CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP013419	Burkholderia sp. MSMB0266 plasmid pMSMB0266, complete sequence	0 crisprs	NA	0	2	0
NZ_CP013418	Burkholderia sp. MSMB0266 chromosome 2, complete sequence	1 crisprs	csa3,cas3,DinG,RT	0	3	0
NZ_CP013417	Burkholderia sp. MSMB0266 chromosome 1, complete sequence	2 crisprs	cas3,RT,PrimPol,DEDDh,csa3,DinG	2	10	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

82585 : 206689

103

Burkholderia_phage(30.77%)

protease,holin,integrase,lysis,plate,tail,transposase

attL 118882:118941|attR 216515:216646

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059583948.1\|82585_83113_+\|protease	hydrogenase maturation protease	NA	NA	NA	NA
WP_059583950.1\|83105_83393_+	hydrogenase nickel incorporation protein HypA	NA	NA	NA	NA
WP_059583952.1\|83392_85723_+	carbamoyltransferase HypF	NA	NA	NA	NA
WP_059584010.1\|85722_85965_+	HypC/HybG/HupF family hydrogenase formation chaperone	NA	NA	NA	NA
WP_059583954.1\|85961_87107_+	hydrogenase formation protein HypD	NA	NA	NA	NA
WP_059583956.1\|87103_88156_+	hydrogenase expression/formation protein HypE	NA	NA	NA	NA
WP_059583957.1\|88708_89521_+	ATP-binding cassette domain-containing protein	W6JKT0	Anomala_cuprea_entomopoxvirus	5.3e-26	34.3
WP_059710775.1\|89477_90326_+	ABC transporter permease	NA	NA	NA	NA
WP_157131170.1\|90345_92001_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_059583962.1\|94017_95190_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_059583965.1\|95339_95885_-	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_059583969.1\|97374_99141_+	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	9.2e-132	50.3
WP_059583971.1\|99137_100160_+	pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha	NA	NA	NA	NA
WP_059583974.1\|100156_101131_+	alpha-ketoacid dehydrogenase subunit beta	NA	NA	NA	NA
WP_059583977.1\|101159_102299_+	2-oxo acid dehydrogenase subunit E2	NA	NA	NA	NA
WP_059583979.1\|102295_102544_+	acyl carrier protein	NA	NA	NA	NA
WP_059584012.1\|102540_102972_-	response regulator transcription factor	NA	NA	NA	NA
WP_059583982.1\|102991_104068_+	hypothetical protein	A0A2H4J9J6	uncultured_Caudovirales_phage	5.2e-21	28.4
WP_082717569.1\|105858_106368_-	DUF2059 domain-containing protein	NA	NA	NA	NA
WP_059583984.1\|106797_107409_-	membrane integrity-associated transporter subunit PqiC	NA	NA	NA	NA
WP_059583987.1\|107405_109031_-	MCE family protein	NA	NA	NA	NA
WP_059583989.1\|109023_109743_-	hypothetical protein	NA	NA	NA	NA
WP_059583992.1\|109739_110396_-	paraquat-inducible protein A	NA	NA	NA	NA
WP_059583997.1\|111039_111702_-	DUF3313 domain-containing protein	NA	NA	NA	NA
WP_059583999.1\|111974_112571_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_082717564.1\|113313_114015_+	hypothetical protein	NA	NA	NA	NA
WP_059584002.1\|114019_114388_+	hypothetical protein	NA	NA	NA	NA
WP_059584004.1\|114630_114894_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_063889481.1\|114890_115319_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_059584018.1\|115330_116413_+	hypothetical protein	NA	NA	NA	NA
WP_156439882.1\|116828_117964_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	8.8e-11	26.5
WP_157131171.1\|118183_119000_+\|transposase	IS5 family transposase	NA	NA	NA	NA
118882:118941	attL	NA	NA	NA	NA
WP_059579167.1\|119082_120045_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	2.2e-119	68.1
WP_156432335.1\|120285_120756_+	hypothetical protein	NA	NA	NA	NA
WP_059579164.1\|120990_123120_+	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	1.2e-40	28.8
WP_059579161.1\|123147_124572_+	HlyD family type I secretion periplasmic adaptor subunit	NA	NA	NA	NA
WP_082717301.1\|124663_126061_+	TolC family protein	NA	NA	NA	NA
WP_059579158.1\|127838_128627_-	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	3.1e-31	32.3
WP_059579152.1\|129367_129751_-	hypothetical protein	NA	NA	NA	NA
WP_045598729.1\|130618_130879_-	hypothetical protein	NA	NA	NA	NA
WP_063889484.1\|134241_134355_-\|tail	GpE family phage tail protein	A0A089FGX3	Burkholderia_phage	1.0e-12	91.9
WP_059627739.1\|134526_134997_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_045598729.1\|135060_135321_+	hypothetical protein	NA	NA	NA	NA
WP_085701527.1\|135330_136953_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	4.7e-66	34.1
WP_082717279.1\|137052_137466_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.9e-16	38.5
WP_059584105.1\|137405_137867_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_059583232.1\|137948_138227_-\|tail	phage tail assembly protein	K4NXA3	Burkholderia_phage	3.0e-37	91.3
WP_156437503.1\|138563_139301_-	hypothetical protein	NA	NA	NA	NA
WP_059583227.1\|139477_139897_-\|tail	phage tail protein	A4JWT7	Burkholderia_virus	2.1e-66	90.6
WP_059583236.1\|139889_140024_-	hypothetical protein	K4PAX1	Burkholderia_phage	1.2e-15	90.9
WP_059583224.1\|140001_140442_-\|lysis	LysB family phage lysis regulatory protein	K4NXJ2	Burkholderia_phage	1.2e-67	93.2
WP_059583222.1\|140438_141251_-	DUF3380 domain-containing protein	A4JWZ0	Burkholderia_virus	1.8e-143	94.8
WP_059583219.1\|141247_141520_-\|holin	phage holin family protein	K4NX91	Burkholderia_phage	1.7e-40	96.7
WP_059583217.1\|141521_141866_-	hypothetical protein	K4NZQ3	Burkholderia_phage	3.0e-47	95.6
WP_059583215.1\|142084_142336_-	hypothetical protein	A4JWZ4	Burkholderia_virus	1.4e-22	68.7
WP_059583208.1\|144301_144661_-	type II toxin-antitoxin system HicB family antitoxin	R4JJS9	Burkholderia_phage	3.0e-50	80.7
WP_059583206.1\|144657_144912_-	type II toxin-antitoxin system HicA family toxin	R4JMD3	Burkholderia_phage	6.5e-39	91.7
WP_156432331.1\|145276_145522_+	hypothetical protein	NA	NA	NA	NA
WP_059583204.1\|147109_148378_+	serine dehydratase subunit alpha family protein	NA	NA	NA	NA
WP_059583202.1\|148409_149156_+	AzlC family ABC transporter permease	NA	NA	NA	NA
WP_059583200.1\|149143_149464_+	AzlD domain-containing protein	NA	NA	NA	NA
WP_157131172.1\|149973_150790_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_156432332.1\|151997_152390_+\|transposase	transposase	NA	NA	NA	NA
WP_059584666.1\|152386_152722_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_059669918.1\|154144_156223_-	serine recombinase	I3VYZ3	Thermoanaerobacterium_phage	3.1e-09	22.8
WP_082717267.1\|156209_156413_-	hypothetical protein	NA	NA	NA	NA
WP_156432333.1\|158052_159561_+	DASS family sodium-coupled anion symporter	NA	NA	NA	NA
WP_059584678.1\|159574_160624_+	Ldh family oxidoreductase	NA	NA	NA	NA
WP_059584683.1\|160981_161551_-	hypothetical protein	B0FIT1	Escherichia_phage	4.1e-09	31.6
WP_059574913.1\|163833_164841_+	N-acetylmuramoyl-L-alanine amidase	A0A223VZK2	Agrobacterium_phage	6.6e-10	30.6
WP_059574911.1\|164954_166280_+	autotransporter strand-loop-strand O-heptosyltransferase	NA	NA	NA	NA
WP_082717445.1\|166418_167789_+	hypothetical protein	NA	NA	NA	NA
WP_059574904.1\|167838_168198_+	hypothetical protein	NA	NA	NA	NA
WP_059574903.1\|168419_170126_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_059574901.1\|170116_170851_-	response regulator transcription factor	NA	NA	NA	NA
WP_059574899.1\|170847_172650_-	sensor histidine kinase	W8CYF6	Bacillus_phage	4.0e-05	29.0
WP_059574897.1\|172929_173424_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_082717447.1\|173447_174962_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_059574893.1\|175145_175634_+	Hcp family type VI secretion system effector	NA	NA	NA	NA
WP_063889415.1\|175630_176083_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_059574889.1\|176108_177842_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_059574887.1\|177829_178849_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_059574925.1\|178835_181544_+	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	8.1e-87	29.7
WP_059574886.1\|181570_184555_+	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_059574883.1\|184580_187142_+	DUF2169 domain-containing protein	NA	NA	NA	NA
WP_059574881.1\|187150_188215_+	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_082717444.1\|188235_188934_+	DUF3540 domain-containing protein	NA	NA	NA	NA
WP_059574877.1\|188962_189355_+	DUF4150 domain-containing protein	NA	NA	NA	NA
WP_059574875.1\|189364_190093_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_059574921.1\|190116_191529_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_059574873.1\|191525_192191_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_059574923.1\|192202_195892_+	type VI secretion system protein ImpL	NA	NA	NA	NA
WP_082717443.1\|195949_197140_+	peptidase	NA	NA	NA	NA
WP_082717442.1\|197130_198237_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_059574919.1\|198510_198924_-	hypothetical protein	NA	NA	NA	NA
WP_082717441.1\|199194_199866_-	response regulator transcription factor	NA	NA	NA	NA
WP_059574866.1\|199993_200473_-	chaperone SicP	NA	NA	NA	NA
WP_059574863.1\|200543_202091_-	autophagy evasion T3SS effector BopA	NA	NA	NA	NA
WP_156437409.1\|202083_202707_+	hypothetical protein	NA	NA	NA	NA
WP_059574861.1\|202703_203447_+	type III secretion protein BopE	NA	NA	NA	NA
WP_082717279.1\|204757_205171_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.9e-16	38.5
WP_059584105.1\|205110_205572_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_156437608.1\|205660_206689_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
216515:216646	attR	NA	NA	NA	NA

DBSCAN-SWA_2

280944 : 343209

Leptospira_phage(33.33%)

transposase,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059577754.1\|280944_282240_-\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_059577654.1\|282338_282620_-	BapB protein	NA	NA	NA	NA
WP_157131175.1\|282616_286270_-	hypothetical protein	NA	NA	NA	NA
WP_059577649.1\|287532_288471_-	IpaD/SipD/SspD family type III secretion system needle tip protein	NA	NA	NA	NA
WP_059577751.1\|288539_288833_-	H-NS histone family protein	NA	NA	NA	NA
WP_059577647.1\|288968_290156_-	IpaC/SipC family type III secretion system effector	NA	NA	NA	NA
WP_059577644.1\|290212_292087_-	YopB/SseC family type III secretion system translocon subunit	NA	NA	NA	NA
WP_059577641.1\|292105_292627_-	type III secretion system translocator chaperone SicA	NA	NA	NA	NA
WP_082717320.1\|293981_294740_-	EscT/YscT/HrcT family type III secretion system export apparatus protein	NA	NA	NA	NA
WP_059577637.1\|294763_295018_-	EscS/YscS/HrcS family type III secretion system export apparatus protein	NA	NA	NA	NA
WP_059577634.1\|295051_295732_-	EscR/YscR/HrcR family type III secretion system export apparatus protein	NA	NA	NA	NA
WP_059577631.1\|295721_296684_-	YscQ/HrcQ family type III secretion apparatus protein	NA	NA	NA	NA
WP_063889445.1\|296680_297766_-	hypothetical protein	NA	NA	NA	NA
WP_059577628.1\|297743_298208_-	hypothetical protein	NA	NA	NA	NA
WP_059577624.1\|298204_299515_-	FliI/YscN family ATPase	NA	NA	NA	NA
WP_059577620.1\|299511_299919_-	hypothetical protein	NA	NA	NA	NA
WP_059577617.1\|299929_302008_-	EscV/YscV/HrcV family type III secretion system export apparatus protein	NA	NA	NA	NA
WP_059577615.1\|302052_303177_-	YopN family type III secretion system gatekeeper subunit	NA	NA	NA	NA
WP_059577612.1\|303173_305048_-	EscC/YscC/HrcC family type III secretion system outer membrane ring protein	R9TEZ5	Vibrio_phage	5.4e-13	26.7
WP_059577609.1\|305061_305820_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_059577606.1\|306200_307490_+	PrgH/EprH family type III secretion apparatus protein	NA	NA	NA	NA
WP_059577603.1\|307486_307756_+	EscF/YscF/HrpA family type III secretion system needle major subunit	NA	NA	NA	NA
WP_059577599.1\|307814_308117_+	type III secretion system protein	NA	NA	NA	NA
WP_082717319.1\|308121_308988_+	EscJ/YscJ/HrcJ family type III secretion inner membrane ring protein	NA	NA	NA	NA
WP_059577596.1\|308984_309569_+	type III secretion apparatus protein OrgA/MxiK	NA	NA	NA	NA
WP_059577593.1\|309537_310317_+	type III secretion system protein	NA	NA	NA	NA
WP_059577591.1\|310285_310480_+	hypothetical protein	NA	NA	NA	NA
WP_156437540.1\|310649_310790_-	hypothetical protein	NA	NA	NA	NA
WP_156439882.1\|310790_311926_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	8.8e-11	26.5
WP_082717728.1\|312047_312500_-	lytic transglycosylase domain-containing protein	A0A0K2QQJ4	Ralstonia_phage	5.4e-12	44.0
WP_082717729.1\|312777_313701_-	hypothetical protein	NA	NA	NA	NA
WP_157131176.1\|314085_317241_-	hypothetical protein	NA	NA	NA	NA
WP_045598729.1\|318017_318278_+	hypothetical protein	NA	NA	NA	NA
WP_156432289.1\|318911_319172_+	hypothetical protein	NA	NA	NA	NA
WP_059581540.1\|319348_319801_+	helix-turn-helix domain containing protein	NA	NA	NA	NA
WP_059581537.1\|319836_320088_+	hypothetical protein	NA	NA	NA	NA
WP_059581534.1\|320077_322159_+	recombinase family protein	A0A0H3UZF2	Geobacillus_virus	5.8e-08	20.0
WP_156437455.1\|322654_325213_-	fimbria/pilus outer membrane usher protein	NA	NA	NA	NA
WP_059584129.1\|325337_326039_-	fimbria/pilus periplasmic chaperone	NA	NA	NA	NA
WP_082717273.1\|326146_326692_-	type 1 fimbrial protein	NA	NA	NA	NA
WP_082717272.1\|326743_327298_-	type 1 fimbrial protein	NA	NA	NA	NA
WP_082717271.1\|327718_328864_+	type 1 fimbrial protein	NA	NA	NA	NA
WP_059584133.1\|330071_330611_+	lysozyme	Q8W6S5	Burkholderia_virus	1.3e-60	74.9
WP_156437454.1\|330706_331270_-\|transposase	transposase	S5WIU1	Leptospira_phage	3.1e-09	26.8
WP_059584119.1\|332127_332421_+\|tail	phage tail assembly protein	Q6QIA8	Burkholderia_phage	1.5e-31	78.7
WP_059584115.1\|332593_332836_-	hypothetical protein	A4JWK9	Burkholderia_virus	5.4e-27	76.2
WP_082717573.1\|334143_334347_-	hypothetical protein	NA	NA	NA	NA
WP_082717571.1\|335723_336698_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_082717570.1\|338341_338653_+\|transposase	transposase	NA	NA	NA	NA
WP_059584108.1\|338757_338979_-	hypothetical protein	NA	NA	NA	NA
WP_085701565.1\|339201_339663_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_157131177.1\|340824_341463_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	3.0e-16	38.5
WP_045598729.1\|342271_342532_-	hypothetical protein	NA	NA	NA	NA
WP_059627737.1\|342651_343209_-\|transposase	transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP013418

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013418_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013418_1

48879-48973

Orphan

Consensus_repeat	Method
AGGCCGACTCGGTTGCCCCGGGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013418_1

>merge|NZ_CP013418|1|48879-48973|CRISPRCasFinder
TGGCCGATTCGGCTGCCCCGGGCGGGCGGGGCGCGCAGGCCGACTCGGTTGCCCCGGGCACGCAGGGCGCGCAGGCCGACTCGGTTGCCCTCGGC

