVYGVVFYLPTQVAGLLGQKVGLLVGLVSAIPWVCALLAAWLIPSWSDRTGERRRTAAATLAISGLGIAASVTFSPLYALIALCFAAAGFIAVQPLFWTFPSDQLRGSAAAGGIALINTCGAIGGFIAPLAKRWAEVTFAHPGAGLYLLAGTTLVAAALILGLRQRRQADPQAQLTPSH
>NZ_CP013987.1|WP_059315026.1|2557840_2558788_-|LysR-family-transcriptional-regulator
MNASPHARALFNRLRYKHLLMLATLAGTLNLHRAAEALHMSQPATTRMLQEVEEAFGCVLFERQARGLKVTALGMEIVEFARRALNGLDRCAEDLDARRSGGYGHLAIGAIMGALPDLVVRAIAASKARQPGLQLRILGDTSDQLTELLEQERIDVAIARFTQQADLGRFVFEPLGNEHLAVVVRTGHPLTGRAAPDLAELVAEWPWILQPEASPARVALEAAFARRQLPPPADVIECGSVFAMLQLVQITDAILVLTEAVVRDHLRTGLMVSLDLEITEPLTPFGILLRAGQVPSAALEGFLTLLRRQASGGEA
>NZ_CP013987.1|WP_059316886.1|2556868_2557444_-|hypothetical-protein
MKIACLGWGSLIWKAAELPVASDWFVDGPRLPIEFAREGDSGELATVLCEDAADVQVFWAYLAVDSLEEARDALREREGVPREQPECIGSWPSGPQSEFQQRIGEWARAKELEAVVWTALPPRSAGLNQRMPTVEEALDYLRKLDPDRQTHARDYIRRTPVSIDTAYRRVIAETFNWSPLPEARSDVEASA
>NZ_CP013987.1|WP_059315025.1|2556138_2556513_-|transcriptional-regulator
MSRLAEFRAAEEQLRAQLQLLEDLKQDSSLQKEIEFESKLQELMDEYQMNLGDIIGILDPNAAPKHKAQTPHPEKPAGKRRPRSTKRYQHPKTGEVIETKGGNHKVLKAWKAEHGADTVEGWLQ
>NZ_CP013987.1|WP_059315032.1|2566313_2567759_-|NADP-dependent-succinate-semialdehyde-dehydrogenase
MLQDASLFRQQAYVDGAWIDADSGATVTVDNPATGETLGTIPKLGRAETKRAIDAANRALPAWRALTAKERSAKLRRWYELMIENQDDLGRLMTLEQGKPLAEAKGEIVYAASFIEWFAEEAKRIYGDTIPGHQADKRILVIKQPIGVTAAITPWNFPTAMITRKAGPALAAGCTMVIKPASQTPYSALALVELAERAGIPKGVLSVVTGSAAEIGAELTESPIVRKISFTGSTEIGAKLMEQSAPTIKKLSLELGGNAPFIVFDDADLDKAVEGAIASKYRNAGQTCVCVNRLYIQDGVYDAFAEKFKAAVAKLKVGNGLEEGVTIGPLIDAKAAAKVKEHIDDAVSQGAKVIAGGKAHANGGSYFEPTILADVPKSAKVSKEETFGPLAPLFRFKDEAEVIELANDTEFGLASYFYARDLSRVFRVAEALEYGMVGINTGLISNEVAPFGGVKASGLGREGSKYGIEEYLEIKYLCLGV
>NZ_CP013987.1|WP_059315033.1|2567811_2569218_-|cytosine-permease
MSAAPRSAVAIETHTVDHVASAERHGHSRDLFTLWFSTNIAPLPIVTGAMVVQTFHLNLAWGLVAIVFGHLLGGVVLALASAQGPRLGIPQMVQSRGQFGRYGALLIVCVTALIYVGFFTSNVVLAGKSIQGLVPAVPMPLAIVVGALSATAIGVIGYRCIHTLNRWGTWVMGAGLLAGFAMMLSQPLPADFLTRGGLNASGFVATLSLGVIWQLSFSPYTSDYSRYLPEAVGIARPFWATYLGATLGTILAFSFGVVAVLAVPAGNDAMAAVAQATGWLGPVLMVLFLLNIISHNALNLYGAVLAIITCVQTFAASWTPGVKVKVVLSSLVLVGCCSVALMASADFIERFIGLVLAMTMILVPWASINLIDFYLIKRGDYHIPSLFAADGGRYGRFNGHAIAAYAVGILVQLPFANTALFKGPYADLVAGADLSWLFGLLVTCPLYFWLAYQGSPAQVARLQAASPQ
>NZ_CP013987.1|WP_059315034.1|2569489_2570527_+|LLM-class-flavin-dependent-oxidoreductase
MKFSLFVHMERWDESVSHRQLFEELTELTLMAEAGGFCTVWVGEHHAMEYTISPSPMPILANLAARTSTIRLGAGTLIAPFWHPLRAAGECALLDVISEGRMEVGLARGAYQVEFDRMAGGLPATAGGKHLRELVPALRKLWEGDYAHDGEVWQFPTSTSVPKPVGTPPIWIAARDPDSHNFAVANGCNVMVTPLMKGDEEVVDLKHKFDNALANNPGVARPKLMVLRHTHVHAAEEPEGWKIGAQAIGRFYRTFDAWFGNKETPVNGFLAPSPEEKFAGRPEFELENIRKNTMIGTPEEVIARLRHYEELGVDEFSFWCDNSLPFAEKKKSLQLFIDKVAPAFA
>NZ_CP013987.1|WP_059315035.1|2570610_2571201_+|amino-acid-synthesis-family-protein
MSFEIRKVVTYLEETHIEGGKATDKPVTMAGVAVVIRNPWAGQGFVEDLKPEIKAHCSDLGAFIVERLTRAIGGAERIEAYGKAAVVGADGEIEHASAVIHTLRFGNHYREAVQAKSYLSFTNKRGAPGTSIQIPMMHKDDEGLRSHYITLEMRIEDAPRADEIVVVLGAADGGRLHPRIGNRYIDLEELAAEKAR
>NZ_CP013987.1|WP_059315036.1|2571214_2572054_+|alpha/beta-fold-hydrolase
MIRSTDAKTPAGTAYRIAGDGSPLVLIHGVGLSKDMWGGQLAGLAPRYQVIAYDMLGHGESQRPAAQATLDDYAAQLTELLDHLALETAVVVGFSMGGLIARAFALSYPQRLDALVILNSVFNRSVEQRSGVLERSRQAELEGPDANLDSALARWFSREYQGANPAQIQALRQAFANNDPQGYLTTYTLFATQDRYGAERLDSLQVPTLVATGELDSGSTPEMARQLAARIPRARTAVLADQRHMMPVESPKLVNALLLDFLDDVLAKAPSTSIKGYVA
>NZ_CP013987.1|WP_059315037.1|2572050_2573532_+|aldehyde-dehydrogenase
MTLQRFQMCIDGEWTAAQSGRTFASLDPATATAWAELPDADADDVDRAVQAAQRAFEAPAWRGLTASARGKLLRRLGDLIAANKEALAQLESRDNGKLIRETRGQVGYLPEFFHYTAGLADKIEGGTLPLDKTDLFAYTVHEPLGVIAGIVPWNSPLYLTAIKVAPALAAGNTVVIKPSEHASATILELARLALEAGIPPGVFNVVTGYGPGAGAALTRHPLVRKIAFTGGAATARHVVRASAENFAKLSLELGGKSPNIIFADADLDSAINGAVAGIYAASGQSCVAGSRLLVQDEIYDEFVTRLVERAQRIRIGNPQDDASEMGPMATEQQLAIVEQLVEAALAEGATLRLGGKRPDTGSAGWYYEPTLLECDRHSLRIMQEEVFGPVAAVIRFKDEAEALRLANDSELGLAAGIWTRDLGRAHRLARDIRSGIIWVNTYRAVSAMAPIGGFKNSGYGRESGIDSVLAYTETKTVWINLSQAPMPDPFVMR
>NZ_CP013987.1|WP_059315038.1|2573547_2574033_+|flavin-reductase-family-protein
MIDPAIYKQVMGAFPSGVTVVTTLDAEGNLAGLTASAFSALSLDPALVLFCPNYSSDTYPLLRDGKGFAIHLLSAEQQRIAYAFASKGKDKTQGIEWTRSALGNPLLADATAVIECELWREYDGGDHAIIVGAVKNLIVPDQEVIPMLYHRGRMGAAPIYA
>NZ_CP013987.1|WP_059315039.1|2574161_2574917_+|GntR-family-transcriptional-regulator
MRRAQLDDSFKITRSPVTLREMVCNRLRQAILNFQLLPGDRLVERDLCDRLGVSRTSVREALRHLESEGLVEFADARGPRVAIITLEDACDLYELRCVLEGLIVQLFTLRAGPREIEALEQALEENRKALEGAELPEVIETVQNFYNVLMEGCGNRVAATQLRQLQARVSYLRATSVSQANRRQASNAEMERMVAAIRSGDALAAHQASVDHVRAAAQVALDYLQRQQEHQGEQARELFIPRVQDEPRIER
>NZ_CP013987.1|WP_059315040.1|2574961_2575249_-|DUF1330-domain-containing-protein
MKGYWIAEVDVTDPEAYRGYTERAPAAFARYGGRFLARGGRAEQLEGEGWATRRVVIEFDSYEQALACYRSAEYQDACGHRQTAARAEIFIVEGL
>NZ_CP013987.1|WP_059315041.1|2575327_2576437_+|bifunctional-3,4-dihydroxy-2-butanone-4-phosphate-synthase/GTP-cyclohydrolase-II
MAIHPIEAIIEDFRAGKMVILVDDEDRENEGDILLAADACTPAAISFMAREARGLICLTLTEERCRQLNLMQMVSDNGTVHGTAFTVSIEAATGVTTGISAADRARTIEAAVAPDATARDLVQPGHIFPLRARDGGVLTRAGHTEAGCDLARLAGRNPSAVIVEVMNDDGSMARRPDLERFGERHGIKLGTIADLIHYRLRHEHTVIRIGESELPTVHGTFRLLTYEDRIEGGVHLAMVMGDIDRETPTLVRVHALDPLRDLVGAEYSGPPSWTLWAALERVAREGHGIVVVLANHESSQALLARVPSLTQPKRLFERSQSRIYAEVGTGAQILQDLGVGRIRHLGLPLRYAGLTGYELEIVETLPFPG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP013987_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013987_2