>NZ_CP013418|1|1|48879-48973|CRISPRCasFinder
TGGCCGATTCGGCTGCCCCGGGC	GGGCGGGGCGCGCAGGCCGACTCGGTTGCCCCGGGCACGCAGGGCGCGC
AGGCCGACTCGGTTGCCCTCGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013418.1\|WP_082717708.1\|49963_50878_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP013418.1\|WP_059576370.1\|45677_46259_+\|phage-tail-protein-I	unknown	unknown	gnl\|CDD\|370616
NZ_CP013418.1\|WP_038743429.1\|40604_41207_+\|phage-baseplate-assembly-protein-V	unknown	unknown	gnl\|CDD\|226915
NZ_CP013418.1\|WP_059576374.1\|43540_43984_+\|phage-tail-protein	unknown	unknown	gnl\|CDD\|379879
NZ_CP013418.1\|WP_038743426.1\|39193_39400_+\|membrane-protein	unknown	unknown	gnl\|CDD\|283209
NZ_CP013418.1\|WP_059576364.1\|49370_49721_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013418.1\|WP_082717726.1\|59907_60225_+\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380355
NZ_CP013418.1\|WP_059576343.1\|60535_61297_+\|peptidoglycan-DD-metalloendopeptidase-family-protein	unknown	unknown	gnl\|CDD\|227278
NZ_CP013418.1\|WP_059576347.1\|57548_58964_+\|NADP-dependent-phosphogluconate-dehydrogenase	unknown	unknown	gnl\|CDD\|236453
NZ_CP013418.1\|WP_059576350.1\|56534_57170_+\|DUF938-domain-containing-protein	unknown	unknown	gnl\|CDD\|253548
NZ_CP013418.1\|WP_059576353.1\|55574_56504_+\|NAD-dependent-protein-deacetylase	unknown	unknown	gnl\|CDD\|235415
NZ_CP013418.1\|WP_156437460.1\|41924_43544_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013418.1\|WP_059576367.1\|46258_48217_+\|tail-fiber-protein	unknown	unknown	gnl\|CDD\|377845
NZ_CP013418.1\|WP_059576372.1\|44533_45685_+\|baseplate-protein	unknown	unknown	gnl\|CDD\|377414
NZ_CP013418.1\|WP_059576380.1\|39387_40608_+\|Cro/Cl-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|222877
NZ_CP013418.1\|WP_156437461.1\|41657_41846_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013418.1\|WP_063889427.1\|51412_53401_-\|acyltransferase	unknown	unknown	gnl\|CDD\|224748
NZ_CP013418.1\|WP_038743454.1\|59163_59496_+\|DUF4148-domain-containing-protein	unknown	unknown	gnl\|CDD\|379321
NZ_CP013418.1\|WP_059576356.1\|54153_55578_+\|cytosine-permease	unknown	unknown	gnl\|CDD\|271377
NZ_CP013418.1\|WP_038743435.1\|44183_44537_+\|baseplate-protein	unknown	unknown	gnl\|CDD\|226155

Protein	Function_ID	Function_description	E-value
NZ_CP013418.1\|WP_082717708.1\|49963_50878_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	7.25697e-13
NZ_CP013418.1\|WP_059576370.1\|45677_46259_+\|phage-tail-protein-I	gnl\|CDD\|370616	pfam09684, Tail_P2_I, Phage tail protein (Tail_P2_I). These sequences represent the family of phage P2 protein I and related tail proteins from a number of temperate phage of Gram-negative bacteria.	4.83597e-31
NZ_CP013418.1\|WP_038743429.1\|40604_41207_+\|phage-baseplate-assembly-protein-V	gnl\|CDD\|226915	COG4540, gpV, Phage P2 baseplate assembly protein gpV [General function prediction only].	2.9165e-31
NZ_CP013418.1\|WP_059576374.1\|43540_43984_+\|phage-tail-protein	gnl\|CDD\|379879	pfam16778, Phage_tail_APC, Phage tail assembly chaperone protein. Phage_tail_APC is a family of general phage tail assembly chaperone proteins from double-stranded DNA viruses with no RNA stage, many of which are unclassified.	3.50417e-05
NZ_CP013418.1\|WP_038743426.1\|39193_39400_+\|membrane-protein	gnl\|CDD\|283209	pfam05489, Phage_tail_X, Phage Tail Protein X. This domain is found in a family of phage tail proteins. Visual analysis suggests that it is related to pfam01476 (personal obs: C Yeats). The functional annotation of family members further confirms this hypothesis.	1.04433e-09
NZ_CP013418.1\|WP_082717726.1\|59907_60225_+\|cupin-domain-containing-protein	gnl\|CDD\|380355	cd02226, cupin_YdbB-like, Bacillus subtilis YdbB and related proteins, cupin domain. This family includes bacterial proteins homologous to YdbB, a Bacillus subtilis protein of unknown function. It also includes protein Nmb1881 From Neisseria meningitidis, also of unknown function. Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	1.00707e-06
NZ_CP013418.1\|WP_059576343.1\|60535_61297_+\|peptidoglycan-DD-metalloendopeptidase-family-protein	gnl\|CDD\|227278	COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning].	3.63102e-27
NZ_CP013418.1\|WP_059576347.1\|57548_58964_+\|NADP-dependent-phosphogluconate-dehydrogenase	gnl\|CDD\|236453	PRK09287, PRK09287, NADP-dependent phosphogluconate dehydrogenase.	0
NZ_CP013418.1\|WP_059576350.1\|56534_57170_+\|DUF938-domain-containing-protein	gnl\|CDD\|253548	pfam06080, DUF938, Protein of unknown function (DUF938). This family consists of several hypothetical proteins from both prokaryotes and eukaryotes. The function of this family is unknown.	1.29488e-85
NZ_CP013418.1\|WP_059576353.1\|55574_56504_+\|NAD-dependent-protein-deacetylase	gnl\|CDD\|235415	PRK05333, PRK05333, NAD-dependent protein deacetylase.	0
NZ_CP013418.1\|WP_059576367.1\|46258_48217_+\|tail-fiber-protein	gnl\|CDD\|377845	pfam07484, Collar, Phage Tail Collar Domain. This region is occasionally found in conjunction with pfam03335. Most of the family appear to be phage tail proteins; however some appear to be involved in other processes. For instance a member from Rhizobium leguminosarum may be involved in plant-microbe interactions. A related protein MrpB is involved in the pathogenicity of Microcystis aeruginosa. The finding of this family in a structural component of the phage tail fibre baseplate suggests that its function is structural rather than enzymatic. Structural studies show this region consists of a helix and a loop and three beta-strands. This alignment does not catch the third strand as it is separated from the rest of the structure by around 100 residues. This strand is conserved in homologs but the intervening sequence is not. Much of the function of phage T4 appears to reside in this intervening region. In the tertiary structure of the phage baseplate this domain forms part of the 'collar'. The domain may bind SO4, however the residues accredited with this vary between the PDB file and the Swiss-Prot entry. The long unconserved region maybe due to domain swapping in and out of a loop or reflective of rapid evolution.	3.69509e-08
NZ_CP013418.1\|WP_059576372.1\|44533_45685_+\|baseplate-protein	gnl\|CDD\|377414	pfam04865, Baseplate_J, Baseplate J-like protein. The P2 bacteriophage J protein lies at the edge of the baseplate. This family also includes a number of bacterial homologs, which are thought to have been horizontally transferred.	4.30369e-64
NZ_CP013418.1\|WP_059576380.1\|39387_40608_+\|Cro/Cl-family-transcriptional-regulator	gnl\|CDD\|222877	PHA02561, D, tail protein; Provisional.	3.01632e-95
NZ_CP013418.1\|WP_038743454.1\|59163_59496_+\|DUF4148-domain-containing-protein	gnl\|CDD\|379321	pfam13663, DUF4148, Domain of unknown function (DUF4148).	4.85018e-10
NZ_CP013418.1\|WP_063889427.1\|51412_53401_-\|acyltransferase	gnl\|CDD\|224748	COG1835, COG1835, Predicted acyltransferases [Lipid metabolism].	4.46781e-74
NZ_CP013418.1\|WP_059576356.1\|54153_55578_+\|cytosine-permease	gnl\|CDD\|271377	cd11484, SLC-NCS1sbd_CobB-like, nucleobase-cation-symport-1 (NCS1) transporter CobB-like; solute-binding domain. This NCS1 subfamily includes Escherichia coli CodB (cytosine permease), and the Saccharomyces cerevisiae transporters: Fcy21p (Purine-cytosine permease), and vitamin B6 transporter Tpn1. NCS1s are essential components of salvage pathways for nucleobases and related metabolites; their known substrates include allantoin, uracil, thiamine, and nicotinamide riboside. NCS1s belong to a superfamily which also contains the solute carrier 5 family sodium/glucose transporters (SLC5s), and solute carrier 6 family neurotransmitter transporters (SLC6s).	2.21774e-101
NZ_CP013418.1\|WP_038743435.1\|44183_44537_+\|baseplate-protein	gnl\|CDD\|226155	COG3628, COG3628, Phage baseplate assembly protein W [General function prediction only].	5.879e-24

>NZ_CP013418.1|WP_059576367.1|46258_48217_+|tail-fiber-protein
MSKLVETSKWEEDIYQIETSDPVEGGPDGISNRQANQLVNRTRYLKDDIERRDKGRVLKAGDTMEGSLLGKTGPATPHNERNAGFGFANDPDTGMFSPSDGVLQLASQGQPAVVLSGDGGARVGAAGPVVLVTGNAERVRVTKEGRTLIGTSDDNGRDALQVRGNASASNGMIAGGLDRGDGGQLRACGNQYGAFIRNDDVSVYLLSTKKGDPLGSWNDWRPLSWSLESGKVVVDGSGAGAVFGGAANVAGDLMVGQNTAEGHVKLGPVDGYFYTSKDSTGWWSPTIGSYQYMFGDHTFRIDGKAVWHEGTLTPLDLNRGGALKGDLKLDPGARVVLAEGSVAFPSLTFANDGAPDTGLFHMADGHFGVSNNGIQTVHFSPEGTYFDRPAFGSHPDATDRSNRFATTQWVAGEVASAMIGQIVFEMRTSARAGYLKCNGALLKRADYPALWAYAQASGALVAENNWGGASANWGCFTDGDGATTFRIPELRGEFLRCWDDGRGGDVDRKIGTWQDSQNRLHAHGASADGVGDHSHNAWTDNQGWHGHHGWTGSVGEHQHIAPYSEANVQPWGAHSQGQAGSHGGVDNDNPWAYTSPSGGHNHEFNTEGAGTHAHNIGIGGSGAHSHAIHVAADGGSETRPRNLAVLAMIRAY
>NZ_CP013418.1|WP_059576370.1|45677_46259_+|phage-tail-protein-I
MADTLLPPPLARDRRFAALAQLAARHDNIDLSPILVYLIDSVDATALPHLAEQFSVMGEDGWSLAESDDARRALIKGAIELHRYKGTPWAVREVIRRLGFGEVELVENIARVSYDGKRRYNGWMVHGDPGLWAVYRVILRDRAITNDQAALLRATLAAFAPARCELASLEYREVPVRYNGAARYDGQYNHGSS
>NZ_CP013418.1|WP_059576372.1|44533_45685_+|baseplate-protein
MTLSEPNFIDRDPQAITADIIAEYEARTGKTLYPAQVERVLIDIVAYRETLVRVGVQEAAKQNLVAFARAPMIDYLGQLVGVTRLPAQPAKTVVRFSLDAPLASSLLIAAGTRVETSDGGVSFATDADAVLAAGRTSIDVAATCDTAGALGNGWQPGQINSLVDDLGDVDVSVANTQTSANGYEEEETERLRERIQLAPEAFSTAGPRLAYVFHAKSAHQSIVDVSVIGPEMAARDGRLVSVNGVPPGSVRVHPLVDTGLPGDDILALVAQALDDEKKRPLTDFVEVRAPKPVDYAIDARLTLYKDADAGTVLAQARAAANAYRANRSAGLGRDIVPAQLTAALQVRGVYDVDLNGLALRVLAGDEWARCTSVSVVATGVAHG
>NZ_CP013418.1|WP_038743435.1|44183_44537_+|baseplate-protein
MTRLTDITSVHWQPALGRDDVVEGVADIDQAIRVILGTPKGSDPHRPDFGSNLSLYLDMPIDRATPHLVREAVDAIRRWEPRCEVVRVMPAIDAAHETLRVQWRLADGVIRETEVPR
>NZ_CP013418.1|WP_059576374.1|43540_43984_+|phage-tail-protein
MTMTRILAGYDTLGFIRTFCDERSKPDGLTFVEITPEQHAMLLAGAAAGKTMAVTADGHPLLVDPEKPTRKQLADAKRAARDAALAATDWLTSRHRDEQALGDGTTLTPDDYAQLLRYRQALRNLGEASRWPNVDLPTPPACVATAA
>NZ_CP013418.1|WP_156437460.1|41924_43544_+|hypothetical-protein
MNELANALGNDPNFATTMTNALSRKAPLDSPTFTGAPKGPTPAPFDSSTKMATTEFVQRALGNVNFASYTSSQKLTASQAGSCVNFWGGTASTFTLPSTSAMPLGGTFLFNNSSTAPLTITRDGTDTILLNGGNPSVTLASGDSLLLVAVPPTQWIAAGGSAQLPFASAMAGPNWTTPPQFDNSAKLATTAFVQRALGSYSGSAVINAATTLTSGNVGNIIELNGTSSFTTNLPAGASIAAGGKVAFVNQSGVDQTVATQGNDFIWSYATGKSSSIMLHSGDTLELFSRGGEWDICGGTVALRYVYGAATQTVPQFDSSPNIATTAFVQRALGNFQAIMVLDAAATLTPAQAGSAISLNDGASVVLPLYSAVKRGATFLFMNSGSMPKTISRQGGDIFFGPSGGSLSSTVTSFTLLPGDWALISAVYQWEMMAGSPLMTINNGAFEFSHGPTGYERSPTGKIEQWGQGVTDANGDINVVFPKRFPNACFNVAANHVGLGAAMVIVIHGSMTQDGVKLRAFNETGGTYPGWLVYWHATGK
>NZ_CP013418.1|WP_156437461.1|41657_41846_-|hypothetical-protein
MRIGGGGVPAQAGLRLLDLLLQVKRAIAELLGLTVRDAVRPAFDRIGHLDLVDLFFPLGSFD
>NZ_CP013418.1|WP_038743429.1|40604_41207_+|phage-baseplate-assembly-protein-V
MNDTLDAFGATVRFGTVSASKPGFARVRLADLGNLRTMWLPIAYPKTQNDQCCWTYDEGEQVAVLMDGRGEDGVILGAVYSAADKPPVSDPNKFVARFKDGATLEYDRATHVLACRGMAQVVVDAGAEIVLRAGAKVTVIAPETEFSANVTVKGKLTYEGGMTGSGGGGASIAGNVKVDGDIDATGAIMDAGGNSNHHSH
>NZ_CP013418.1|WP_059576380.1|39387_40608_+|Cro/Cl-family-transcriptional-regulator
METLNPLAALLPPGVADVPRPTFVLTYEQKNITTDVAPYVTSVAYTDFLSGQSDEIEVVLEDADGRWRDAWYPGKGDALALRIGYVGAPLLPCGRFEIDELSFDDPPSTVTIRALATGVAAPLRTDRSKPYERTTLAAIAARVAKRNRLTLTGKIREIRIDRITQYEEPDVAFLARLAREYGYAFKIVGRTLVFTELADLRDADAALRFTRGDLKSIRLTDKIKDVYAAAKGGYHNPATKKLIVYGVKDGKIDVAGAAAQSGAAGESGTPASSGRDTSADTLRVTARAGSKATLEARTQAALDRANLQRTTGTFELDGNTRLVAGNAIELTGYGRLSGKYLIETARHRIDRGGGYTTEIEVKRASRDARPDGGAQAGTQPARKPSAKPLIAYGAADPSSNQTKDKQ
>NZ_CP013418.1|WP_038743426.1|39193_39400_+|membrane-protein
MFLTHVTTEGERWDQLAHRYYGDPFAYERIIAANPDVPITPLLPSGLALSIPVIARAELSEDLPPWKR
>NZ_CP013418.1|WP_059576364.1|49370_49721_-|hypothetical-protein
MEIAPLDKPLVTRDMGEVLYVDHADTATLKRKYRRDAAIRHDAIVDIDGVWGENTLSEAIGGPKVDYIVTSHVIGHVPDLVTWLIELDSVLAPAGQVRLAIPDMRFTFGRYPDIRV
>NZ_CP013418.1|WP_082717708.1|49963_50878_-|class-I-SAM-dependent-methyltransferase
MKVERLWAFGWNMLLRYPTCSRTVWSLRMTSDWSIETIRDPLYRTKFVTVPDIVDEWLSETGGVYKKDVLEFGCGEGTMALGMALRKDVQRVVGVEILDVHEQCLPIARREIGLHALPDNLFLRRITPGADLTCFGDFDVVYTWSVFEHVSQDMLMRSLASIKSALKPGGSFFLQISPLFYSPNGSHMGPWIPEPWAHLSMPLDDFHERLLQAPQTPAHVRSEWSVYIPLTADVEAERAALWETYATLNKITAPQLCRLIEEAGFRIVRDYRTKTDLPIPKALSDIYHEDVLTTEQIVLLMQHR
>NZ_CP013418.1|WP_063889427.1|51412_53401_-|acyltransferase
MSNTPPKVSSLIYRPDIDGLRAIAVTSVLLFHAFPGVVSGGFVGVDIFFVISGYLITSILVDEVRGNRFSIATFYARRARRIFPALVAVLATVLVIGWGVLVTDELRELGKHIAAGAGFVSNLVLWSETGYFDRAAEFKPLLHLWSLGVEEQFYILWPLALALTHRSRAALVATVMLIFSASFALNIGLVANHPSAAFFSPFTRFWELMIGSMLTLDADRLQRAPRALRSLASIVGAILCAIAVFGLNGAQSYPGWRALLPTLGAALLIAGGVNGFANQALKRPIMVWIGKISYPLYLWHWPLLSFAAIVAGAQPAAPVRTALLLASVLLAWLTYRLIETPVRHHTNRMIAIATPSCALLVAGSIGAFVFLAAPQAPSQLYSRYGDIATATHGAGHEFISTDCGIAENDLKGAVCAFDKRNTPRFAMIGDSKAEAVIWGFLRESQPDSRWKFFDRSGCVPLTGIVRTSSYADDNPKDCTQFAQLEIQHVAADPNIKLVTIATASRMLFGPDYANAQTLAPDKQGPLHGLDGTIRVLEGAGKRVALLVDNPTLPDPHDCMERSAMRYRIVRALASPNENACTLSYRKHLETTKEYRVLVDQLQKNHPNLLVLDATPILCDIRNDTCPISKDGNYLYSYGDHVSDYASTLIAHAFLPKLVEAVR
>NZ_CP013418.1|WP_059576356.1|54153_55578_+|cytosine-permease
MPNAIDAQRRPLRERRTIDYIPDHERHGKLSSQFTLWLGANLQVTAIVTGALAVVLGGDVFWSLVGLALGQLLGGAVMALHGAQGPQLGLPQMISSRVQFGIYGAVIPLVLVCLMYVGFSASGTVLAGQALAQLVGVDDKVGIFAFIAVVVVLAVFGYRTIHALGRVSSVVGVIAFVYMFARLLAGHDIGALLAIRHFSLASFLLAISLSASWQIAYGPYVADYSRYLPRATSARRTFWAIGLGSVLGAQASMVFGVFAAALAGKQFAGHEVQFIVSLGAGGAAAALLYFAIAFGKLTITTLNAYGSVMSVATIVTGFSGRAQISQRARMAYVLTMVAAVAWLALVGRHAFLKDFSAFILFLLAFFTPWSAINLVDFYWVTKERYDVPALYDPDGRYGRWNVAGVSVYALGVLVQMPFIATEFYTGPLVAKLGGTDISWIIGLVVPGVLYYVTARRQTAHVPERLILPDEPSLS
>NZ_CP013418.1|WP_059576353.1|55574_56504_+|NAD-dependent-protein-deacetylase
MTDSAVSSPPLSPSGAAPPAESHALDALHAFVERHPRLFVLTGAGISTDSGIPGYRDRNGAWMRSQPIQYREFLESDHARRRYWARSMLGWPVVGRAQPNASHHALASLGAAGRIARLVTQNVDGLHQRAGSADVVELHGGIGGVTCLDCGAHHARAAIQHILEADNPALLDAEAEPAADGDAHLEWRALDTFRVPACPACGGLLKPAVVFFGENVPRERVAAAARSLEEADAMLVAGSSLMVYSGYRFCVWADDQRKPIAAINLGHTRADPLLTLKVEASCGQTLAALAARLGLAASGARDARGSPHV
>NZ_CP013418.1|WP_059576350.1|56534_57170_+|DUF938-domain-containing-protein
MPIDSASRQWAPAAERNREPILDVLKRVLPARGTVLEIASGTGQHAVHFAAALPDLVWQPTDTEAAARASIDAWAADAALPNLRAPLALDVCAEPWPLAAADAIVCINMIHIAPWAAACALFDGAARLLPDGGVLYLYGPYRRGGAHTAESNARFDAQLRGRHPAWGVRDLEAVVELGRAAGLALDEIVEMPANNLSVVFRKRTQARDSGS
>NZ_CP013418.1|WP_059576347.1|57548_58964_+|NADP-dependent-phosphogluconate-dehydrogenase
MGKQAIGVVGLAVMGRNLALNIESRGYAVSVYNRSREKTDELIAEFPDRKLVPTHTLAEFVASLETPRRILLMVKAGEATDATIAALKPLLDKGDVLIDGGNTHFTDTIRRNQELAQAGLHFIGTGVSGGEEGALRGPSIMPGGQRDAYDLVEPILKQIAAKAPADGEPCVAYMGPDGAGHYVKMVHNGIEYGDMQLIAESYAVLKQVAGLTNDELGAVYTEWNQGELDSYLIEITAKIFGKKDDETGKHLVDVILDRAAQKGTGKWTSQNALDLGVPLPLITESVFARVLSSLKDQRVAASEVLTGPAPAPLEGDRAAFVESVRRALYLSKVISYAQGFAQLDTASKEYGWNLDLGAIAKIFRAGCIIRARFLQKITDAYAKNAALANLLLDPYFQDIAANYQSALRDVVIAAVKAGVPVPAFASAVAYFDSYRSARLPANLVQAQRDFFGAHTFERTDKPGSFHANWAE
>NZ_CP013418.1|WP_038743454.1|59163_59496_+|DUF4148-domain-containing-protein
MKSLIATVAVAAALAVPAVSFAQQSNGPVTRAQVKAELIQLEQAGYNPAADRVNYPEEIQAAEAKIHGQQNVAAQADTSGYGAQPAAAAEAGAPNKVKRIADGAPVYKGR
>NZ_CP013418.1|WP_082717726.1|59907_60225_+|cupin-domain-containing-protein
MPMKIIRSKSFTAPRAWGAVDIANMRGITTRLHWTDQPYKWHVNDGEEVFVVLDGQVEMRYRDAGGEQVAVLDAGDIFFASTGTEHVACPIGEARILVVETEGSV
>NZ_CP013418.1|WP_059576343.1|60535_61297_+|peptidoglycan-DD-metalloendopeptidase-family-protein
MEVRLRRILFVERPDVGWTVRAMLVAAGAALVGGCTVTPWTDSWQPTHVPQQPAPRASSGVLAGYYRVNSGDTLASIASAFGQRTLDIASWNHLAPTDMLAPGQVLRVAPPPSTTTLAPPPAAAQPEAAAPALAWPAHGTVTAPFGAGKNHGIVITATGGDRTVRAAAPGRVVYAGSGVAAYGPLVILKHENGLITAYGHNEKLLVSEGDAVSAGEPVAEMSTDASGRSTFEFEVRRNGKAVDPLGLLPRNGY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

7272 : 48988

Burkholderia_phage(47.06%)

plate,integrase,transposase,tRNA,tail

attL 3349:3366|attR 35057:35074

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3349:3366	attL	NA	NA	NA	NA
WP_059576426.1\|7272_8313_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	2.9e-93	53.4
WP_038743381.1\|8443_9667_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_004190342.1\|9746_9959_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_038743383.1\|10129_10576_+	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	8.8e-23	49.3
WP_038743385.1\|10670_12551_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	1.3e-67	36.9
WP_059576423.1\|12612_12936_-	hypothetical protein	NA	NA	NA	NA
WP_038743389.1\|12994_15037_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	4.2e-35	32.0
WP_145986859.1\|15418_15751_+	hypothetical protein	NA	NA	NA	NA
WP_038743391.1\|15938_16553_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_059576419.1\|16621_17269_-	2OG-Fe(II) oxygenase	NA	NA	NA	NA
WP_059576416.1\|17330_18638_-	hypothetical protein	NA	NA	NA	NA
WP_038743397.1\|19130_19487_-	DNA-binding protein	Q6QIE8	Burkholderia_phage	3.2e-44	77.7
WP_059576413.1\|19671_20286_-	DUF3164 family protein	Q6QIE4	Burkholderia_phage	3.2e-92	81.8
WP_059576410.1\|20359_20722_-	hypothetical protein	Q6QIE2	Burkholderia_phage	6.4e-24	61.6
WP_063889428.1\|20723_22025_-	AAA family ATPase	Q6QIE1	Burkholderia_phage	1.4e-156	67.7
WP_059576407.1\|22021_23821_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	Q6QIE0	Burkholderia_phage	1.2e-283	80.8
WP_038743842.1\|24963_25275_-	helix-turn-helix domain-containing protein	A4JWN4	Burkholderia_virus	9.1e-35	81.1
WP_156432513.1\|25271_25730_-	hypothetical protein	NA	NA	NA	NA
WP_038743404.1\|25776_26019_-	DNA-binding protein	Q6QID3	Burkholderia_phage	9.5e-32	90.0
WP_038743406.1\|26134_26578_+	helix-turn-helix transcriptional regulator	A4JWR8	Burkholderia_virus	6.0e-24	50.7
WP_059576401.1\|26643_27459_+	hypothetical protein	A4JWN9	Burkholderia_virus	4.1e-26	32.6
WP_059576395.1\|28064_28412_+	hypothetical protein	Q6QIC8	Burkholderia_phage	3.5e-43	79.1
WP_059576497.1\|28414_29023_+	transglycosylase SLT domain-containing protein	Q6QIC7	Burkholderia_phage	3.1e-87	79.6
WP_059576392.1\|29019_29622_+	hypothetical protein	A4JWP5	Burkholderia_virus	2.6e-46	57.6
WP_038743412.1\|29618_29957_+	hypothetical protein	A4JWP6	Burkholderia_virus	1.1e-44	84.5
WP_059576390.1\|29953_30286_+	hypothetical protein	Q6QIC3	Burkholderia_phage	3.3e-51	83.6
WP_038743848.1\|31891_32356_+	hypothetical protein	Q6QIB2	Burkholderia_phage	3.8e-45	62.1
WP_038743417.1\|32352_32595_+	hypothetical protein	Q6QIB1	Burkholderia_phage	4.9e-20	62.5
WP_038743419.1\|32599_34033_+\|tail	tail protein	A4JWK5	Burkholderia_virus	4.7e-243	87.2
WP_059576387.1\|34034_34559_+\|tail	phage major tail tube protein	A4JWK6	Burkholderia_virus	2.0e-87	90.8
WP_038743850.1\|34995_35325_+\|tail	phage tail assembly protein	Q6QIA8	Burkholderia_phage	3.7e-26	70.0
35057:35074	attR	NA	NA	NA	NA
WP_059576494.1\|35731_38290_+\|tail	phage tail tape measure protein	A4JWL0	Burkholderia_virus	1.0e-200	53.1
WP_059576384.1\|38291_39194_+\|tail	phage tail protein	Q6QIA4	Burkholderia_phage	1.8e-70	64.8
WP_038743426.1\|39193_39400_+	membrane protein	A4JWL2	Burkholderia_virus	9.6e-25	75.4
WP_059576380.1\|39387_40608_+	Cro/Cl family transcriptional regulator	A4JWL3	Burkholderia_virus	2.4e-131	67.8
WP_038743429.1\|40604_41207_+\|plate	phage baseplate assembly protein V	Q6QIA1	Burkholderia_phage	1.4e-63	78.5
WP_156437461.1\|41657_41846_-	hypothetical protein	NA	NA	NA	NA
WP_156437460.1\|41924_43544_+	hypothetical protein	A4JWL8	Burkholderia_virus	2.1e-90	50.7
WP_059576374.1\|43540_43984_+\|tail	phage tail protein	NA	NA	NA	NA
WP_038743435.1\|44183_44537_+\|plate	baseplate protein	Q6QIA0	Burkholderia_phage	1.4e-52	82.9
WP_059576372.1\|44533_45685_+\|plate	baseplate protein	A4JWL6	Burkholderia_virus	1.2e-167	79.4
WP_059576370.1\|45677_46259_+\|tail	phage tail protein I	A4JWL7	Burkholderia_virus	2.3e-92	86.5
WP_059576367.1\|46258_48217_+\|tail	tail fiber protein	Q45YG3	Burkholderia_virus	1.2e-140	62.2
WP_082717709.1\|48232_48988_+\|tail	phage tail protein	E5E3Q6	Burkholderia_phage	7.6e-59	59.7

DBSCAN-SWA_2

1570089 : 1634944

Stx2-converting_phage(17.65%)