3369441-3369527

Orphan

Consensus_repeat	Method
GGGAGAGGGCTAGGGTGAGGGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013987_2

>merge|NZ_CP013987|2|3369441-3369527|CRISPRCasFinder
GGGAGAGGGCTAGGGTGAGGGCCAAATCCCGCACCCGCGCACCACTCTTATCCCCTCTCCCTCCGGGAGAGGGCTAGGGTGAGGGCC

>NZ_CP013987|2|2|3369441-3369527|CRISPRCasFinder
GGGAGAGGGCTAGGGTGAGGGCC	AAATCCCGCACCCGCGCACCACTCTTATCCCCTCTCCCTCC
GGGAGAGGGCTAGGGTGAGGGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013987.1\|WP_156428966.1\|3374044_3374461_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013987.1\|WP_059315636.1\|3357114_3357558_-\|hotdog-fold-thioesterase	unknown	unknown	gnl\|CDD\|161843
NZ_CP013987.1\|WP_059315642.1\|3363386_3364733_-\|dicarboxylate/amino-acid:cation-symporter	unknown	unknown	gnl\|CDD\|234968
NZ_CP013987.1\|WP_059315650.1\|3375629_3376388_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187602
NZ_CP013987.1\|WP_059315651.1\|3376384_3377128_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP013987.1\|WP_059226744.1\|3377226_3377694_+\|RNA-methyltransferase	unknown	unknown	gnl\|CDD\|349971
NZ_CP013987.1\|WP_059315646.1\|3371062_3372109_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227008
NZ_CP013987.1\|WP_059315640.1\|3360299_3361517_+\|beta-ketoacyl-ACP-synthase-I	unknown	unknown	gnl\|CDD\|181184
NZ_CP013987.1\|WP_059315637.1\|3357578_3358034_-\|phosphohistidine-phosphatase-SixA	unknown	unknown	gnl\|CDD\|224973
NZ_CP013987.1\|WP_007160484.1\|3359772_3360288_+\|3-hydroxyacyl-[acyl-carrier-protein]-dehydratase-FabA	unknown	unknown	gnl\|CDD\|179953
NZ_CP013987.1\|WP_059315647.1\|3372301_3373435_+\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|143635
NZ_CP013987.1\|WP_059315641.1\|3361771_3362986_+\|sugar-MFS-transporter	unknown	unknown	gnl\|CDD\|340952
NZ_CP013987.1\|WP_174523168.1\|3358030_3358336_-\|DUF4389-domain-containing-protein	unknown	unknown	gnl\|CDD\|379561
NZ_CP013987.1\|WP_059315643.1\|3365119_3365860_+\|4'-phosphopantetheinyl-transferase-superfamily-protein	unknown	unknown	gnl\|CDD\|225524
NZ_CP013987.1\|WP_059315645.1\|3369569_3370820_+\|ribonucleotide-diphosphate-reductase-subunit-beta	unknown	unknown	gnl\|CDD\|235968
NZ_CP013987.1\|WP_059315644.1\|3366474_3369390_+\|ribonucleoside-diphosphate-reductase-subunit-alpha	unknown	unknown	gnl\|CDD\|235966
NZ_CP013987.1\|WP_059315639.1\|3358361_3359396_-\|NAD(P)H-dependent-glycerol-3-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|234629
NZ_CP013987.1\|WP_059315648.1\|3373483_3373957_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP013987.1\|WP_059315652.1\|3377873_3378704_-\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_CP013987.1\|WP_059315649.1\|3374577_3375453_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176166