terminase,tail,integrase,transposase

attL 1623119:1623143|attR 1629140:1629164

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157131168.1\|1570089_1570641_+\|transposase	transposase	A0A0P0ZCV4	Stx2-converting_phage	3.2e-06	27.8
WP_059584214.1\|1570637_1570982_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	2.7e-40	70.4
WP_059584212.1\|1571012_1572566_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	2.7e-151	55.0
WP_045598729.1\|1572860_1573121_+	hypothetical protein	NA	NA	NA	NA
WP_156432330.1\|1573932_1575067_+\|transposase	IS3 family transposase	Q716C2	Shigella_phage	9.4e-21	31.4
WP_082717279.1\|1575250_1575664_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.9e-16	38.5
WP_059584105.1\|1575603_1576065_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_081989327.1\|1581812_1581929_-	phenylacetate-CoA oxygenase	NA	NA	NA	NA
WP_038754968.1\|1582400_1582952_-	phosphohydrolase	A0A2K9L141	Tupanvirus	1.2e-16	30.6
WP_059579922.1\|1582956_1584411_-	phosphonoacetaldehyde dehydrogenase	NA	NA	NA	NA
WP_059579925.1\|1584407_1585679_-	phosphonoacetate hydrolase	NA	NA	NA	NA
WP_038754958.1\|1585709_1586564_-	2-aminoethylphosphonate ABC transport system, membrane component PhnV	NA	NA	NA	NA
WP_038754955.1\|1586553_1587501_-	2-aminoethylphosphonate ABC transporter permease subunit	NA	NA	NA	NA
WP_059579928.1\|1587478_1588576_-	2-aminoethylphosphonate ABC transport system ATP-binding subunit PhnT	G3M9Y6	Bacillus_virus	1.1e-26	33.5
WP_038754949.1\|1588632_1589715_-	2-aminoethylphosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_081990111.1\|1589760_1589946_+	hypothetical protein	NA	NA	NA	NA
WP_038754946.1\|1589953_1591063_+	2-aminoethylphosphonate--pyruvate transaminase	NA	NA	NA	NA
WP_059579933.1\|1591370_1592714_-	MFS transporter	NA	NA	NA	NA
WP_038754941.1\|1592757_1593612_-	shikimate dehydrogenase	NA	NA	NA	NA
WP_038754938.1\|1593608_1594064_-	type II 3-dehydroquinate dehydratase	NA	NA	NA	NA
WP_059579936.1\|1594318_1596313_+	sugar phosphate isomerase/epimerase and 4-hydroxyphenylpyruvate domain-containing protein	NA	NA	NA	NA
WP_038754932.1\|1596912_1598562_-	L-lactate permease	NA	NA	NA	NA
WP_156437424.1\|1598560_1598980_+	hypothetical protein	NA	NA	NA	NA
WP_059579941.1\|1598954_1601129_-	malate synthase G	NA	NA	NA	NA
WP_038750931.1\|1602120_1602390_+	hypothetical protein	NA	NA	NA	NA
WP_059579946.1\|1602987_1603881_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_059579951.1\|1603916_1605218_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_038750928.1\|1605214_1605448_-	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_038750927.1\|1605444_1606578_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_038750926.1\|1606574_1607507_-	4-hydroxyproline epimerase	NA	NA	NA	NA
WP_059579956.1\|1607756_1608677_+	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
WP_038750924.1\|1609206_1610832_+	APC family permease	NA	NA	NA	NA
WP_059579960.1\|1610908_1612501_+	aldehyde dehydrogenase (NADP(+))	NA	NA	NA	NA
WP_059579964.1\|1612493_1613525_+	Ldh family oxidoreductase	NA	NA	NA	NA
WP_038750921.1\|1613839_1615132_+	MFS transporter	NA	NA	NA	NA
WP_059579968.1\|1615696_1617214_+	MFS transporter	A0A0M3UL24	Mycobacterium_phage	4.9e-33	30.2
WP_059579971.1\|1617864_1619313_+	carbohydrate porin	NA	NA	NA	NA
WP_059579974.1\|1619389_1620535_+	hypothetical protein	NA	NA	NA	NA
WP_059580312.1\|1620546_1621839_+	deferrochelatase/peroxidase EfeB	NA	NA	NA	NA
WP_038750916.1\|1622176_1622614_-	DoxX family protein	NA	NA	NA	NA
1623119:1623143	attL	NA	NA	NA	NA
WP_157131162.1\|1623133_1623346_-	hypothetical protein	NA	NA	NA	NA
WP_059579982.1\|1623460_1624645_-\|integrase	site-specific integrase	Q9ZXG4	Shigella_phage	7.1e-11	26.5
WP_059579984.1\|1624641_1624995_-	hypothetical protein	NA	NA	NA	NA
WP_156437422.1\|1624891_1625269_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_059579987.1\|1625556_1626264_+	hypothetical protein	A5X9F5	Aeromonas_virus	3.1e-30	38.3
WP_059579990.1\|1626388_1626838_-	hypothetical protein	D6RRP3	Pseudomonas_phage	4.0e-15	41.3
WP_059608743.1\|1626910_1627231_-	hypothetical protein	NA	NA	NA	NA
WP_059579993.1\|1627244_1627457_-	hypothetical protein	A0A0K2QIZ6	Achromobacter_phage	1.3e-13	57.8
WP_059579996.1\|1627468_1627708_-	hypothetical protein	A0A0A6Z564	Enterobacter_phage	8.3e-20	62.5
WP_059579999.1\|1627819_1628044_-	hypothetical protein	NA	NA	NA	NA
WP_059580003.1\|1628244_1628592_-	hypothetical protein	I6NP76	Burkholderia_phage	1.8e-39	74.5
WP_059580015.1\|1628644_1628845_-	hypothetical protein	NA	NA	NA	NA
WP_156437421.1\|1629634_1629811_+	hypothetical protein	NA	NA	NA	NA
1629140:1629164	attR	NA	NA	NA	NA
WP_059580022.1\|1629901_1631767_-\|terminase	phage terminase large subunit	A0A076YJ70	Mesorhizobium_phage	2.7e-113	43.2
WP_059580025.1\|1631763_1632045_-	hypothetical protein	NA	NA	NA	NA
WP_059580029.1\|1632041_1632374_-	hypothetical protein	B5BTX5	Ralstonia_phage	5.2e-12	41.6
WP_059580033.1\|1632370_1632658_-	hypothetical protein	NA	NA	NA	NA
WP_059580036.1\|1632657_1632867_-	hypothetical protein	NA	NA	NA	NA
WP_059580040.1\|1632901_1634944_-\|tail	tail fiber domain-containing protein	R4JJY3	Burkholderia_phage	4.0e-22	29.4

DBSCAN-SWA_3

1647066 : 1662101

Rhizobium_phage(18.18%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059580070.1\|1647066_1649397_-	hypothetical protein	A0A0P0UWF2	Pectobacterium_phage	6.9e-26	24.4
WP_059580073.1\|1649396_1649975_-	hypothetical protein	A0A218M4G9	Pasteurella_phage	1.9e-09	29.6
WP_059580077.1\|1650034_1651033_-	hypothetical protein	M1HMB6	Pelagibacter_phage	1.1e-28	30.5
WP_059580081.1\|1651158_1651947_-	hypothetical protein	NA	NA	NA	NA
WP_082717415.1\|1651943_1653476_-	hypothetical protein	L7TJ79	Rhizobium_phage	1.5e-50	32.9
WP_156437418.1\|1653472_1653655_-	hypothetical protein	NA	NA	NA	NA
WP_156437417.1\|1654392_1654593_-	hypothetical protein	NA	NA	NA	NA
WP_063889456.1\|1654827_1655382_-	hypothetical protein	A0A2H4J8A1	uncultured_Caudovirales_phage	9.5e-35	40.0
WP_082717414.1\|1655359_1656247_-	hypothetical protein	L7TLU4	Rhizobium_phage	2.7e-31	39.1
WP_059580108.1\|1656150_1656453_-	hypothetical protein	A0A2D1GM12	Salmonella_phage	1.2e-07	42.3
WP_059580111.1\|1656452_1657001_-	hypothetical protein	NA	NA	NA	NA
WP_059580116.1\|1656987_1658847_-	hypothetical protein	F8R4R8	Escherichia_phage	4.7e-70	33.5
WP_059580119.1\|1658846_1659035_-	hypothetical protein	NA	NA	NA	NA
WP_156437416.1\|1659031_1659358_-	hypothetical protein	A0A2D2W4Y4	Ralstonia_phage	4.0e-17	43.0
WP_082717413.1\|1659344_1661009_-	AAA family ATPase	A0A0U1ZI53	Ralstonia_phage	4.1e-105	40.4
WP_059580127.1\|1661008_1661257_-	hypothetical protein	NA	NA	NA	NA
WP_156437415.1\|1661256_1661424_-	hypothetical protein	NA	NA	NA	NA
WP_059580131.1\|1661426_1662101_-	hypothetical protein	A0A0A7HCL4	Escherichia_phage	1.4e-32	36.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP013417

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013417_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013417_1

2600935-2601083

Orphan

Consensus_repeat	Method
TGCGGCGTGCGGCGTGCGGCGTGC	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP013417_1

>merge|NZ_CP013417|1|2600935-2601083|CRISPRCasFinder
TGCGGCATACGGTTTGCGACATGCTCATACGGAATGCGAAATGCGATGTGCGATGTGCGGTCTGCGGTCTGCGGTCTGCGGTCTGCGGTCTGCGGCGTGCGGCGTGCGGCGTGCGGCGTGCGGCGTGCGGCGTGCGGCGTGCGGCGTGC

>NZ_CP013417|1|1|2600935-2601083|CRISPRCasFinder
TGCGGCATACGGTTTGCGACATGC	TCATACGGAATGCGAAA
TGCGATGTGCGATGTGCGGTCTGC	GGTCTGCGGTCTGCGGTC
TGCGGTCTGCGGCGTGCGGCGTGC	GGCGTGCGGCGTGCGGCG
TGCGGCGTGCGGCGTGCGGCGTGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013417.1\|WP_038744793.1\|2605666_2606458_-\|molybdopterin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|239026
NZ_CP013417.1\|WP_059575364.1\|2590837_2591080_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013417.1\|WP_059575354.1\|2593435_2594464_+\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380505
NZ_CP013417.1\|WP_038744795.1\|2604313_2605249_-\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|183067
NZ_CP013417.1\|WP_059575361.1\|2591076_2591409_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013417.1\|WP_038744796.1\|2602931_2604128_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
NZ_CP013417.1\|WP_059575344.1\|2601705_2601897_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013417.1\|WP_059575348.1\|2597723_2598629_+\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|224098
NZ_CP013417.1\|WP_038744838.1\|2601296_2601707_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013417.1\|WP_059575352.1\|2594696_2595758_+\|extracellular-solute-binding-protein	unknown	unknown	gnl\|CDD\|270267
NZ_CP013417.1\|WP_038744790.1\|2609344_2611276_+\|phosphomethylpyrimidine-synthase-ThiC	unknown	unknown	gnl\|CDD\|236451
NZ_CP013417.1\|WP_059575334.1\|2607473_2608313_-\|DUF1223-domain-containing-protein	unknown	unknown	gnl\|CDD\|369071
NZ_CP013417.1\|WP_059575346.1\|2599816_2600641_+\|phosphodiesterase	unknown	unknown	gnl\|CDD\|277347
NZ_CP013417.1\|WP_059575350.1\|2595804_2596629_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223629
NZ_CP013417.1\|WP_059575336.1\|2606473_2607430_-\|b-type-cytochrome	unknown	unknown	gnl\|CDD\|226602
NZ_CP013417.1\|WP_038744799.1\|2598728_2599757_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226361
NZ_CP013417.1\|WP_059575356.1\|2591638_2592676_-\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271177
NZ_CP013417.1\|WP_059575332.1\|2608497_2608785_-\|pentapeptide-MXKDX-repeat-protein	unknown	unknown	gnl\|CDD\|131998
NZ_CP013417.1\|WP_059575359.1\|2591405_2591654_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013417.1\|WP_082717577.1\|2601847_2602642_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227049

Protein	Function_ID	Function_description	E-value
NZ_CP013417.1\|WP_059575332.1\|2608497_2608785_-\|pentapeptide-MXKDX-repeat-protein	gnl\|CDD\|131998	TIGR02953, conserved_hypothetical_protein, pentapeptide MXKDX repeat protein. Members of this protein family are small bacterial proteins, each with an N-terminal signal sequence followed by up to 11 imperfect repeats of a pentapeptide. The pentapeptide repeat usually follows the form Met-Xaa-Lys-Asp-Xaa.	0.000509118
NZ_CP013417.1\|WP_059575354.1\|2593435_2594464_+\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|380505	cd06282, PBP1_LacI-like, ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type 1 periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.	1.35537e-109
NZ_CP013417.1\|WP_038744795.1\|2604313_2605249_-\|EamA-family-transporter	gnl\|CDD\|183067	PRK11272, PRK11272, putative DMT superfamily transporter inner membrane protein; Provisional.	6.56686e-58
NZ_CP013417.1\|WP_038744796.1\|2602931_2604128_+\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.5919e-63
NZ_CP013417.1\|WP_059575334.1\|2607473_2608313_-\|DUF1223-domain-containing-protein	gnl\|CDD\|369071	pfam06764, DUF1223, Protein of unknown function (DUF1223). This family consists of several hypothetical proteins of around 250 residues in length which are found in both plants and bacteria. The function of this family is unknown. Structurally it lies in the Thioredoxin-like superfamily.	1.95339e-67
NZ_CP013417.1\|WP_038744793.1\|2605666_2606458_-\|molybdopterin-dependent-oxidoreductase	gnl\|CDD\|239026	cd02108, bact_SO_family_Moco, bacterial subgroup of the sulfite oxidase (SO) family of molybdopterin binding domains. This domain is found in a variety of oxidoreductases. Common features of all known members of this family, like sulfite oxidase and nitrite reductase, are that they contain one single pterin cofactor and part of the coordination of the metal (Mo) is a cysteine ligand of the protein and that they catalyze the transfer of an oxygen to or from a lone pair of electrons on the substrate. The specific function of this subgroup is unknown.	1.57661e-91
NZ_CP013417.1\|WP_038744790.1\|2609344_2611276_+\|phosphomethylpyrimidine-synthase-ThiC	gnl\|CDD\|236451	PRK09284, PRK09284, thiamine biosynthesis protein ThiC; Provisional.	0
NZ_CP013417.1\|WP_059575352.1\|2594696_2595758_+\|extracellular-solute-binding-protein	gnl\|CDD\|270267	cd13549, PBP2_Fbp_like_3, Substrate binding domain of an uncharacterized ferric iron transporter, a member of the type 2 periplasmic binding fold superfamily. The periplasmic iron binding protein plays an essential role in the iron uptake pathway of Gram-negative pathogenic bacteria from the Pasteurellaceae and Neisseriaceae families and is critical for survival of these pathogens within the host. This periplasmic domain (Fbp) has high affinity for ferric iron and serves as the primary receptor for transport. After binding iron with high affinity, Fbp interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The ferric iron-binding proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	7.08072e-162
NZ_CP013417.1\|WP_082717577.1\|2601847_2602642_-\|hypothetical-protein	gnl\|CDD\|227049	COG4705, COG4705, Uncharacterized membrane-anchored protein conserved in bacteria [Function unknown].	9.69522e-94
NZ_CP013417.1\|WP_059575350.1\|2595804_2596629_+\|ABC-transporter-permease	gnl\|CDD\|223629	COG0555, CysU, ABC-type sulfate transport system, permease component [Posttranslational modification, protein turnover, chaperones].	1.26108e-44
NZ_CP013417.1\|WP_059575336.1\|2606473_2607430_-\|b-type-cytochrome	gnl\|CDD\|226602	COG4117, COG4117, Thiosulfate reductase cytochrome B subunit (membrane anchoring protein) [Energy production and conversion].	2.72747e-54
NZ_CP013417.1\|WP_038744799.1\|2598728_2599757_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226361	COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism].	8.54724e-129
NZ_CP013417.1\|WP_059575356.1\|2591638_2592676_-\|site-specific-integrase	gnl\|CDD\|271177	cd00796, INT_Rci_Hp1_C, Shufflon-specific DNA recombinase Rci and Bacteriophage Hp1_like integrase, C-terminal catalytic domain. Rci protein is a tyrosine recombinase specifically involved in Shufflon type of DNA rearrangement in bacteria. The shufflon of plasmid R64 consists of four invertible DNA segments which are separated and flanked by seven 19-bp repeat sequences. RCI recombinase facilitates the site-specific recombination between any inverted repeats results in an inversion of the DNA segment(s) either independently or in groups. HP1 integrase promotes site-specific recombination of the HP1 genome into that of Haemophilus influenza. Bacteriophage Hp1_like integrases are tyrosine based site specific recombinases. They belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	9.6906e-31
NZ_CP013417.1\|WP_059575346.1\|2599816_2600641_+\|phosphodiesterase	gnl\|CDD\|277347	cd07402, MPP_GpdQ, Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain. GpdQ (glycerophosphodiesterase Q, also known as Rv0805 in Mycobacterium tuberculosis) is a binuclear metallophosphoesterase from Enterobacter aerogenes that catalyzes the hydrolysis of mono-, di-, and triester substrates, including some organophosphate pesticides and products of the degradation of nerve agents. The GpdQ homolog, Rv0805, has 2',3'-cyclic nucleotide phosphodiesterase activity. GpdQ and Rv0805 belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	3.09105e-89
NZ_CP013417.1\|WP_059575348.1\|2597723_2598629_+\|ABC-transporter-permease-subunit	gnl\|CDD\|224098	COG1177, PotC, ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism].	2.30678e-45