Protein	Function_ID	Function_description	E-value
NZ_CP013987.1\|WP_059315636.1\|3357114_3357558_-\|hotdog-fold-thioesterase	gnl\|CDD\|161843	TIGR00369, Putative_esterase, uncharacterized domain 1. Most proteins containing this domain consist almost entirely of a single copy of this domain. A protein from C. elegans consists of two tandem copies of the domain. The domain is also found as the N-terminal region of an apparent initiation factor eIF-2B alpha subunit of Aquifex aeolicus. The function of the domain is unknown.	7.45232e-39
NZ_CP013987.1\|WP_059315642.1\|3363386_3364733_-\|dicarboxylate/amino-acid:cation-symporter	gnl\|CDD\|234968	PRK01663, PRK01663, C4-dicarboxylate transporter DctA; Reviewed.	0
NZ_CP013987.1\|WP_059315650.1\|3375629_3376388_+\|SDR-family-oxidoreductase	gnl\|CDD\|187602	cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR. This subgroup resembles the SDR family, but does not have a perfect match to the NAD-binding motif or the catalytic tetrad characteristic of the SDRs. It includes the SDRs, Q9HYA2 from Pseudomonas aeruginosa PAO1 and APE0912 from Aeropyrum pernix K1. BKR catalyzes the NADPH-dependent reduction of ACP in the first reductive step of de novo fatty acid synthesis (FAS). FAS consists of four elongation steps, which are repeated to extend the fatty acid chain through the addition of two-carbo units from malonyl acyl-carrier protein (ACP): condensation, reduction, dehydration, and a final reduction. Type II FAS, typical of plants and many bacteria, maintains these activities on discrete polypeptides, while type I FAS utilizes one or two multifunctional polypeptides. BKR resembles enoyl reductase, which catalyzes the second reduction step in FAS. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	3.12077e-75
NZ_CP013987.1\|WP_059315651.1\|3376384_3377128_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	3.86122e-13
NZ_CP013987.1\|WP_059226744.1\|3377226_3377694_+\|RNA-methyltransferase	gnl\|CDD\|349971	cd18098, SpoU-like, SAM-dependent rRNA or tRNA methylase related to SpoU. RNA 2'-O ribose methyltransferase catalyzes the methyltransfer from S-adenosyl-L-methionine (AdoMet) to the 2'-OH group of ribose in tRNA or rRNA. It is part of the SpoU family of MTases, a subfamily of the SPOUT methyltransferase superfamily. The SPOUT methyltransferase superfamily is a large class of S-adenosyl-L-methionine (AdoMet or SAM)-dependent RNA MTases which are structurally characterized by a deep trefoil knot.	4.649e-66
NZ_CP013987.1\|WP_059315646.1\|3371062_3372109_+\|hypothetical-protein	gnl\|CDD\|227008	COG4662, TupA, ABC-type tungstate transport system, periplasmic component [Coenzyme metabolism].	0.00391538
NZ_CP013987.1\|WP_059315640.1\|3360299_3361517_+\|beta-ketoacyl-ACP-synthase-I	gnl\|CDD\|181184	PRK07967, PRK07967, beta-ketoacyl-ACP synthase I.	0
NZ_CP013987.1\|WP_059315637.1\|3357578_3358034_-\|phosphohistidine-phosphatase-SixA	gnl\|CDD\|224973	COG2062, SixA, Phosphohistidine phosphatase SixA [Signal transduction mechanisms].	5.59318e-29
NZ_CP013987.1\|WP_007160484.1\|3359772_3360288_+\|3-hydroxyacyl-[acyl-carrier-protein]-dehydratase-FabA	gnl\|CDD\|179953	PRK05174, PRK05174, bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase.	4.91688e-132
NZ_CP013987.1\|WP_059315647.1\|3372301_3373435_+\|GGDEF-domain-containing-protein	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	2.0776e-50
NZ_CP013987.1\|WP_059315641.1\|3361771_3362986_+\|sugar-MFS-transporter	gnl\|CDD\|340952	cd17394, MFS_FucP_like, Fucose permease and similar proteins of the Major Facilitator Superfamily of transporters. This subfamily is composed of L-fucose permease (also called L-fucose-proton symporter) and similar proteins such as glucose/galactose transporter and N-acetyl glucosamine transporter NagP. L-fucose permease facilitates the uptake of L-fucose across the boundary membrane with the concomitant transport of protons into the cell; it can also transport L-galactose and D-arabinose. Glucose/galactose transporter functions in the uptake of of glucose and galactose. The FucP-like subfamily belongs to the bacterial fucose permease, eukaryotic Major facilitator superfamily domain-containing protein 4 (FucP/MFSD4) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	8.3405e-147
NZ_CP013987.1\|WP_174523168.1\|3358030_3358336_-\|DUF4389-domain-containing-protein	gnl\|CDD\|379561	pfam14333, DUF4389, Domain of unknown function (DUF4389). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and archaea. Proteins in this family are typically between 104 and 223 amino acids in length. There is a single completely conserved residue R that may be functionally important.	3.78893e-22
NZ_CP013987.1\|WP_059315643.1\|3365119_3365860_+\|4'-phosphopantetheinyl-transferase-superfamily-protein	gnl\|CDD\|225524	COG2977, EntD, Phosphopantetheinyl transferase component of siderophore synthetase [Secondary metabolites biosynthesis, transport, and catabolism].	8.71567e-60
NZ_CP013987.1\|WP_059315645.1\|3369569_3370820_+\|ribonucleotide-diphosphate-reductase-subunit-beta	gnl\|CDD\|235968	PRK07209, PRK07209, ribonucleotide-diphosphate reductase subunit beta; Validated.	0
NZ_CP013987.1\|WP_059315644.1\|3366474_3369390_+\|ribonucleoside-diphosphate-reductase-subunit-alpha	gnl\|CDD\|235966	PRK07207, PRK07207, ribonucleoside-diphosphate reductase subunit alpha.	0
NZ_CP013987.1\|WP_059315639.1\|3358361_3359396_-\|NAD(P)H-dependent-glycerol-3-phosphate-dehydrogenase	gnl\|CDD\|234629	PRK00094, gpsA, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase.	8.15593e-164
NZ_CP013987.1\|WP_059315648.1\|3373483_3373957_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.69624e-13
NZ_CP013987.1\|WP_059315652.1\|3377873_3378704_-\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	1.16243e-51
NZ_CP013987.1\|WP_059315649.1\|3374577_3375453_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176166	cd08477, PBP2_CrgA_like_8, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 8. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.02951e-72

>NZ_CP013987.1|WP_059315644.1|3366474_3369390_+|ribonucleoside-diphosphate-reductase-subunit-alpha
MQTDLTREQAQQGRPAQDDSQDLGATAPGQLRVIKRNGTVVPYTDDKITVAISKAFLAVEGGNAAASSRIHTTVKQLTDQVSSTFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARSYVIYREARSQERKQGAASDIAEPHPSIRVTKVDGTTQPLDMGRLNTIISEACEGLEEVNGELIQKETLKNLYDGVAEKDVNTALVMTSRTLVEREPNYSYVTARLLLDSLRAEGLSFLGVAESATHHEMAELYAKALPAYVAKGVELELLDPKLASFDLERLGAAIDHERDQQFTYLGLQTLYDRYFLHSHGTRFELPQLFFMRVAMGLAHMEKDKEARAIEFYNLLASFDYMASTPTLFNAGTLRPQLSSCYLTTVPDDLSGIYGAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVFEDGNWTLFSPADVPDLHDLYGKAFEERYEYYEALTEYGKLKLHKTIKAKDLWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSVNLVNHIVDGKLDVAKVARTVKTAVRMLDNVIDINYYSVPQAENSNLKHRPVGMGIMGFQDALYLQHIAYGSDAAVQFADTSMEVISYYAIQASCDLAEERGSYSSFQGSLWSQGILPIDSEKRLIEERGAKYIEVDLSETLDWAPLRERAKKGIRNSNIMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVINPYLVRDLKARGLWDSVMVNDLKYYDGSVQQIERIPQDLKDLYATAFEVETKWIVEAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWFRGLKTTYYLRALAATSTEKSTINTGKLNAVSADPITGVQASAAPAPAQKAEAAPAPAPAPVPKACSLDDPECEACQ
>NZ_CP013987.1|WP_059315643.1|3365119_3365860_+|4'-phosphopantetheinyl-transferase-superfamily-protein
MSTLPLAHLPGCCTTPEPLPPLSPELASLKLIHCRFDPALVSFERDALRLGALPPDNIRRAVAKRQAEYLAGRLCAREALRRLSGTDAVPGHRAEDRGPVWPAGHVGAITHGHGWAAAAVGSAQEYLGVGLDVETLLEPTKALRLADQILTPAEQERLQPLDEERQAFAITLAFSAKESLFKALHPQVRQMFFFQDAEILATDSRGTFVIRLLIELSSRWTAGTQLEGRFRLDEAGRLLTLLAPRA
>NZ_CP013987.1|WP_059315642.1|3363386_3364733_-|dicarboxylate/amino-acid:cation-symporter
MTATVDTTTTTAPAPKRPVKQPLYKSLYFQVILAIVLGILLGHFYPQTGAAMKPLGDGFIKLIKMVIAPIIFCTVVTGIAGMQNMKAVGKTGGMALLYFEIFSTIALLIGLIVVNVVQPGAGMNVDVSTLDTKGIAAYAAAAEKQSTIDFLLNIIPSTVVNAFATGEILQVLFFAVLFGYALHRLGETGQLVFNFIDRISHVFFNIINVIMKLAPIGAFGAMAFTIGKYGVGTLVQLGYLMACFYITCVLFVLLVLGTVARMHGFSILKFIKYIREELLIVLGTSSSESALPRMLTKMQKLGAEKSVVGLVIPTGYSFNLDGTAIYLTMAAVFIAQATNTQMDITHQITLLLVLLISSKGAAGVTGSGFIVLAATLSAVGHVPVAGLALILGIDRFMSEARALTNLVGNGVASIVVAKWCGQLDEQTLKTELARGPNAVEVEEARQTA
>NZ_CP013987.1|WP_059315641.1|3361771_3362986_+|sugar-MFS-transporter
MHNQNQSYRGPLIVLTMLFFMWGLITSLNDILIPHLKAVFTLSYLQASLIQFCFFTAYFIVSFPAGRLVESLGYKKGIIVGLLTAGVGCVLFYPAAGAQSYGFFLTALFVLAAGITVLQVAANPYVTILGKPETAASRLNLTQAFNSLGTTVGPLVGAVTILALVGEDSAAHSVQLPYLILAGMLVALAVIIGLFRLPQIKDTEQDNATDENALTASSVWAYRHLLLGVVGIFMYVGAEVSIGSYLVSLMESPDVAGLNAATAAKYLSLYWGGAMVGRFIGGVIMTKVRPNLVLTFNAIAIGVLLAIAVLQGGKVAMWALLAIGFFNSIMFPTIFSLALKGLGKFTSKGSGLLCMGIVGGALVPAIQGFFADTIGLLPSFVVPLVCYVYILFYGVMGYRPTLRR
>NZ_CP013987.1|WP_059315640.1|3360299_3361517_+|beta-ketoacyl-ACP-synthase-I
MRRVVITGLGIVSCLGNDKDTVSANLRAGRAGIRHNPEYAEMGLRSQVSGSIDLNLEELIDRKVKRFVGDAAAYAYLAMDQAIKDSGLSEDQVSNPRTGLIAGSGGASTFNQMEALDILREKGVKRVGPYRVTRTMSSTVSACLATPFKIKGLNYSVASACATSAHCIGLAMEQIQLGKQDVVFAGGGEEEHWTQSMLFDAMGALSSDYNETPEKASRAYDSKRDGFVIAGGGGMVVVEELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQQALSTVDGEIDYLNTHGTSTPVGDVAEIKGVRAVFGDKAPAISSTKSLSGHSLGAAGVHEAIYCMLMMEGNFIAGSANIDELDPEVADLPILRETKENTKLDLIMSNSFGFGGTNATLVLKRWQG
>NZ_CP013987.1|WP_007160484.1|3359772_3360288_+|3-hydroxyacyl-[acyl-carrier-protein]-dehydratase-FabA
MTKQHAFTYEDLLRCSRGELFGPGNAQLPAPNMLMIDRITHISEVGGKYGKGELVAELDIRPDLWFFGCHFEGDPVMPGCLGLDAMWQLVGFYLGWQGNPGRGRALGSGEVKFFGQVLPTAKKVTYNIHIKRTINRSLILAIADGTVSVDGREIYSAEGLRVGLFTSTDSF
>NZ_CP013987.1|WP_059315639.1|3358361_3359396_-|NAD(P)H-dependent-glycerol-3-phosphate-dehydrogenase
MTVQSPIAVLGGGSFGTALANLVAENGLPVRLWMRDPHQAETIRRERENPRYLKGIKVHAAVEATSDLQGAIADCELILVALPSSALRQALAPIAQQLEGRFLVSTTKGIEAHSFMLMSEILAEIVPRARIGIISGPNLAREIAEHQLTATVVASEDEEVCRRVQAALHGRTFRVYASADRLGVELAGALKNVYAIIAGMAAALAMGENTRSMLITRALAEMTRFAVQRGANPITYLGLAGVGDLIVTCSSEKSRNYRVGHALGRGLSLEEAVAQIGETAEGVNTLRVLKEKADELGVYMPLVNGLYAILFEGRSLGQVIEALMGGEPKTDVDVADAAEIPSRL
>NZ_CP013987.1|WP_174523168.1|3358030_3358336_-|DUF4389-domain-containing-protein
MSMSQPVHSRELLGLRLIWMLLFLFVWLGAQYVLAVVVLVQLVVRLIKGEANPGLTAFGAALGAYLAQIVRFGTFASEVKPWPFADWPAAEQPDDRSATAP
>NZ_CP013987.1|WP_059315637.1|3357578_3358034_-|phosphohistidine-phosphatase-SixA