>NZ_CP013417.1|WP_059575346.1|2599816_2600641_+|phosphodiesterase
MLLAHISDLHIKRPGMLAYRRVDTAAHLARCVARLNALEPRPDAVLVTGDLTDFGDDDEYAHLKSLLAPLAIPYYLLVGNHDDRAALRRAFPDRAELQSGEFVQYALDLGPLRVIALDSQIPGASGGTLCDARLAWLAGQLDAARERPVIVALHHPPFACGIGHMDAMRLEPAASGRLDALLRRFPNVERVLCGHVHRTMFARFGGTIASAVPAPAHQVTFDLRDDGPSSFSMEPPAFAVHRYAPDAGLASHHVYVDASDGPHPFFETTGVLID
>NZ_CP013417.1|WP_038744799.1|2598728_2599757_+|ABC-transporter-ATP-binding-protein
MKLESVPITLTRCAKTFHGARVLEPLDLAIGAGETLVLLGPSGCGKTTTLRLIAGLDVPDAGGAIAFGADDVTALPIEKRGVGMVFQNYALFPNLSVRGNVGYGLRIRRTDPRALRERVDELLAMMRLTAHADKPIDALSGGQRQRVALARALAVRPRVLLLDEPLTALDAQLRDALRREMNALLRELGVTTVYVTHDQAEAMELGDRIVVMSAGKIEQIGAPRDVYYRPATRAVARFIGTLNRIEGVWRDGALVTTGGKLAAASPANELFFRPEDARLVDPSGATLRGAVAHCAFLGERTRVTVEQAAPDALVIDMPGRVDLARGTAVGVAIAAEGLIALA
>NZ_CP013417.1|WP_059575348.1|2597723_2598629_+|ABC-transporter-permease-subunit
MTPTFKDAAALVRPAAAVTDSDEPPTARRPRRAAFDWLAAAQWAVTLALCAFLIVPVAMSVLAGLTVNYFRGPSSGLTLRWLGEVWTQYHGSVFLSLEVAAATLAITLVAGVPAGYALARSRSRVSRVIEEALVLPVALPGLASALALLSVYGGFAAFRTSVWFIVVGHVVFTLPFMVRAVAAVAARAGLRTLEEGAASLGASFVTRFATIVLPNLRSGIVAGALAVLTLSIGEFNLTWMLHTPDTKTLPVGLADTYASLRLEIGSAYTILFLLMTLPLLVAMQRLGVDPSGARRDARKRR
>NZ_CP013417.1|WP_059575350.1|2595804_2596629_+|ABC-transporter-permease
MSDLTFPSRWRIALVAPALAVFVAFWLLPMVSLVRVSADGAFVDAYAALLSNARYMKSLASTVALSAAVTLATLALSTISGLLLARREFAGKRTLIALLTFPLAFPGVVVGFMVIMLAGRQGLIGMLSQRFIGDRWVFAYSVAGLFVGYLYFSIPRVIVTVIAAASKLDPSLEEAARSLGASPWHVLRDIVLPALAPGLVAAGAICFATAMGAFGTAFTLATDLDVLPMTIYTEFTLNANIATAAGLSILLGIVTWAVLALARNLTGQATAASA
>NZ_CP013417.1|WP_059575352.1|2594696_2595758_+|extracellular-solute-binding-protein
MTVRRSFFPRSPLAAVRRACAAALIPLASLALSLGARAAHAQDTAICYNCPPEWADWASQIAAIKQKTGIRVPFDNKNSGQAIAQLIAEQKSPVADVVYLGVSSAFQAKDKGVTAPYRPAHWNDIPANLKDPQGYWFAIHSGTLGFFVNKDALDGKPVPRSWADLLKPEYKGMVGYLDPSSAFVGYAGAVAVNEALGGGFENFQPALDWFRKLKANQPIVPKQTAYARVLSGEIPILLDYDFDAYRAKYKDHANVEFVIPKEGTIAVPYVMSLVKGAPHDANGKKVLDFVLSDEGQKLWANAYLRPVRAPALTADVAAKFLPASEYARAKSVDFGKLAAGQQAFGKQYLQVMQ
>NZ_CP013417.1|WP_059575354.1|2593435_2594464_+|LacI-family-DNA-binding-transcriptional-regulator
MTPTIKDVAALAGVSIATVSRAINAPHTVNPATLERIRAAIGTLRFRPNPLGRQLRSDRTQLIGVVLPTLSNPVFAECLQGVDEFATRAGFKLIVMSTEYDAARERHAIETLRAQRVEGLMLTVADADAHPLLDELDRDGSLYVLMHNDTPHRPSVAVDNRRAAYDGVRMLIERGHRRVLMLAGSLDASDRARLRVRGYAQALDEHGLEPLPALEIDFNAPTLPHAMLAHLSARATRPTALFCSNDWLAMVVMRGLRDARLAVPDDMSVLGFDGLAVGALLAPPLASVATPNREIGRAAWRRLAERIAGERHAQPWLTLPHTVREGATVAPPRDARMPRRAV
>NZ_CP013417.1|WP_059575356.1|2591638_2592676_-|site-specific-integrase
MATYTKRGGVWRAQVRRKGVSMSETFSSKADAVAWATRIEHEINVGKLTPGTKHTFADALREYEKRVSPTKRTARWEVIRFAAFVKHFPDLAAMPLSDVTADHMGRWRDARLAGDEAAGRGKVGTATVLREINLLSHVFTTARDEWKWISESPLTGMRRPTEPEPRKRRITDEEIALLLARLGYRDDETPTTKSARIGAMLVFAIETAMRAGEIEGMRWDEVDFKKRYVHLPRTKTGVARDVPLSPRALALLKQFEPLRKEFGGSVFGVEAALRSTLFAKAKKAVMLDDLHFHDARREALTRLSKIFSVMELAKISGHQDLRILQAVYYAPHAADLADKLHQAST
>NZ_CP013417.1|WP_059575359.1|2591405_2591654_+|hypothetical-protein
MTELSQLAQEIAARLTPHALWDLAELAAYLHRSEQHTRQWIITQDGFPRPIRIPSGKSAVERARPLWRAKDVIAWAESHVEA
>NZ_CP013417.1|WP_059575361.1|2591076_2591409_+|hypothetical-protein
MTSRRINSEAVAGVLRAGTHTVGQIANELRTSTVVVQHFIDMLFYAGKIRIDRRVQRDTGYELAPVAVPRAALDTPAAGPRLAPNLQSTLAGYDREISRRVDLAMTTRAR
>NZ_CP013417.1|WP_059575364.1|2590837_2591080_+|hypothetical-protein
MKLDELIQRVGVDNVGVQFLAESITGGKQRRGYVEVSFGTDCISMRDIATGEWENVVFVIIIKRQAFELARDASYAGDAS
>NZ_CP013417.1|WP_038744838.1|2601296_2601707_-|hypothetical-protein
MIKRKLIAFAVAPALAAAAFGIGAVSPAGVAPSAAEAATVSKLGDLSPFRAIAVDTAKLVDKGDLAGAKARIKDLETSWDDAEPSLKPRAAADWHAVDKAIDRALAALRADRPQAGACKQALAELLAVIDRTSGAR
>NZ_CP013417.1|WP_059575344.1|2601705_2601897_+|hypothetical-protein
MFNLLVVNVNETDECDAGLGCDIDIDSDSDSDCDCDCDCDCDDNSNNITVRAPAPRADPRAPR
>NZ_CP013417.1|WP_082717577.1|2601847_2602642_-|hypothetical-protein
MNQPARPPAAAGMLNKVPEVTLAFWIVKIMSTTVGETGADYLAVHVGLGAAVTGALMSGLLICALALQWRARAYVPWIYWLTIVLVSVVGTQITDALTDGLGVSLYVSTPLFAAALAATFALWYRSERTLSIHTIVTPRREGFYWAAILLTFALGTAAGDLATEALGLGFRLGIVAFGGAIALVAAAALGGMNRVLAFWLAYILTRPLGASLGDFLSQAQAYGGLGLGTIKTSAVFLAVIVVLVAGLSVTAARADRLGAPARGR
>NZ_CP013417.1|WP_038744796.1|2602931_2604128_+|MFS-transporter
MPSQPRPRADAPDRYSRSLLLLLATIAGVSVANIYYNQPLLDAFRASFPGSASWIGVVPTATQLGYATGMFLLAPLGDRFDRRKLILLQIAGLSAALVIAAAAPTLAVLAAASLAIGILATIAQQAVPFAAEIAPPAARGQAVGTVMSGLLLGILLARTAAGFVAEYFGWRAVFAASVAALAALAAVIVARLPRSSPTSTLPYGKLLASMWQLARELRGLRDASMTGAAIFAAFSAFWPVLTLLLAGEPFHLGPQAAGLFGIVGAAGALAAPYAGRFADKRGPRAIITLAIALMAVAFVIFAMSGRSLVGLVIGVIVLDVGVQAAQISNQSRIYALKPDARSRVNTVYMACYFIGGAIGSSAGVAAWRAMGWIGMCAVGLLFSAVAAIVHYRGRASGQ
>NZ_CP013417.1|WP_038744795.1|2604313_2605249_-|EamA-family-transporter
MTPFDRPLAFLARRPLRLPQSRGGRVALALTFIYFAWGSTYLALHVALESFPPLLLSGLRNLLAGIGLFIFAMRRRPVRPTLVEIRNAALVGTMLVTMSSGLIALGMRTVSSGSAAVMVATVPLFATVIASVAGRRVTGGEWAAVALGMVGIVVLNSGGPSSPGSTLGSITVLAGALFWAGGAHLAARLALPHDLFLSTALQIGLGGAASTCIAWVLGERIEHVAFVPGVAFVYLMLAGTMAAYVAYGYLIRHTSPIIASSCMYVNPVVAVALGALLLGEPVTLATVIATVAILGSVGLSFAFDPARKRMQ
>NZ_CP013417.1|WP_038744793.1|2605666_2606458_-|molybdopterin-dependent-oxidoreductase
MSESDRKKPAGDLARIDRASLLIDVRKELALPSRRLFGKRVLTLGGLAMLTGCTLRDDASVDDFLEKVSRANDRVQAWLFGPTRLAPTYAEADITRPFPFNAFYGIDDVPRVSADDFRLAVSGLVTGKRSWTLPELYALPHAEQITRHICVEGWSAIGRWGGTPFREFLRRAGADTTAKYVGFKCADDYYESIDMPTALHPQTLLTFEYDGKRLPPEYGFPMKLRMPTKLGYKNPKHIMEIFVTNTYPGGYWVDQGYNWFGGS
>NZ_CP013417.1|WP_059575336.1|2606473_2607430_-|b-type-cytochrome
MNAITTKGAKGAKGAWTRAATGARADAGAGESTGASTSAAADAEVRGKVCGKVRAVAGATGDAKADATTGATPGAMTDAAAPAMARGAAGAMPHAMHHAPPRAANPAPTDAQATDAATSASRPRRPIHPLWVRASHWLNAVAAVTLALSGWRIYDASPIYAGFTFPRGATLGGWLGGALQWHFAAMWLLFFNGVFYLTMSAATGRFKRKFLPLSATGVARDLRDALRGRLSHDDLSVYNAVQRAAYVATIADLVLLVLSGLVIWKSVQFPLLRELLGGYDSARVVHFWAMAFLVAFFVVHVAMAALVPRSLVAMLRGH
>NZ_CP013417.1|WP_059575334.1|2607473_2608313_-|DUF1223-domain-containing-protein
MSFSMSNSFSVSMRAVAAGLALAAAGIAQAAAGGACVARSPDGRQALVELYTSEGCSSCPSADDWLARLAPHRAALRVVPLALHVDYWDGLGWTDRFAQHRFTERQHALASRGGGRFVYTPEVAVAGRELRDWRDASAFERRVVATAGEPARVGIALSAARRADALDVELSVTPRAGAPRALDAYLALYENGIESPVRAGENRGATLRHERVVRQWIGPLSFGPLASTAGAVAPLDVRRTLPLPANLRAQDAARYGVAAFVEDHATGDVLQALDLPLCG
>NZ_CP013417.1|WP_059575332.1|2608497_2608785_-|pentapeptide-MXKDX-repeat-protein
MKRNLFAFACVAGLALAAPLAHAQNDAMSKDAMSKDAMSKDAMSKGEMSKGAMSKDEMGMKKQDHMAKGGMKKGHTPKDAMKKPMSSDKMSPMSN
>NZ_CP013417.1|WP_038744790.1|2609344_2611276_+|phosphomethylpyrimidine-synthase-ThiC
MNANPKFLSADARVDAAAVAPLPNSRKIYVTGSQPDIRVPMREITQSDTPTSFGGERNPPIYVYDTSGPYTDPDAKIDIRAGLPALRQRWIDARGDTETLEGLTSEYGRERAADAATAELRFPDLHRHPRRAKAGKNVTQMHYARQGIITPEMEFIAIRENQRRAEYLESLKASGPNGAKLAAMMGRQHAGQAFGAAAFGASALAQITPEFVRDEVARGRAIIPANINHPETEPMIIGRNFLVKINANIGNSAVTSSIGEEVDKMTWAIRWGGDTVMDLSTGKHIHETREWIIRNSPVPIGTVPIYQALEKVNGKAEDLTWEIFRDTLIEQAEQGVDYFTIHAGVRLQYVPLTANRMTGIVSRGGSIMAKWCLAHHKESFLYEHFEEICEIMKAYDVSFSLGDGLRPGSIYDANDEAQLGELKTLGELTQIAWKHDVQVMIEGPGHVPMQLIKENMDLQLDWCKEAPFYTLGPLTTDIAPGYDHITSGIGAAMIGWFGTAMLCYVTPKEHLGLPNKDDVKEGIITYKLAAHAADLAKGHPGAQVRDNALSKARFEFRWEDQFNIGLDPDKAREFHDETLPKDSAKVAHFCSMCGPHFCSMKITQDVREFAAQQGMSENDALKKGMEVKAVEFVKSGSEIYHRQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP013417_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013417_2

3139797-3139884

Orphan

Consensus_repeat	Method
CGCGCGCCGCTCCCATCCGAAGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013417_2

>merge|NZ_CP013417|2|3139797-3139884|CRISPRCasFinder
CGCGCGCCGCTCCCATCCGAAGCCGTCGCTCGGATGCCGAACGGACGCTGCGCTGACTTGTGCGCCGCGCCCGCTCCCATCCGAAGCC

>NZ_CP013417|2|2|3139797-3139884|CRISPRCasFinder
CGCGCGCCGCTCCCATCCGAAGCC	GTCGCTCGGATGCCGAACGGACGCTGCGCTGACTTGTGCG
CCGCGCCCGCTCCCATCCGAAGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013417.1\|WP_038750846.1\|3129475_3130420_-\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224096
NZ_CP013417.1\|WP_038750863.1\|3141639_3142683_+\|GlxA-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|227311
NZ_CP013417.1\|WP_038750855.1\|3135347_3135812_+\|transcriptional-repressor	unknown	unknown	gnl\|CDD\|223806
NZ_CP013417.1\|WP_059581337.1\|3138767_3139616_-\|S-formylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|131868
NZ_CP013417.1\|WP_059575167.1\|3153259_3153895_+\|TetR-family-transcriptional-regulator-BpeR	unknown	unknown	gnl\|CDD\|182632
NZ_CP013417.1\|WP_038750849.1\|3131911_3133336_-\|D-tagatose-bisphosphate-aldolase,-class-II,-non-catalytic-subunit	unknown	unknown	gnl\|CDD\|377955
NZ_CP013417.1\|WP_060821232.1\|3146824_3148372_-\|efflux-transporter-outer-membrane-subunit	unknown	unknown	gnl\|CDD\|182103
NZ_CP013417.1\|WP_038751636.1\|3154124_3154853_-\|carbon-monoxide-dehydrogenase	unknown	unknown	gnl\|CDD\|176853
NZ_CP013417.1\|WP_038751638.1\|3154880_3155240_-\|DUF427-domain-containing-protein	unknown	unknown	gnl\|CDD\|377265
NZ_CP013417.1\|WP_059581511.1\|3137779_3138571_+\|metal-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224033
NZ_CP013417.1\|WP_059575164.1\|3151591_3152842_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|184990
NZ_CP013417.1\|WP_059581344.1\|3130532_3131861_-\|sugar-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270303
NZ_CP013417.1\|WP_059581333.1\|3143101_3144526_-\|carbohydrate-kinase	unknown	unknown	gnl\|CDD\|198374
NZ_CP013417.1\|WP_038750851.1\|3133323_3134280_-\|sugar-kinase	unknown	unknown	gnl\|CDD\|238571
NZ_CP013417.1\|WP_059581341.1\|3135894_3136866_+\|zinc-ABC-transporter-solute-binding-protein	unknown	unknown	gnl\|CDD\|238502
NZ_CP013417.1\|WP_038750853.1\|3134284_3135061_-\|L-iditol-2-dehydrogenase	unknown	unknown	gnl\|CDD\|235925
NZ_CP013417.1\|WP_038750861.1\|3139889_3140996_-\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176260
NZ_CP013417.1\|WP_038750858.1\|3136890_3137787_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213202
NZ_CP013417.1\|WP_081989822.1\|3144869_3146309_+\|purine-permease	unknown	unknown	gnl\|CDD\|274468
NZ_CP013417.1\|WP_038751627.1\|3148375_3151576_-\|efflux-RND-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|273335

Protein	Function_ID	Function_description	E-value
NZ_CP013417.1\|WP_038750846.1\|3129475_3130420_-\|sugar-ABC-transporter-permease	gnl\|CDD\|224096	COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism].	3.80085e-73
NZ_CP013417.1\|WP_038750863.1\|3141639_3142683_+\|GlxA-family-transcriptional-regulator	gnl\|CDD\|227311	COG4977, COG4977, Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription].	2.8916e-83
NZ_CP013417.1\|WP_038750855.1\|3135347_3135812_+\|transcriptional-repressor	gnl\|CDD\|223806	COG0735, Fur, Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism].	1.67676e-31
NZ_CP013417.1\|WP_059581337.1\|3138767_3139616_-\|S-formylglutathione-hydrolase	gnl\|CDD\|131868	TIGR02821, S-formylglutathione_hydrolase, S-formylglutathione hydrolase. This model describes a protein family from bacteria, yeast, and human, with a conserved critical role in formaldehyde detoxification as S-formylglutathione hydrolase (EC 3.1.2.12). Members in eukaryotes such as the human protein are better known as esterase D (EC 3.1.1.1), an enzyme with broad specificity, although S-formylglutathione hydrolase has now been demonstrated as well. [Cellular processes, Detoxification].	2.56482e-172
NZ_CP013417.1\|WP_059575167.1\|3153259_3153895_+\|TetR-family-transcriptional-regulator-BpeR	gnl\|CDD\|182632	PRK10668, PRK10668, DNA-binding transcriptional repressor AcrR; Provisional.	9.48145e-64
NZ_CP013417.1\|WP_038750849.1\|3131911_3133336_-\|D-tagatose-bisphosphate-aldolase,-class-II,-non-catalytic-subunit	gnl\|CDD\|377955	pfam08013, Tagatose_6_P_K, Tagatose 6 phosphate kinase. Proteins in this family are tagatose 6 phosphate kinases.	0
NZ_CP013417.1\|WP_060821232.1\|3146824_3148372_-\|efflux-transporter-outer-membrane-subunit	gnl\|CDD\|182103	PRK09837, PRK09837, Cu(I)/Ag(I) efflux RND transporter outer membrane protein.	1.09082e-111
NZ_CP013417.1\|WP_038751636.1\|3154124_3154853_-\|carbon-monoxide-dehydrogenase	gnl\|CDD\|176853	cd05018, CoxG, Carbon monoxide dehydrogenase subunit G (CoxG). CoxG has been shown, in Oligotropha carboxidovorans, to anchor the carbon monoxide (CO) dehydrogenase to the cytoplasmic membrane. The gene encoding CoxG is part of the Cox cluster (coxBCMSLDEFGHIK) located on a low-copy-number, circular, megaplasmid pHCG3. This cluster includes genes encoding subunits of CO dehydrogenase and several accessory components involved in the utilization of CO. This family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands.	8.02233e-20
NZ_CP013417.1\|WP_038751638.1\|3154880_3155240_-\|DUF427-domain-containing-protein	gnl\|CDD\|377265	pfam04248, NTP_transf_9, Domain of unknown function (DUF427). This domain contains a beta-tent fold.	1.03081e-36
NZ_CP013417.1\|WP_059581511.1\|3137779_3138571_+\|metal-ABC-transporter-permease	gnl\|CDD\|224033	COG1108, ZnuB, ABC-type Mn2+/Zn2+ transport systems, permease components [Inorganic ion transport and metabolism].	3.7183e-44
NZ_CP013417.1\|WP_059575164.1\|3151591_3152842_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|184990	PRK15030, PRK15030, multidrug efflux RND transporter periplasmic adaptor subunit AcrA.	1.02013e-114
NZ_CP013417.1\|WP_059581344.1\|3130532_3131861_-\|sugar-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270303	cd13585, PBP2_TMBP_like, The periplasmic-binding component of ABC transport systems specific for trehalose/maltose and similar oligosaccharides; possess type 2 periplasmic binding fold. This family includes the periplasmic trehalose/maltose-binding component of an ABC transport system and related proteins from archaea and bacteria. Members of this group belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.15512e-81
NZ_CP013417.1\|WP_059581333.1\|3143101_3144526_-\|carbohydrate-kinase	gnl\|CDD\|198374	cd07808, FGGY_D-XK_EcXK-like, Escherichia coli xylulokinase-like D-xylulose kinases; a subgroup of the FGGY family of carbohydrate kinases. This subgroup is predominantly composed of bacterial D-xylulose kinases (XK, also known as xylulokinase; EC 2.7.1.17), which catalyze the rate-limiting step in the ATP-dependent phosphorylation of D-xylulose to produce D-xylulose 5-phosphate (X5P) and ADP. D-xylulose has been used as a source of carbon and energy by a variety of microorganisms. Some uncharacterized sequences are also included in this subgroup. The prototypical member of this CD is Escherichia coli xylulokinase (EcXK), which exists as a dimer. Each monomer consists of two large domains separated by an open cleft that forms an active site. This model includes both the N-terminal domain, which adopts a ribonuclease H-like fold, and the structurally related C-terminal domain. The presence of Mg2+ or Mn2+ is required for catalytic activity. Members of this subgroup belong to the FGGY family of carbohydrate kinases.	3.42421e-140
NZ_CP013417.1\|WP_038750851.1\|3133323_3134280_-\|sugar-kinase	gnl\|CDD\|238571	cd01166, KdgK, 2-keto-3-deoxygluconate kinase (KdgK) phosphorylates 2-keto-3-deoxygluconate (KDG) to form 2-keto-3-deoxy-6-phosphogluconate (KDGP). KDG is the common intermediate product, that allows organisms to channel D-glucuronate and/or D-galacturinate into the glycolysis and therefore use polymers, like pectin and xylan as carbon sources.	4.94347e-73
NZ_CP013417.1\|WP_059581341.1\|3135894_3136866_+\|zinc-ABC-transporter-solute-binding-protein	gnl\|CDD\|238502	cd01020, TroA_b, Metal binding protein TroA_b. These proteins are predicted to function as initial receptors in ABC transport of metal ions. They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains. In addition, these proteins sometimes have a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence).	1.27937e-105
NZ_CP013417.1\|WP_038750853.1\|3134284_3135061_-\|L-iditol-2-dehydrogenase	gnl\|CDD\|235925	PRK07067, PRK07067, L-iditol 2-dehydrogenase.	3.07721e-166
NZ_CP013417.1\|WP_038750861.1\|3139889_3140996_-\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	gnl\|CDD\|176260	cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding.	0
NZ_CP013417.1\|WP_038750858.1\|3136890_3137787_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213202	cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters. This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc. The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor. The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri. Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates.	1.78688e-89
NZ_CP013417.1\|WP_081989822.1\|3144869_3146309_+\|purine-permease	gnl\|CDD\|274468	TIGR03173, pbuX, xanthine permease. All the seed members of this model are observed adjacent to genes for either xanthine phosphoribosyltransferase (for the conversion of xanthine to guanine, GenProp0696) or genes for the conversion of xanthine to urate and its concomitant catabolism (GenProp0640, GenProp0688, GenProp0686 and GenProp0687). A number of sequences scoring higher than trusted to this model are found in different genomic contexts, and the possibility exist that these transport related compounds in addition to or instead of xanthine itself. The outgroup to this family are sequences which are characterized as uracil permeases or are adjacent to established uracil phosphoribosyltransferases.	0
NZ_CP013417.1\|WP_038751627.1\|3148375_3151576_-\|efflux-RND-transporter-permease-subunit	gnl\|CDD\|273335	TIGR00915, Probable_aminoglycoside_efflux_pump, The (Largely Gram-negative Bacterial) Hydrophobe/Amphiphile Efflux-1 (HAE1) Family. Proteins scoring above the trusted cutoff (1000) form a tight clade within the RND (Resistance-Nodulation-Cell Division) superfamily. Proteins scoring greater than the noise cutoff (100) appear to form a larger clade, cleanly separated from more distant homologs that include cadmium/zinc/cobalt resistance transporters. This family is one of several subfamilies within the scope of pfam00873. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Unknown substrate].	0