MKLWLLRHGEAEARASSDEQRELTAAGRAAVLRSAEQLQGSGLQRLLTSPYVRARQTAALVQQQLAWAGDVSVCQWATPDGEPERALAELERLGVEELLLVTHNPFVGELAGWLLHGHRQAPVPMGTASLLCLEAPLPLAGGFDLVSRFDG
>NZ_CP013987.1|WP_059315636.1|3357114_3357558_-|hotdog-fold-thioesterase
MSIWQTLPDPADLGRQLENTLGEHLDMRIEAWDDSSLTASMVVDKRTHQPMGLLHGGASVALAETVGSIASMLCVDRSRYYCVGQEINANHLRGVRAGRVTAVARPLHLGRSSHVWDIRLNDEEGRLTCVSRLTVAVVPLQRDHPST
>NZ_CP013987.1|WP_059315645.1|3369569_3370820_+|ribonucleotide-diphosphate-reductase-subunit-beta
MLNWEEFDKDDDTTTAKPAQAAGQQAPAQTERLDSEGDALVHDARAPSADDSDAVARAKAALNELDIQEGLDDLEGSSARVHVGDKQMINARADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMNADIATWKSADGLTEDERRIVKRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQAFEEAIHTHAYQYCIESLGMDEGEIFNMYHEIPSVAKKASWGLKYTRSISDPEFKTGTPETDRQFLKNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGTAEQFQYILRDESMHLNFGIDMINQIKIENPSLWDAQMKDEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIANRRLTQIGLKEEYPGATNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD
>NZ_CP013987.1|WP_059315646.1|3371062_3372109_+|hypothetical-protein
MPRWTDQPATDTDAVFDFILKFSGTFLRRHASLLAKGLPPTLGFGMFLAYFARNHFYPSFDLFQFSSLLLAAACLGFLTIGAFVAALFLPGAWVYYRFINTAAIKEDITYALPYRGEGRFRKIMLLMAVVFFVPYLLAGFSDAAILFVDPELFLSVALLAPIPITLLAGMAIQGLFDLRRFSFLKFVWEAYLPTMAVGLFIFWMLAQAYPLVSDWQPLFKWGALAIAPFIIAFVTTMTSMLFIAGWKAAMMFSLFFALFLAGYSGMLTTLPETMVKTLGLGNYQAKAIVLDTSYCAKEQARVLPTDDQCVLKEVQVVWSLGEAFVLHLADGSTARLPATAIRALVKPQ
>NZ_CP013987.1|WP_059315647.1|3372301_3373435_+|GGDEF-domain-containing-protein
MALDAPTMLILTIALAAAAAGYLAIEWRSVRESALLYWSAGFALICVGSTLALLRSQGLLLVGIWFANGLLILVHGLFLLGVARFTGRRLSLGWWAFAAIWLGMLLLPNEPWWSKVLLVVQSLMIGILAIRASLLLRRRNAGERQLRVVLLIHGLFYLAKMIPPLTPGTLIDLAVYRGAIIQISLVEGVMAVMLIALSMTGTVRYRREQHIERLAGSDPLTGLHNRRALEAEAPRLFGQATPARPSALLLIDLDNFKLVNDLHGHAAGDGLLIALSDLLRSTLPRQALAARLGGDEFVVLLGEAADADVVRLGETLRLRFNQLAAQRLRTPEPVTLSIGAVLFDQPPESLADLLERGDGALYEAKRGGRDGLRMSLG
>NZ_CP013987.1|WP_059315648.1|3373483_3373957_+|GNAT-family-N-acetyltransferase
MPFTLESPDQPEVIALIAELDAYQDDLYPPESRHALDLTSLMQPNVLFLVVRDDSGSALGCGAMVLQDDYGEIKRMYLSSRARGQGLGGRLLAELEREAVGRGCELARLETGPYQPEALRLYESAGYRRRGPFGAYRDDPLSVFIEKLLPIATYRIK
>NZ_CP013987.1|WP_156428966.1|3374044_3374461_+|hypothetical-protein
MTRNALIFLLAIIISQTAYSSPQDFSGIPDKFFDLLKQGQTIEAFSFIEKGAGKTGEIPSDLILKVVEGNGGYKFHELIKQVDYGKNYIAQAYIVGLKTGPALLTWKLYYNGEKWRVKYFNFTSNLDDIQTQKIADKL
>NZ_CP013987.1|WP_059315649.1|3374577_3375453_-|LysR-family-transcriptional-regulator
MDLLDSMQVFVAVVERGSLAAAAQAQGISPTMAGNHLRRLERRLGLQLLVRTTRRQRLTAFGEGYYARCREILALVADTDRQAETQRLAPAGILRVSAPVSFGTYGLTPRLGDYLARHPHVTLDLVLSDRVQDLVEEGIDIAIRIGELADSSLVARPLAPYVMWCCAAPGYLAQRGTPERLVDLEAHDCLGMDPRALSQWRAQTGTPFGPLPPGRLHLSNGPALRLAALQGLGIILQPAFLLQDDVATGNLVRLFQGQELTRPLTALYPQTRWRSVTVRSFVEFLLTEFTP
>NZ_CP013987.1|WP_059315650.1|3375629_3376388_+|SDR-family-oxidoreductase
MDLQLHDRTALVTGASMGIGTGIARVLAAEGVRLAITARRRDALEELAEEIAAAGHARPLVIVADITDAEDVQRLAREAEEGLGRVDILVNNAGGTRPLSVTADDAAWDEAWALNFTATRRLTQALLGGMRERRWGRIVNFSGSMEPRDVNGAGTAKAAIQFWSKGLASQLAAEGITVNTIAPGRINSEQILQRLHPTPEARQAFIARHIPIGYFGEPEDVGQVVAFLASPLARYLTGDVIAVDGGMHAHAH
>NZ_CP013987.1|WP_059315651.1|3376384_3377128_-|class-I-SAM-dependent-methyltransferase
MSATALYTDLSAYYDLLCADIDYRAQSQAVLRLQRLFGNGGGRHLDLACGTGPHVRHFLDAGFQSSGLDLNPPMLAQAALRCPEAEFSCQDMCSFTLEQPVDLITCFLYSLHYSGSLARLQACLAQVQTALTPGGLFCFNAVDKRRIDNASSVGHSVERADGHFSFASAWHYPGEGEHQKLRLRIERRHAGEQQTWQDEHPMVAVDFPELLALLEPQFDVQMLEHDYQRIEPWAGEAGNALFVCVKR
>NZ_CP013987.1|WP_059226744.1|3377226_3377694_+|RNA-methyltransferase
MSNKRYACIGLSNPKSPSNVGSIMRAAGCYGVASVFYTGTRYDRAKDFVTDTKKVHQDIPLINIDDLRRILPLGCVPVAVELVDGARPLPEYTHPDRALYLFGSEDGSLSQELRDWCEDVVYIPTQGCMNLAATVNVVLYDRLAKGNNTRSGPLF
>NZ_CP013987.1|WP_059315652.1|3377873_3378704_-|IclR-family-transcriptional-regulator
MSDSTERNMGSTEVGVGVISRVFAVVRALGEGDPEGEKVTRLAERVGLSQPTTHRLLRGLVEEGMVEQCARSKRYRLSLDFFALAASAGQVGNLRDLARPSLLRLSASLGDSLFLLARSGFDAMCLDRSEGPYPIRTFTGDIGGRVPLGGGQGALAILAFLPEEEREEVIRYNLPRLRDAHHYDEVLLRAEIDNVRQQGYAARNTGVLAGMAGLAVPILDRNGRAVAALSVGTLSERLNPQRLPTVIELLRREAGVIAARINPFDPVLRRPTQGFG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2115542 : 2171303