>NZ_CP013417.1|WP_059581337.1|3138767_3139616_-|S-formylglutathione-hydrolase
MLELVSSHACHGGEQRFYRHESKTIGLPMKFSAYLPPQAAHGRVPALFYLAGLTCTEETFAIKAGAQRFAAQHGIALVAPDTSPRGAGVPGEADAWDFGVGAGFYVNATEAPWAAHWRMDSYVVDELREIATAGLPIDGARLGIFGHSMGGHGALVLALRNPHVYRSVSAFAPIAAPSRCPWGEKALSGYLGADRAAWKQYDASELVARAGAKRFDEGILIDQGLADQFLPTQLNPDVFEAACRAAGQPLTLRRHEGYDHGYYFISTFIADHIAHHARVLGR
>NZ_CP013417.1|WP_059581511.1|3137779_3138571_+|metal-ABC-transporter-permease
MFEYEFMINAFAAAGIVAVLAGVVGYFLVLRGQTFAGHALSHVGFTGATGAALFGLSPIWGMIGFTLAAGISMGALGERLAGRDVAIGVTLSVALGCGLLFLHFYTSYATQVTALLFGNVLGVSHATLVVLAAIGAVSLAALAAIARPLLFASLQPELAEAKGVSLRLVSILFLSICALAVAACTQIVGVLLVFTLLVGPAAAAQNLAARLSTGVWLAAAFALGQAWLGITLAYYTDWPTSFWITALSAAVYGTSLVGRRRHA
>NZ_CP013417.1|WP_038750858.1|3136890_3137787_+|ABC-transporter-ATP-binding-protein
MTHPRHALELDHVTLALGGRTILRDASFAVEPGEFVGVLGPNGAGKTTLMRALLGLVPAQSGSIRVAGEPVARGNPAIGYMPQVRSALAGRRVRGRDFVATAADGHRWGLPHASAAIAADVDRVLELVGATALAKRPLSELSGGERQRLLLAQCLLGAPKLLLLDEPLISLDPNHQRGVVELVRRVQRELGITVLFSAHELNPLLNALDRVLYLGNGVAALGTVDEVITKPVLSRLYGSPIDVMRVNGRIFVMSGDVEVEKHDHGHEDEHDHDHGHGHDHAHGRGHARSHGGRRTHDV
>NZ_CP013417.1|WP_059581341.1|3135894_3136866_+|zinc-ABC-transporter-solute-binding-protein
MTLAATSRAPLRALAPSSRPARSPLTLRSSPLLRAARALAAGAAALAFAGAAFAQNAAVKIVAAENFYGDVAKQIGGAHVAVSSVLSNPDQDPHLFEASPKVARELQRADLVIYNGADYDPWMAKLLAASKNAKRTIVVVAELVGRKAGDNPHLWYDPATMPAAARALAAALGSADPAHKAEYDANLARFVASMKPVDAKVAELRARYKGAPVTATEPVFGYMADAIGLDMRNQRFQLATMNNTEASPADVAAFENDLKKRQVRVLIYNSQAVEPMTKRMLKLAQDARVPSVSVTETQPAGKTFQQWMLAQLDALAAALGQRP
>NZ_CP013417.1|WP_038750855.1|3135347_3135812_+|transcriptional-repressor
MASTHSLAARLSRADAFAAEHGLAWTPLRRQVYEHVLAAGRPIGAYDLLAELEPQRGRVPPTTVYRALEFLVEHGFIHRIESKNAFIACCEISKPHEGQFLICEECGETVEIPGGDLAKQLSASPPAHGFEVHRQVVELTGLCGQCKTKHAPHG
>NZ_CP013417.1|WP_038750853.1|3134284_3135061_-|L-iditol-2-dehydrogenase
MRLQRKVAILTGAASGIGEAVARRYLAEGAHCVLVDLKPADGSLARLVDAHPGRAVAVPADVTRRDDIARIVATAVERFGGVDILFNNAALFDMRPLLDESWDVFDRLFAVNVKGMFFLMQAVAQRMVEQGRGGKIINMSSQAGRRGEALVSHYCATKAAVLSYTQSAALALAKHRINVNGIAPGVVDTPMWEQVDALFARYENRPLGEKKRLVGEAVPLGRMGVPDDLAGAALFLASADADYITAQTLNVDGGNWMS
>NZ_CP013417.1|WP_038750851.1|3133323_3134280_-|sugar-kinase
MAAIVVAGELLAEFVAAKRGQGFDAPGEFAGPFPSGAPAIFADQAARMGASVAYAGCVGRDAFGDAIVARLAGHGVDVARIRRAARPTGIACVAYRADGGRQFVFSIEGSASALLEPADVDASMFAGCRYFHVMGSSLTSENAIAAVKRGVIEAARVGAKISFDPNVRAEMLAFEPMRAALHELLDACHLFLPSEVDLPYFCGPQPAERAIAGLLATHPLLERVVLKRGAAGSAAFDRTGSVAAPAYATAEVDPTGAGDCFGGTFVAGAIAGLPVATALMRANAAGALAVSRIGPMEGNSMPDDIDRFLAERGVRCAA
>NZ_CP013417.1|WP_038750849.1|3131911_3133336_-|D-tagatose-bisphosphate-aldolase,-class-II,-non-catalytic-subunit
MRGVNAIAQRPRASGHVQLLREIFDANRAGRASGIYSVCSAHRLVLEAALEAARADESPLLVEATCNQVNHRGGYTGMTPADFRRDVDSLAREAGFPAQALILGGDHLGPNPWRHLAARDAMREARAMVAAYVAAGFTKIHLDASMACADDAAPLPDATIAERAAQLCAAAEEAAAGAGVSPVYVVGTEVPTPGGEVSAAQTETANDPDDEANPPARHARGGAAADDGAFARIDVTRAASVSATLAAHRDAFARHGLLDAWSRVIAIVAQPGVDFDDRRVLDYDPVRAAELGASVLRAPGLVFEAHSTDYQTEGALAALVRDHFAILKVGPALTFALREALFALTYIEDALFDDASERSQLRDVIDAAMRERPEYWAPYYRGDALAQRLARQFSYSDRIRYYWLQPAVAAALDRLLDNLARRAPPETLVAQWLPDAYAACRRGELAREPVAWVRHRIRDVISRYARACALQQGA
>NZ_CP013417.1|WP_059581344.1|3130532_3131861_-|sugar-ABC-transporter-substrate-binding-protein
MQRKPFIAAAARVAAGAALASSALAAHAATLTIATLNNPDMIELKKLSSAFEKANPDIRLNWVILEENVLRQRATTDITTGSGQFDVMAIGTYEAPQWGKRGWLAPMTNLSADYDLNDVIKTARDSLSYNGQLYALPFYVESSMTFYRKDLFAAKGLKMPEQPTYDQIAEFADKLTDRASGTYGICLRGKAGWGENMAYVSTVVNTFGGRWFDENWNAQLTSPEWKKAINFYVNLLKKNGPPGASSNGFNENLTLTASGKCAMWIDATVAAGMLYNRQQSQVADKIGFAAAPVAVTPKGSHWLWAWALAIPKTSKQQDAAKKFIAWATSKQYVEMAGKDEGWASVPPGTRQSTYQRAEYKAAAPFSDFVLKAIQTADPNDPSLKKVPYTGVQYVGIPEFQSFGTVVGQAIAGAVAGQMSVDQALAAGQAAADRAVRQAGYRK
>NZ_CP013417.1|WP_038750846.1|3129475_3130420_-|sugar-ABC-transporter-permease
MRHLRLPLAHSAPLGDAGPAADERARGKPARWLVTPSVAVLFLWMAIPLAMTIWFSLTRYNLLNPDVKGFAGLDNYRFLATDPSFLPAIWHTLALIGSVLAITVAGGVLMAVLFDRKFYGQGVARLFAIAPFFVMPTVSALIWKNMILHPVYGLVARAMRALGMQPIDWFAQYPLASIVMIVAWQWLPFAFLILFTAIQSLDQEQKEAARIDGAGPIAMFFYITLPHLKRAIAVVVMMETIFLLSIFAEIYTTTGGGPGDATTNLSYLIYALGLQQFDVGLASAGGILAVVLANVVSFFLVRMLARNLKGEYEA
>NZ_CP013417.1|WP_038750861.1|3139889_3140996_-|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase
MKTKAAIAWKAGEPLTIEEVDLDGPRAGEVLIEVKATGICHTDYYTLSGADPEGIFPAILGHEGAGVVVDVGPGVGTVKKGDHVIPLYTPECRECKFCLSRKTNLCQKIRATQGRGLMPDATSRFSIGGKPIFHYMGTSTFSNYIVVPEIAVAKVREDAPFDKICYIGCGVTTGVGAVVYSAKVEAGANVVVFGLGGIGLNVIQGARMVGADKIIGVDINPKRVELAKKFGMTHFVNPNEVENVVDHIVQLTDGGADYSFECIGNVKVMRQALECTHKGWGQSFIIGVAAAGEEISTRPFQLVTGREWKGSAFGGARGRTDVPKIVDWYMEGKLNIDDLITHTLPLEKINDGFDLMKTGESIRSVVLY
>NZ_CP013417.1|WP_038750863.1|3141639_3142683_+|GlxA-family-transcriptional-regulator
MAAEIPLRHRTTTVDVVIYPGFKAIEAVGVINVFDYANARLAAAGLPPVYDLQIAAPAKGAVKSDTLIVLEATKAIDTLAVPDTAIVVGARDIERALRDTSMLVGWCRDVSGRIGRMVGLCSGCFFLAESGMLDGRRATTHWSVAHTLQARYPAVKVEPDAIFVREGNVWTSAGVTAGLDLALAMVEEDLGRDIALAVARDLVIYLKRPGGQSQFSVYLASQMTAHSSIRDVQDWILNSLGERLSVAQLAKRAAMSERNFIRVFVRETGYRPAEFIEIARLEKARRMLEQEELPLKTVAVRSGFHSDDQLRRVFVRRLGVTPGAYRERFSGTGVRDAAASEGADFTD
>NZ_CP013417.1|WP_059581333.1|3143101_3144526_-|carbohydrate-kinase
MRFLGIDLGTGSLKLAIVDGDGRVRASSGAAYAVATPQPGWAEIDVAAWWRALVDAARRLPEHERAQVRAIGLSGQMHGVVLADACGRALRPAMLWPDARATALVARWPASPNPVSPGMAGPLLAWLAAHEPDVLRAARWALQPKDWLRVALGGDVASDPSDACATALAGPDGDWDDALIASLGLPRALFAAPRASDARCGALSADAARALGLPADVALATGAGDTPCAALGSGLARDGDALLTTGTGGQIVVLTAQGAAPRAGLHRYRAAGGARYYTMAAMQNVGIALESARGWLVYPDWRAAYDDAFGAHAAAQISFLPYLTGERSPWMNPAARGGWLGLSLGDSRGALMRAAFEGVAFALRAGLDAIRADGSPVRALRLAGGGSVDPRWRQLLADALDVELHAVEGADAAARGAALLGGVAAEHWRATELVALGPGATCVAKPGHDAALAARHARFVDLYRRTEAWFDTGI
>NZ_CP013417.1|WP_081989822.1|3144869_3146309_+|purine-permease
MLRFVNAHNVEPSSKQDHGVRQMQSNTVHPCDELLPSGKLLTLGLQHVLVMYAGAVAVPLIVGGALKLPKDQIAFLISADLFACGIATLIQTLGVWIFGIRLPVIMGCTFAAVGPMIAIGTNPGLGILDIFGSTIAAGAIGIVLAPMIGKLLRFFPPVVVGTVISVIGLSLMEVGINWAAGGVGNPNYGDPVYLGLSLLVLALILLINKFGRGFVANISVLLGMVAGFAIAFAAGRVNTDGVAAAPWLGFVAPFHFGLPHFDPLAIATMVIVMFVTFIESTGMFLAVGDMVERPVDQDTLVRGLRVDGLGTLIGGIFNSFPHTSFSQNVGLIGVTGVKSRFVCATGGMILVLLGLFPKMAQLVASVPPFVLGGAGIVMFGMVAANGVKVLSKVDFVRNHHNLFIVAVSIGLGLVPVVSPNFFSKLPAALAPILHSGILLASVSAVVLNLVFNGMKGEQDARCDIRRAGRDFDGRPADLH
>NZ_CP013417.1|WP_060821232.1|3146824_3148372_-|efflux-transporter-outer-membrane-subunit
MKRKHALTALAVALLATGCTLAPRYERPAAPVSGAFPTDGVYAAQPGAASGARSANGQSAVDIGWREFFVDPRLQRLVEIALRNNRDLRVSVLNVEASRAQYQITRAGLFPTLDGTGTGSIQRYPAGVSTTRQPLISRAYNVGVSASWELDLFGRVQSLKDQALAQYFATAQARKAAEISLVASVADQYLSLLSTDDLLQVTENTLKTARASYDLTKLQFDNGTGSELDLRQAQTVVETALANQQAQARARAQAVNALVLLIGEPLPDDLPAGLPLNAQNLLTDVPAGLPSDLLTRRPDIMQAEEALRAANANIGAARAAFFPKISLTAAFGTASPTLGGLFKAGTAAWSFAPSIALPIFEGGQNIANLDLAHVQKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRYDLSDLRYKNGVDSYLSVLTAQTDLYTAQQQLISARLARWTNLVDLYRALGGGWIERAGETPRPADAPVDYGRAAVPAAASAVPAASAGATTAG
>NZ_CP013417.1|WP_038751627.1|3148375_3151576_-|efflux-RND-transporter-permease-subunit
MAKFFIDRPIFAWVIAIILMLAGVAAIFTLPIAQYPTIAPPSIQITANYPGASAKTVEDTVTQVIEQQMSGLDNFLYMSSTSDDSGNATITITFAPGTNPDIAQVQVQNKLSLATPILPQVVQQLGLSVTKSSSSFLLVLAFNSEDGSMNKYDLANYVASHVKDPISRINGVGTVTLFGSQYAMRIWLDPTKLTNYGLTPVDVTSAISAQNVQIAGGQLGGTPAVPGTVLQATITEQTLLQTPEQFGNILLKVNQDGSQVRLKDVAQIGLGGETYNFDTKYNGQPTAALGIQLATNANALATAKAVRAKIDEMSSYFPHGLVVKYPYDTTPFVRLSIEEVVKTLLEGIVLVFLVMYLFLQNLRATIIPTIAVPVVLLGTFAIMSMVGFSINVLSMFGLVLAIGLLVDDAIVVVENVERVMAEEGLSPKEATRKAMGQITGALVGVALVLSAVFVPVAFSGGSVGAIYRQFSLTIVSAMVLSVLVALILTPALCATILKPIPQGHHEEKKGFFGWFNRTFNASRDKYHVGVHHVIKRSGRWLIIYLAVIVAVGLLFVRLPKSFLPDEDQGLMFVIVQTPSGSTQETTARTLANISDYLLTQEKDIVESAFTVNGFSFAGRGQNSGLVFVKLKDYSQRQSANQKVQALIGRMFGRYAGYKDALVIPFNPPSIPELGTAAGFDFELTDSAGLGHDALMAARNQLLGMAAKDPTLQGVRPNGLNDTPQYKVNIDREKANALGVTASAIDQTFSIAWASSYVNNFLDTDGRIKKVYVQADAPFRMSPEDLNIWYVRNGSGGMVPFSAFATGHWTYGSPKLERYNGISAMEIQGQAAPGKSTGQAMAAMETLAKKLPTGIGYSWTGLSFQEIQSGSQAPILYAISILVVFLCLAALYESWSIPFSVIMVVPLGVIGALLAATMRGLENDVFFQVGLLTTVGLSAKNAILIVEFARELQQTEKMGPIEAALEASRLRLRPILMTSLAFILGVLPLAISNGAGSASQHAIGTGVIGGMITATFLAIFMIPMFFVKVRAVFSGEKEDADEALRLAHEHMHRDEKPEHGDDAGKKD
>NZ_CP013417.1|WP_059575164.1|3151591_3152842_-|efflux-RND-transporter-periplasmic-adaptor-subunit
MRVERVPYRLITVATAAVFLAACGKKESAPPPQTPEVGVVTVQPQSVPVVSELPGRTSAYLVAQVRARVDGIVLRREFTEGGDVKAGQRLYKIDPAPYVAQLNSAKATLAKAQANLATQNALVARYKVLVAANAVSKQQYDDAVAAQGQAAADVGSGKAAVDTAQINLGYTDVVSPITGRVGISQVTPGAYVQASQATLMSTVQQLDPVYVDLTQSSLDGLKLRQDIQSGRIKTEGPGAAKVTLILEDGKPYSEQGKLQFSDVTVDQTTGSVTIRAIFPNKQRVLLPGMFVRARIEEGVNDNAFLVPQIGVTHDPKGQAIAMIVDEKGKVASRVLTTSGTQGQNWVVEGGLQAGDRVIVQGIDKVRPGMSVKTADAQLQAASGAAQAGASPAQAAAASAAASGAAPSSAAAASSAQ
>NZ_CP013417.1|WP_059575167.1|3153259_3153895_+|TetR-family-transcriptional-regulator-BpeR
MARRTKEEALATRDRILDAAEHVFFEKGVSHTSLADIAQHAGVTRGAIYWHFASKSELFDAMFDRVLLPIDELKADTGAPHADPLGRIREILIWCLLGVARDPQLRRVFSILFMKCEYVADMGPLLQRNREGMRDALRNIEADLAQGVANGQLPADLDTWRATLMLHTLVSGFVRDMLMLPGEIDAERHAEKLVDGCFDMLRTSSAMRKDG
>NZ_CP013417.1|WP_038751636.1|3154124_3154853_-|carbon-monoxide-dehydrogenase
MELNDALCIPLAPSVVWDALQDLALVRASLDHCESFSRLARGEYALALTVPLGPLRARYDVRAHVVSERHDEPEHTRRTLNFRARADGIGALRGQIDVVLAPADDAPDAIRGEPATRIEYAVWATASGPLAELPGRQIQNALHELADDFFTEFCEVVQAKHGLAPNRARDGAPRRQHVFLRPAGFTGIARRAHAQHLGGALTGRAASALHHRESNPVPLWAWAAMIFFVALLLYVARWFNGG
>NZ_CP013417.1|WP_038751638.1|3154880_3155240_-|DUF427-domain-containing-protein
MSDAAGHRIEIEPNRHRVRVIHRGITYADSLAAYTLRESGLPDVQYLPRGDVNMSRLAPSDRVTRCERKGPATYFHLHTEDGVIENAAWSYEEPPEIADAIRHYVAFDAACVDRIDVTS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP013417_1	1.2\|2601000\|18\|NZ_CP013417\|CRISPRCasFinder	2601000-2601017	18	NZ_CP013417.1	2804837-2804854	0	1.0
NZ_CP013417_1	1.2\|2601000\|18\|NZ_CP013417\|CRISPRCasFinder	2601000-2601017	18	NZ_CP013417.1	2804893-2804910	0	1.0
NZ_CP013417_1	1.2\|2601000\|18\|NZ_CP013417\|CRISPRCasFinder	2601000-2601017	18	NZ_CP013417.1	2804900-2804917	0	1.0
NZ_CP013417_1	1.2\|2601000\|18\|NZ_CP013417\|CRISPRCasFinder	2601000-2601017	18	NZ_CP013417.1	2804907-2804924	0	1.0
NZ_CP013417_1	1.2\|2601000\|18\|NZ_CP013417\|CRISPRCasFinder	2601000-2601017	18	NZ_CP013417.1	2804914-2804931	0	1.0
NZ_CP013417_1	1.2\|2601000\|18\|NZ_CP013417\|CRISPRCasFinder	2601000-2601017	18	NZ_CP013417.1	2804921-2804938	0	1.0
NZ_CP013417_1	1.2\|2601000\|18\|NZ_CP013417\|CRISPRCasFinder	2601000-2601017	18	NZ_CP013417.1	2804928-2804945	0	1.0
NZ_CP013417_1	1.2\|2601000\|18\|NZ_CP013417\|CRISPRCasFinder	2601000-2601017	18	NZ_CP013417.1	2804935-2804952	0	1.0
NZ_CP013417_1	1.2\|2601000\|18\|NZ_CP013417\|CRISPRCasFinder	2601000-2601017	18	NZ_CP013417.1	2804830-2804847	1	0.944
NZ_CP013417_1	1.2\|2601000\|18\|NZ_CP013417\|CRISPRCasFinder	2601000-2601017	18	NZ_CP013417.1	2804844-2804861	1	0.944
NZ_CP013417_1	1.2\|2601000\|18\|NZ_CP013417\|CRISPRCasFinder	2601000-2601017	18	NZ_CP013417.1	2804886-2804903	1	0.944
NZ_CP013417_1	1.3\|2601042\|18\|NZ_CP013417\|CRISPRCasFinder	2601042-2601059	18	NZ_CP013418.1	2603311-2603328	0	1.0
NZ_CP013417_1	1.3\|2601042\|18\|NZ_CP013417\|CRISPRCasFinder	2601042-2601059	18	NZ_CP013418.1	2603325-2603342	1	0.944
NZ_CP013417_1	1.3\|2601042\|18\|NZ_CP013417\|CRISPRCasFinder	2601042-2601059	18	NZ_CP013418.1	2657994-2658011	1	0.944
NZ_CP013417_1	1.3\|2601042\|18\|NZ_CP013417\|CRISPRCasFinder	2601042-2601059	18	NZ_CP013417.1	2601070-2601087	0	1.0
NZ_CP013417_1	1.3\|2601042\|18\|NZ_CP013417\|CRISPRCasFinder	2601042-2601059	18	NZ_CP013417.1	2601077-2601094	0	1.0
NZ_CP013417_1	1.3\|2601042\|18\|NZ_CP013417\|CRISPRCasFinder	2601042-2601059	18	NZ_CP013417.1	1188289-1188306	0	1.0
NZ_CP013417_1	1.3\|2601042\|18\|NZ_CP013417\|CRISPRCasFinder	2601042-2601059	18	NZ_CP013417.1	3234267-3234284	0	1.0
NZ_CP013417_1	1.3\|2601042\|18\|NZ_CP013417\|CRISPRCasFinder	2601042-2601059	18	NZ_CP013417.1	4143803-4143820	0	1.0
NZ_CP013417_1	1.3\|2601042\|18\|NZ_CP013417\|CRISPRCasFinder	2601042-2601059	18	NZ_CP013417.1	4143810-4143827	0	1.0
NZ_CP013417_1	1.3\|2601042\|18\|NZ_CP013417\|CRISPRCasFinder	2601042-2601059	18	NZ_CP013417.1	4143817-4143834	0	1.0
NZ_CP013417_1	1.3\|2601042\|18\|NZ_CP013417\|CRISPRCasFinder	2601042-2601059	18	NZ_CP013417.1	4143824-4143841	0	1.0
NZ_CP013417_1	1.3\|2601042\|18\|NZ_CP013417\|CRISPRCasFinder	2601042-2601059	18	NZ_CP013417.1	4143831-4143848	0	1.0
NZ_CP013417_1	1.3\|2601042\|18\|NZ_CP013417\|CRISPRCasFinder	2601042-2601059	18	NZ_CP013417.1	1539147-1539164	1	0.944
NZ_CP013417_1	1.3\|2601042\|18\|NZ_CP013417\|CRISPRCasFinder	2601042-2601059	18	NZ_CP013417.1	3328484-3328501	1	0.944

1. spacer 1.2|2601000|18|NZ_CP013417|CRISPRCasFinder matches to position: 2804837-2804854, mismatch: 0, identity: 1.0

ggtctgcggtctgcggtc	CRISPR spacer
ggtctgcggtctgcggtc	Protospacer
******************

2. spacer 1.2|2601000|18|NZ_CP013417|CRISPRCasFinder matches to position: 2804893-2804910, mismatch: 0, identity: 1.0

ggtctgcggtctgcggtc	CRISPR spacer
ggtctgcggtctgcggtc	Protospacer
******************

3. spacer 1.2|2601000|18|NZ_CP013417|CRISPRCasFinder matches to position: 2804900-2804917, mismatch: 0, identity: 1.0

ggtctgcggtctgcggtc	CRISPR spacer
ggtctgcggtctgcggtc	Protospacer
******************

4. spacer 1.2|2601000|18|NZ_CP013417|CRISPRCasFinder matches to position: 2804907-2804924, mismatch: 0, identity: 1.0

ggtctgcggtctgcggtc	CRISPR spacer
ggtctgcggtctgcggtc	Protospacer
******************

5. spacer 1.2|2601000|18|NZ_CP013417|CRISPRCasFinder matches to position: 2804914-2804931, mismatch: 0, identity: 1.0

ggtctgcggtctgcggtc	CRISPR spacer
ggtctgcggtctgcggtc	Protospacer
******************

6. spacer 1.2|2601000|18|NZ_CP013417|CRISPRCasFinder matches to position: 2804921-2804938, mismatch: 0, identity: 1.0

ggtctgcggtctgcggtc	CRISPR spacer
ggtctgcggtctgcggtc	Protospacer
******************

7. spacer 1.2|2601000|18|NZ_CP013417|CRISPRCasFinder matches to position: 2804928-2804945, mismatch: 0, identity: 1.0

ggtctgcggtctgcggtc	CRISPR spacer
ggtctgcggtctgcggtc	Protospacer
******************

8. spacer 1.2|2601000|18|NZ_CP013417|CRISPRCasFinder matches to position: 2804935-2804952, mismatch: 0, identity: 1.0

ggtctgcggtctgcggtc	CRISPR spacer
ggtctgcggtctgcggtc	Protospacer
******************

9. spacer 1.2|2601000|18|NZ_CP013417|CRISPRCasFinder matches to position: 2804830-2804847, mismatch: 1, identity: 0.944

ggtctgcggtctgcggtc	CRISPR spacer
ggtctacggtctgcggtc	Protospacer
*****.************

10. spacer 1.2|2601000|18|NZ_CP013417|CRISPRCasFinder matches to position: 2804844-2804861, mismatch: 1, identity: 0.944

ggtctgcggtctgcggtc	CRISPR spacer
ggtctgcggtctacggtc	Protospacer
************.*****

11. spacer 1.2|2601000|18|NZ_CP013417|CRISPRCasFinder matches to position: 2804886-2804903, mismatch: 1, identity: 0.944

ggtctgcggtctgcggtc	CRISPR spacer
ggtctacggtctgcggtc	Protospacer
*****.************

12. spacer 1.3|2601042|18|NZ_CP013417|CRISPRCasFinder matches to position: 2603311-2603328, mismatch: 0, identity: 1.0

ggcgtgcggcgtgcggcg	CRISPR spacer
ggcgtgcggcgtgcggcg	Protospacer
******************

13. spacer 1.3|2601042|18|NZ_CP013417|CRISPRCasFinder matches to position: 2603325-2603342, mismatch: 1, identity: 0.944

ggcgtgcggcgtgcggcg	CRISPR spacer
ggcgtgcggcatgcggcg	Protospacer
**********.*******

14. spacer 1.3|2601042|18|NZ_CP013417|CRISPRCasFinder matches to position: 2657994-2658011, mismatch: 1, identity: 0.944

ggcgtgcggcgtgcggcg	CRISPR spacer
ggcgagcggcgtgcggcg	Protospacer
**** *************

15. spacer 1.3|2601042|18|NZ_CP013417|CRISPRCasFinder matches to position: 2601070-2601087, mismatch: 0, identity: 1.0

ggcgtgcggcgtgcggcg	CRISPR spacer
ggcgtgcggcgtgcggcg	Protospacer
******************

16. spacer 1.3|2601042|18|NZ_CP013417|CRISPRCasFinder matches to position: 2601077-2601094, mismatch: 0, identity: 1.0

ggcgtgcggcgtgcggcg	CRISPR spacer
ggcgtgcggcgtgcggcg	Protospacer
******************

17. spacer 1.3|2601042|18|NZ_CP013417|CRISPRCasFinder matches to position: 1188289-1188306, mismatch: 0, identity: 1.0

ggcgtgcggcgtgcggcg	CRISPR spacer
ggcgtgcggcgtgcggcg	Protospacer
******************

18. spacer 1.3|2601042|18|NZ_CP013417|CRISPRCasFinder matches to position: 3234267-3234284, mismatch: 0, identity: 1.0

ggcgtgcggcgtgcggcg	CRISPR spacer
ggcgtgcggcgtgcggcg	Protospacer
******************

19. spacer 1.3|2601042|18|NZ_CP013417|CRISPRCasFinder matches to position: 4143803-4143820, mismatch: 0, identity: 1.0

ggcgtgcggcgtgcggcg	CRISPR spacer
ggcgtgcggcgtgcggcg	Protospacer
******************

20. spacer 1.3|2601042|18|NZ_CP013417|CRISPRCasFinder matches to position: 4143810-4143827, mismatch: 0, identity: 1.0

ggcgtgcggcgtgcggcg	CRISPR spacer
ggcgtgcggcgtgcggcg	Protospacer
******************

21. spacer 1.3|2601042|18|NZ_CP013417|CRISPRCasFinder matches to position: 4143817-4143834, mismatch: 0, identity: 1.0

ggcgtgcggcgtgcggcg	CRISPR spacer
ggcgtgcggcgtgcggcg	Protospacer
******************

22. spacer 1.3|2601042|18|NZ_CP013417|CRISPRCasFinder matches to position: 4143824-4143841, mismatch: 0, identity: 1.0

ggcgtgcggcgtgcggcg	CRISPR spacer
ggcgtgcggcgtgcggcg	Protospacer
******************

23. spacer 1.3|2601042|18|NZ_CP013417|CRISPRCasFinder matches to position: 4143831-4143848, mismatch: 0, identity: 1.0

ggcgtgcggcgtgcggcg	CRISPR spacer
ggcgtgcggcgtgcggcg	Protospacer
******************

24. spacer 1.3|2601042|18|NZ_CP013417|CRISPRCasFinder matches to position: 1539147-1539164, mismatch: 1, identity: 0.944

ggcgtgcggcgtgcggcg	CRISPR spacer
ggcgcgcggcgtgcggcg	Protospacer
****.*************

25. spacer 1.3|2601042|18|NZ_CP013417|CRISPRCasFinder matches to position: 3328484-3328501, mismatch: 1, identity: 0.944

ggcgtgcggcgtgcggcg	CRISPR spacer
ggcgtgcggcttgcggcg	Protospacer
********** *******

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

200990 : 260334

Ralstonia_phage(25.0%)

head,tail,plate,protease,integrase,transposase

attL 219326:219342|attR 254617:254633

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081990112.1\|200990_201530_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	2.2e-20	49.0
WP_082717423.1\|201802_203821_-	acyltransferase	W6MVL2	Pseudomonas_phage	6.3e-52	39.3
WP_059577323.1\|204004_204409_-	hypothetical protein	A0A1S5NV54	Burkholderia_phage	4.1e-11	35.3
WP_082717421.1\|204411_205974_-	hypothetical protein	A0A1S5NTG6	Burkholderia_phage	9.6e-32	38.7
WP_004549651.1\|205976_206549_-	DUF2313 domain-containing protein	NA	NA	NA	NA
WP_059577314.1\|206545_207613_-\|plate	baseplate J/gp47 family protein	A0A0M3LQN4	Mannheimia_phage	1.1e-68	43.3
WP_038730277.1\|207612_207963_-	phage GP46 family protein	A0A2H4JDR8	uncultured_Caudovirales_phage	5.4e-28	57.4
WP_006025666.1\|208028_208631_-\|plate	phage baseplate assembly protein V	A0A0M3LPA3	Mannheimia_phage	1.3e-37	42.4
WP_059579172.1\|208627_209752_-\|tail	phage tail protein	A0A2H4J9E6	uncultured_Caudovirales_phage	1.8e-77	42.3
WP_038748622.1\|209735_211046_-	multidrug DMT transporter permease	A0A2H4JGT4	uncultured_Caudovirales_phage	2.0e-43	30.1
WP_038748621.1\|211047_213300_-\|tail	tail tape measure protein	A0A0M3LPB6	Mannheimia_phage	2.1e-56	30.5
WP_017880452.1\|213430_213829_-	hypothetical protein	NA	NA	NA	NA
WP_059577766.1\|213825_214203_-	hypothetical protein	A0A0M3LRV6	Mannheimia_phage	4.3e-23	42.5
WP_059577769.1\|214232_215654_-\|tail	phage tail protein	B7SDP8	Haemophilus_phage	7.2e-103	48.0
WP_059577772.1\|215657_215885_-	DUF2635 domain-containing protein	A0A0M3LQM9	Mannheimia_phage	1.9e-05	56.5
WP_059580620.1\|215881_216550_-	DUF1834 family protein	B7SDP5	Haemophilus_phage	1.0e-30	43.3
WP_059580625.1\|216554_216968_-	DUF1320 domain-containing protein	C9DGP4	Escherichia_phage	2.3e-09	33.1
WP_059580628.1\|216974_217529_-	hypothetical protein	NA	NA	NA	NA
WP_059580633.1\|217657_218551_-	hypothetical protein	A0A0M4UKB9	Ralstonia_phage	1.4e-107	62.0
WP_038748614.1\|218595_219006_-	hypothetical protein	A0A0M4TU84	Ralstonia_phage	1.5e-29	52.9
WP_038748613.1\|219048_220158_-	hypothetical protein	A0A0M5N0Q6	Ralstonia_phage	2.8e-70	46.1
219326:219342	attL	NA	NA	NA	NA
WP_059608733.1\|220475_221060_-	phage virion morphogenesis protein	B7SDZ4	Pseudomonas_virus	7.2e-09	39.3
WP_059580643.1\|221163_222477_-\|head	phage head morphogenesis protein	Q6QIB9	Burkholderia_phage	1.8e-60	46.9
WP_085701498.1\|222466_224038_-	DUF935 domain-containing protein	A0A0M5MS00	Ralstonia_phage	1.6e-148	53.3
WP_085701499.1\|224067_225855_-	hypothetical protein	A0A0M4U7A1	Ralstonia_phage	1.1e-254	73.8
WP_156437474.1\|225856_226054_-	hypothetical protein	NA	NA	NA	NA
WP_059583899.1\|226063_226561_-	DUF1804 family protein	A0A0M3VI86	Ralstonia_phage	8.2e-54	69.3
WP_017880468.1\|226566_226776_-	hypothetical protein	NA	NA	NA	NA
WP_059583902.1\|226772_227042_-	hypothetical protein	NA	NA	NA	NA
WP_082717426.1\|227065_227299_-	conjugal transfer protein TraR	A0A0M4UVB2	Ralstonia_phage	1.3e-06	46.9
WP_038748603.1\|227299_227920_-	hypothetical protein	Q6QIC6	Burkholderia_phage	2.2e-08	35.4
WP_038748602.1\|227900_228146_-	hypothetical protein	A0A0M4UKB4	Ralstonia_phage	1.8e-09	43.5
WP_017880473.1\|228150_228639_-	lysozyme	A0A0M4R365	Salmonella_phage	8.7e-32	48.8
WP_038748601.1\|228766_229201_-\|transposase	transposase	A0A0A1IWZ1	Pseudomonas_phage	3.4e-19	40.0
WP_059582605.1\|229197_229608_-	regulatory protein GemA	A0A0M5MRZ7	Ralstonia_phage	4.9e-28	46.9
WP_156432295.1\|229674_230133_-	hypothetical protein	NA	NA	NA	NA
WP_059582598.1\|230142_230700_-	hypothetical protein	A0A1S5NV61	Burkholderia_phage	4.5e-08	80.0
WP_017880478.1\|230713_231331_-	DUF3164 family protein	Q5ZR10	Pseudomonas_phage	1.1e-60	53.5
WP_059582595.1\|231364_231670_-	hypothetical protein	NA	NA	NA	NA
WP_038719153.1\|231666_232104_-	hypothetical protein	NA	NA	NA	NA
WP_080109822.1\|232115_232433_-	hypothetical protein	NA	NA	NA	NA
WP_059582590.1\|232487_232742_-	hypothetical protein	NA	NA	NA	NA
WP_059582586.1\|232792_233125_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_038719151.1\|233111_233738_-	hypothetical protein	A0A0M3VI82	Ralstonia_phage	3.7e-19	51.9
WP_017880484.1\|233730_233961_-	hypothetical protein	NA	NA	NA	NA
WP_038730309.1\|233968_234715_-	ATP-binding protein	A0A0U5DWK7	unidentified_phage	2.3e-84	65.5
WP_085701500.1\|234732_236916_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A125RN39	Pseudomonas_phage	1.2e-181	48.5
WP_038748598.1\|236915_237398_-	hypothetical protein	NA	NA	NA	NA
WP_081989580.1\|237459_237780_-	transcriptional regulator	F6MII4	Haemophilus_phage	1.8e-17	59.2
WP_052145086.1\|237939_238707_+	helix-turn-helix transcriptional regulator	A5X9F5	Aeromonas_virus	3.7e-21	35.2
WP_059581661.1\|238960_239965_+	hypothetical protein	NA	NA	NA	NA
WP_063889464.1\|239961_241080_+	hypothetical protein	NA	NA	NA	NA
WP_156437473.1\|241138_241774_+	hypothetical protein	NA	NA	NA	NA
WP_082717525.1\|241820_242219_-\|integrase	tyrosine-type recombinase/integrase	C8CLF4	Xylella_phage	1.3e-33	61.9
WP_059581678.1\|242808_244239_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	6.1e-17	37.7
WP_082717522.1\|244889_245183_-\|tail	phage tail protein	K4NZQ8	Burkholderia_phage	1.6e-33	76.3
WP_156432552.1\|246163_247765_-	hypothetical protein	NA	NA	NA	NA
WP_059581649.1\|247772_249254_-	MBOAT family protein	A0A125RNP0	Pseudomonas_phage	2.5e-74	40.8
WP_038746362.1\|250273_251059_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_038746364.1\|251055_252402_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_038746367.1\|252510_253125_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_059581641.1\|253500_254172_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_038746373.1\|254211_254730_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
254617:254633	attR	NA	NA	NA	NA
WP_038746376.1\|254746_256237_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_038746378.1\|256309_256813_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_081989470.1\|256840_257353_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_082717524.1\|257443_259270_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_059581633.1\|259233_260334_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA

DBSCAN-SWA_2

578148 : 587802

Hokovirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038753329.1\|578148_580098_+	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	1.4e-144	49.6
WP_038753330.1\|580361_581492_+	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	1.7e-22	27.2
WP_059583438.1\|581523_583560_+	bifunctional anthranilate synthase component I family protein/class IV aminotransferase	S4VT78	Pandoravirus	1.9e-51	32.3
WP_038753332.1\|584118_584934_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	7.4e-36	32.9
WP_059583442.1\|584996_585680_-	deoxynucleoside kinase	A0A249XZR7	Enterococcus_phage	3.3e-05	26.0
WP_038753334.1\|585676_586204_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_038753335.1\|586239_587802_-	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	3.3e-24	31.3

DBSCAN-SWA_3

991145 : 999724

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059584551.1\|991145_992549_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	9.4e-79	38.5
WP_059584553.1\|992514_993504_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	2.7e-16	27.7
WP_038745594.1\|993562_994555_+	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	5.9e-27	30.6
WP_038745592.1\|994626_994944_+	competence protein ComE	NA	NA	NA	NA
WP_038745590.1\|995212_996115_+	cysteine synthase CysM	A0A1X9I5K7	Streptococcus_phage	3.9e-54	40.2
WP_082717745.1\|996204_997614_-	lytic murein transglycosylase B	NA	NA	NA	NA
WP_059584558.1\|997663_998587_+	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	5.4e-43	35.9
WP_082717753.1\|998884_999724_-	alpha/beta hydrolase	A7XCB7	Tanapox_virus	5.9e-20	27.6

DBSCAN-SWA_4

1313317 : 1410806

104

uncultured_Caudovirales_phage(19.23%)

head,tail,plate,portal,tRNA,terminase,protease,integrase,transposase,capsid

attL 1307193:1307217|attR 1379612:1379636

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1307193:1307217	attL	NA	NA	NA	NA
WP_038750493.1\|1313317_1314844_-\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	3.1e-83	35.6
WP_156432255.1\|1314935_1316040_-	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	2.2e-06	37.1
WP_059577184.1\|1316616_1318311_-	single-stranded-DNA-specific exonuclease RecJ	A0A0K2FM92	Brevibacillus_phage	9.7e-30	27.5
WP_082717338.1\|1318326_1319403_-	regulator	NA	NA	NA	NA
WP_038750474.1\|1320003_1321257_+	lipoprotein-releasing ABC transporter permease subunit	NA	NA	NA	NA
WP_038750469.1\|1321276_1321999_+	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	5.2e-33	38.2
WP_038750467.1\|1322003_1322792_+	TatD family hydrolase	NA	NA	NA	NA
WP_059577246.1\|1322844_1325376_+	DNA internalization-related competence protein ComEC/Rec2	NA	NA	NA	NA
WP_059577194.1\|1325412_1326243_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_038750462.1\|1326520_1328182_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	5.4e-150	52.0
WP_038750459.1\|1328178_1329033_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	2.0e-47	40.9
WP_006478406.1\|1329137_1330421_+	phosphopyruvate hydratase	W6LP63	Streptococcus_phage	3.8e-151	62.4
WP_059577197.1\|1330515_1330947_+	cell division protein FtsB	NA	NA	NA	NA
WP_059577200.1\|1331142_1331487_-	hypothetical protein	NA	NA	NA	NA
WP_038750451.1\|1331563_1332514_-	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_059577204.1\|1332553_1333078_-	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_082717339.1\|1333221_1334073_+	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_059577210.1\|1334575_1335466_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_156437452.1\|1335678_1336518_+	PHP domain-containing protein	NA	NA	NA	NA
WP_038750439.1\|1336584_1337214_+	threonylcarbamoyl-AMP synthase	NA	NA	NA	NA
WP_038750436.1\|1337312_1337978_+\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_059577212.1\|1337986_1339189_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_038750431.1\|1339185_1339803_+	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_038750428.1\|1