uncultured_Caudovirales_phage(43.14%)

portal,protease,head,tRNA,integrase,bacteriocin,holin,terminase,tail,capsid

attL 2105439:2105456|attR 2137338:2137355

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2105439:2105456	attL	NA	NA	NA	NA
WP_059314650.1\|2115542_2115899_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	3.1e-10	39.5
WP_059314651.1\|2115947_2118218_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	2.4e-164	43.0
WP_002553999.1\|2118290_2118509_-	translation initiation factor IF-1	NA	NA	NA	NA
WP_059314652.1\|2118604_2119312_-	arginyltransferase	NA	NA	NA	NA
WP_059314653.1\|2119347_2120037_-\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_059314654.1\|2120293_2122777_+	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	1.1e-87	51.7
WP_059314655.1\|2122794_2123418_+	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_059314656.1\|2123428_2124757_+	replication-associated recombination protein A	G3MBE0	Bacillus_virus	3.2e-76	40.0
WP_059314657.1\|2124804_2126082_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	4.3e-99	54.1
WP_059314658.1\|2126081_2127476_+	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_059314659.1\|2127479_2128481_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_059314660.1\|2128546_2129530_-	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	7.4e-123	65.4
WP_059314661.1\|2129526_2129841_-	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	4.0e-30	64.6
WP_059314662.1\|2129842_2130142_-	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	2.1e-12	43.9
WP_059314663.1\|2130138_2130495_-	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	6.8e-18	46.7
WP_059314664.1\|2130496_2130892_-	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	2.0e-42	63.8
WP_059314665.1\|2130941_2131610_-	Bax inhibitor-1/YccA family protein	A0A2H4JFM9	uncultured_Caudovirales_phage	6.2e-81	72.6
WP_059314666.1\|2131945_2132995_-\|integrase	tyrosine-type recombinase/integrase	A0A2H4JDJ8	uncultured_Caudovirales_phage	3.9e-106	57.9
WP_059314667.1\|2132996_2133239_-	DUF4224 domain-containing protein	NA	NA	NA	NA
WP_059314668.1\|2133353_2133746_-	DUF2591 family protein	A0A2H4J8F6	uncultured_Caudovirales_phage	1.3e-67	93.8
WP_059314669.1\|2133742_2134078_-	hypothetical protein	NA	NA	NA	NA
WP_059314670.1\|2134074_2134578_-	hypothetical protein	A0A0S2SY59	Pseudomonas_phage	7.6e-15	34.7
WP_059314671.1\|2134634_2134910_-	hypothetical protein	NA	NA	NA	NA
WP_167348563.1\|2134918_2135059_-	hypothetical protein	NA	NA	NA	NA
WP_156428940.1\|2135300_2136311_+	hypothetical protein	NA	NA	NA	NA
WP_059314673.1\|2136959_2137139_-	hypothetical protein	A0A2D2W6B5	Pectobacterium_phage	7.6e-10	53.1
WP_059314674.1\|2137153_2137414_-	hypothetical protein	A0A2H4JFR3	uncultured_Caudovirales_phage	5.5e-17	75.9
2137338:2137355	attR	NA	NA	NA	NA
WP_156428999.1\|2137410_2137749_-	helix-turn-helix transcriptional regulator	A0A2H4JA92	uncultured_Caudovirales_phage	2.0e-43	96.0
WP_059314676.1\|2137796_2138018_-	hypothetical protein	NA	NA	NA	NA
WP_082696313.1\|2138014_2138134_-	hypothetical protein	A0A2H4JG58	uncultured_Caudovirales_phage	1.5e-09	76.9
WP_059314677.1\|2138308_2138518_-	hypothetical protein	NA	NA	NA	NA
WP_082696314.1\|2138917_2139202_+	DUF1654 domain-containing protein	A0A2D1GND3	Pseudomonas_phage	9.5e-15	51.2
WP_082696315.1\|2139320_2140697_-	Fic family protein	A0A1V0E025	Clostridioides_phage	1.8e-21	27.3
WP_059314679.1\|2141034_2141883_-	helix-turn-helix domain-containing protein	A0A2D1GNH0	Pseudomonas_phage	1.2e-57	56.2
WP_059314680.1\|2141985_2142204_+	hypothetical protein	NA	NA	NA	NA
WP_174523134.1\|2142388_2143189_+	hypothetical protein	A0A2D1GNQ6	Pseudomonas_phage	1.3e-61	54.8
WP_156428941.1\|2143169_2143973_+	ATP-binding protein	A0A059VK34	Pseudomonas_phage	4.3e-60	48.6
WP_059314682.1\|2144091_2144313_+	hypothetical protein	NA	NA	NA	NA
WP_059314683.1\|2144309_2144615_+	DUF1364 family protein	A0A2I7QSH6	Vibrio_phage	1.6e-20	53.9
WP_059314684.1\|2144611_2144962_+	RusA family crossover junction endodeoxyribonuclease	A0A0H5AUD2	Pseudomonas_phage	6.6e-42	75.4
WP_059314685.1\|2144958_2145390_+	hypothetical protein	NA	NA	NA	NA
WP_156428942.1\|2145367_2145667_+	hypothetical protein	NA	NA	NA	NA
WP_059314687.1\|2145669_2146233_+	hypothetical protein	H2BDI9	Pseudomonas_virus	2.6e-48	53.5
WP_082696317.1\|2146523_2146712_+	Com family DNA-binding transcriptional regulator	B5TK59	Pseudomonas_phage	1.1e-11	86.8
WP_059314688.1\|2146717_2147554_+\|bacteriocin	putidacin L1 family lectin-like bacteriocin	NA	NA	NA	NA
WP_059314689.1\|2147616_2147991_+	hypothetical protein	A0A2H4J7X6	uncultured_Caudovirales_phage	1.2e-36	57.3
WP_059314690.1\|2147994_2148318_+\|holin	phage holin family protein	A0A2H4J0H1	uncultured_Caudovirales_phage	7.0e-22	57.3
WP_059314691.1\|2148314_2148545_+	hypothetical protein	NA	NA	NA	NA
WP_059314692.1\|2148541_2148727_+	hypothetical protein	NA	NA	NA	NA
WP_059314693.1\|2148726_2149092_+	HNH endonuclease	H2BDK0	Pseudomonas_virus	9.4e-23	59.1
WP_059314694.1\|2149222_2149708_+\|terminase	phage terminase small subunit P27 family	A0A2D1GNP3	Pseudomonas_phage	5.9e-73	84.3
WP_059314695.1\|2149707_2151429_+\|terminase	terminase large subunit	A0A2D1GNU5	Pseudomonas_phage	2.3e-284	82.1
WP_059314696.1\|2151428_2152694_+\|portal	phage portal protein	A0A286S1N5	Klebsiella_phage	1.4e-182	75.4
WP_059314697.1\|2152711_2153374_+\|head,protease	HK97 family phage prohead protease	K7PM91	Enterobacterial_phage	2.8e-73	65.2
WP_059314698.1\|2153384_2154551_+\|capsid	phage major capsid protein	K7P862	Enterobacteria_phage	4.3e-162	74.5
WP_059314699.1\|2154589_2154784_+	hypothetical protein	NA	NA	NA	NA
WP_059314700.1\|2154780_2155131_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_059314701.1\|2155111_2155450_+\|head	phage head closure protein	A0A1J0GUY4	Halomonas_phage	5.1e-31	58.9
WP_082696318.1\|2155452_2155887_+	HK97 gp10 family phage protein	A0A2H4JB20	uncultured_Caudovirales_phage	2.6e-19	40.3
WP_059314702.1\|2155886_2156252_+	DUF3168 domain-containing protein	Q9MCA6	Pseudomonas_phage	1.3e-32	56.2
WP_058790571.1\|2156315_2156810_+\|tail	phage tail protein	Q9MCA5	Pseudomonas_phage	2.0e-44	56.6
WP_059314703.1\|2156819_2157194_+\|tail	phage tail assembly chaperone family protein, TAC	NA	NA	NA	NA
WP_174523135.1\|2157208_2157502_+	hypothetical protein	A0A1J0GUY0	Halomonas_phage	7.8e-12	38.0
WP_059314705.1\|2158095_2160831_+\|tail	phage tail tape measure protein	A0A2H4J107	uncultured_Caudovirales_phage	2.2e-124	38.6
WP_059314706.1\|2160843_2161428_+	hypothetical protein	A0A2H4IYI9	uncultured_Caudovirales_phage	1.6e-56	58.2
WP_059314707.1\|2161427_2162027_+	hypothetical protein	A0A059VA31	Pseudomonas_phage	1.4e-84	72.7
WP_059314708.1\|2162031_2162430_+	hypothetical protein	A0A2H4IYI8	uncultured_Caudovirales_phage	7.5e-50	66.7
WP_059314709.1\|2162429_2165363_+	DUF1983 domain-containing protein	A0A059VFW9	Pseudomonas_phage	4.8e-303	53.8
WP_059314710.1\|2165362_2165650_+	hypothetical protein	NA	NA	NA	NA
WP_059314711.1\|2165646_2166354_+	hypothetical protein	NA	NA	NA	NA
WP_059314712.1\|2166356_2166905_+	hypothetical protein	NA	NA	NA	NA
WP_082696420.1\|2167000_2167420_+	DUF4376 domain-containing protein	A0A1S5R1J2	Pseudomonas_phage	5.5e-27	51.4
WP_059314714.1\|2167416_2167776_+	DUF1353 domain-containing protein	A0A2H4JDM4	uncultured_Caudovirales_phage	6.1e-51	82.1
WP_059314715.1\|2167977_2168451_+	hypothetical protein	A0A2H4JFP9	uncultured_Caudovirales_phage	2.3e-77	93.0
WP_059314716.1\|2168450_2168861_+	hypothetical protein	A0A2H4JA72	uncultured_Caudovirales_phage	8.0e-39	71.3
WP_059314717.1\|2168857_2169124_+	hypothetical protein	A0A2H4J8E9	uncultured_Caudovirales_phage	1.5e-33	86.4
WP_059314718.1\|2169155_2169668_-	hypothetical protein	NA	NA	NA	NA
WP_156428943.1\|2169660_2170725_-	hypothetical protein	NA	NA	NA	NA
WP_059314719.1\|2170793_2171303_-	hypothetical protein	A0A2H4JG45	uncultured_Caudovirales_phage	4.3e-90	90.4

DBSCAN-SWA_2

2380321 : 2418094

Pseudomonas_virus(41.18%)

portal,head,integrase,tRNA,plate,holin,terminase,tail,capsid

attL 2389109:2389124|attR 2423315:2423330

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059314883.1\|2380321_2381335_-\|portal	phage portal protein	A0A2H4J922	uncultured_Caudovirales_phage	1.7e-151	78.6
WP_059314884.1\|2381334_2383122_-\|terminase	terminase ATPase subunit family protein	Q9ZXM5	Pseudomonas_virus	2.4e-281	81.0
WP_059314885.1\|2383276_2384122_+\|capsid	GPO family capsid scaffolding protein	A0A2H4J928	uncultured_Caudovirales_phage	3.2e-74	56.5
WP_059314886.1\|2384149_2385166_+\|capsid	phage major capsid protein, P2 family	Q9ZXM3	Pseudomonas_virus	3.0e-151	75.7
WP_059314887.1\|2385169_2385871_+\|terminase	terminase	Q9ZXM2	Pseudomonas_virus	3.6e-71	60.5
WP_059314888.1\|2385973_2386435_+\|head	head completion/stabilization protein	Q9ZXM1	Pseudomonas_virus	7.9e-43	60.8
WP_059314889.1\|2386434_2386659_+\|tail	tail protein X	A0A2H4J946	uncultured_Caudovirales_phage	8.9e-16	57.1
WP_059314890.1\|2386681_2386996_+\|holin	phage holin, lambda family	A0A2H4JFM8	uncultured_Caudovirales_phage	9.5e-24	53.4
WP_059314891.1\|2386992_2387817_+	DUF3380 domain-containing protein	A0A2H4JGJ9	uncultured_Caudovirales_phage	2.3e-85	62.5
WP_059314892.1\|2387813_2388020_+	hypothetical protein	NA	NA	NA	NA
WP_082696328.1\|2388016_2388451_+	DUF2570 domain-containing protein	Q9ZXL5	Pseudomonas_virus	3.8e-15	42.1
WP_059314893.1\|2388547_2389078_+\|tail	phage tail protein	Q9ZXL3	Pseudomonas_virus	3.4e-50	61.4
WP_059314894.1\|2389070_2389523_+	phage virion morphogenesis protein	Q9ZXL2	Pseudomonas_virus	4.1e-36	59.2
2389109:2389124	attL	NA	NA	NA	NA
WP_156428947.1\|2389525_2390263_-	hypothetical protein	NA	NA	NA	NA
WP_059314895.1\|2390377_2390971_+\|plate	phage baseplate assembly protein V	Q9ZXL0	Pseudomonas_virus	1.9e-57	66.2
WP_059314896.1\|2390967_2391312_+	GPW/gp25 family protein	A0A2H4JE52	uncultured_Caudovirales_phage	1.0e-26	56.8
WP_059314897.1\|2391308_2392217_+\|plate	baseplate J/gp47 family protein	Q9ZXK8	Pseudomonas_virus	1.5e-85	58.3
WP_059314898.1\|2392220_2392835_+\|tail	phage tail protein I	A0A2H4JAU2	uncultured_Caudovirales_phage	1.9e-68	66.3
WP_059314899.1\|2392831_2394490_+\|tail	phage tail protein	A0A077K818	Ralstonia_phage	1.0e-84	61.0
WP_059314900.1\|2394505_2395075_+	hypothetical protein	NA	NA	NA	NA
WP_059314901.1\|2395071_2395497_+	hypothetical protein	A0A2H4J973	uncultured_Caudovirales_phage	1.9e-38	51.1
WP_059314902.1\|2395692_2396496_+	hypothetical protein	NA	NA	NA	NA
WP_059314903.1\|2396602_2397769_+\|tail	phage tail sheath protein	F1BUU3	Erwinia_phage	9.0e-160	72.5
WP_059314904.1\|2397817_2398333_+\|tail	phage major tail tube protein	Q9ZXK3	Pseudomonas_virus	2.8e-73	77.2
WP_059314905.1\|2398390_2398696_+\|tail	phage tail assembly protein	R4JJY8	Burkholderia_phage	2.8e-20	50.5
WP_017640277.1\|2398704_2398824_+\|tail	GpE family phage tail protein	Q9ZXK1	Pseudomonas_virus	1.6e-08	66.7
WP_059314906.1\|2398813_2401411_+\|tail	phage tail tape measure protein	E5FFG5	Burkholderia_phage	5.4e-181	43.7
WP_027599413.1\|2401416_2401860_+\|tail	phage tail protein	Q9ZXJ9	Pseudomonas_virus	1.6e-53	70.3
WP_027599414.1\|2401856_2403128_+	phage late control D family protein	Q9ZXJ8	Pseudomonas_virus	3.5e-165	70.3
WP_156428948.1\|2403570_2404374_+	hypothetical protein	NA	NA	NA	NA
WP_156428949.1\|2404366_2405074_+	hypothetical protein	NA	NA	NA	NA
WP_051398751.1\|2405121_2405526_-	DUF4113 domain-containing protein	NA	NA	NA	NA
WP_082696423.1\|2405636_2405972_+	hypothetical protein	NA	NA	NA	NA
WP_156428950.1\|2406391_2407168_+	hypothetical protein	NA	NA	NA	NA
WP_059314907.1\|2407323_2408415_-	DUF4238 domain-containing protein	NA	NA	NA	NA
WP_027599416.1\|2408839_2409064_-	hypothetical protein	NA	NA	NA	NA
WP_027599417.1\|2409186_2409537_-	helix-turn-helix transcriptional regulator	A0A2H4JFL3	uncultured_Caudovirales_phage	1.4e-23	53.2
WP_059314908.1\|2409618_2409867_+	hypothetical protein	A0A2H4JE67	uncultured_Caudovirales_phage	1.7e-15	58.9
WP_027599419.1\|2409863_2410346_+	hypothetical protein	A0A2H4JG61	uncultured_Caudovirales_phage	5.2e-53	68.4
WP_027599420.1\|2410451_2410805_+	hypothetical protein	V9IQW3	Stenotrophomonas_phage	2.3e-10	38.5
WP_027599421.1\|2410801_2411158_+	hypothetical protein	A0A2H4J947	uncultured_Caudovirales_phage	9.2e-07	39.0
WP_027599422.1\|2411232_2411472_+	hypothetical protein	NA	NA	NA	NA
WP_082696333.1\|2411474_2414312_+	toprim domain-containing protein	A0A2H4J936	uncultured_Caudovirales_phage	0.0e+00	63.8
WP_059314909.1\|2414383_2414626_+	hypothetical protein	NA	NA	NA	NA
WP_027599424.1\|2414622_2414892_+	pyocin activator PrtN family protein	A0A2K8HN48	Pseudomonas_phage	5.5e-28	70.1
WP_059314910.1\|2414888_2416007_-\|integrase	tyrosine-type recombinase/integrase	L7TP61	Pseudomonas_virus	9.5e-151	70.6
WP_059314911.1\|2416109_2417120_+\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
WP_059314912.1\|2417167_2418094_+	transaldolase	A0A1D8KMI9	Synechococcus_phage	1.1e-11	35.4
2423315:2423330	attR	NA	NA	NA	NA

DBSCAN-SWA_3

3245945 : 3254539

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059315558.1\|3245945_3246860_-	dTDP-4-dehydrorhamnose reductase	I7HXC9	Enterobacteria_phage	7.1e-35	36.7
WP_059315559.1\|3246856_3247393_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	1.6e-58	63.7
WP_059315560.1\|3247392_3248274_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	1.9e-106	65.2
WP_059315561.1\|3248346_3249411_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	6.8e-98	51.8
WP_059315562.1\|3249632_3251615_-	polysaccharide biosynthesis protein	A0A2P1ELS8	Moumouvirus	3.9e-14	24.5
WP_059315563.1\|3251625_3252675_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_059315564.1\|3252674_3253646_-	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_059315565.1\|3253785_3254007_-	hypothetical protein	NA	NA	NA	NA
WP_007160396.1\|3254251_3254539_-	integration host factor subunit beta	G3M9Y0	Bacillus_virus	1.6e-09	39.1

DBSCAN-SWA_4

4727824 : 4758287

Bacillus_virus(20.0%)

holin,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059316703.1\|4727824_4728766_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_059316704.1\|4729034_4729973_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_059316705.1\|4730089_4730932_+\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
WP_059316706.1\|4730935_4732168_+\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.4e-25	35.1
WP_059316707.1\|4732480_4733338_-	formyltetrahydrofolate deformylase	NA	NA	NA	NA
WP_059316708.1\|4733438_4734068_-	sarcosine oxidase subunit gamma	NA	NA	NA	NA
WP_059316709.1\|4734084_4737105_-	sarcosine oxidase subunit alpha	NA	NA	NA	NA
WP_059316710.1\|4737101_4737401_-	sarcosine oxidase subunit delta	NA	NA	NA	NA
WP_059316711.1\|4737412_4738663_-	sarcosine oxidase subunit beta family protein	NA	NA	NA	NA
WP_059316712.1\|4738742_4739996_-	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	9.8e-104	53.8
WP_059316713.1\|4740212_4741571_+	PAS domain S-box protein	NA	NA	NA	NA
WP_059316714.1\|4741663_4742092_+	universal stress protein	NA	NA	NA	NA
WP_007160046.1\|4742149_4742929_-	exodeoxyribonuclease III	NA	NA	NA	NA
WP_059316715.1\|4743009_4743651_+	orotate phosphoribosyltransferase	NA	NA	NA	NA
WP_059316716.1\|4743676_4744273_+	hypothetical protein	NA	NA	NA	NA
WP_059316717.1\|4744545_4745211_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_059316718.1\|4745226_4746078_+	DUF1989 domain-containing protein	NA	NA	NA	NA
WP_059316719.1\|4746138_4747041_-	acetylglutamate kinase	NA	NA	NA	NA
WP_059316720.1\|4747115_4749677_-	phosphomannomutase/phosphoglucomutase	A0A127AWJ1	Bacillus_phage	7.0e-56	29.8
WP_059316721.1\|4749722_4750178_-	dUTP diphosphatase	Q2NP83	Xanthomonas_phage	5.0e-50	61.1
WP_059316722.1\|4750170_4751394_-	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	2.4e-38	31.1
WP_059316723.1\|4751530_4752205_+	DNA repair protein RadC	NA	NA	NA	NA
WP_059316724.1\|4752534_4754079_+	type VI secretion system protein TssA	NA	NA	NA	NA
WP_059316725.1\|4754108_4754603_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_059316726.1\|4754608_4756096_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_059316727.1\|4756102_4756498_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_059316728.1\|4756502_4758287_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP013987

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection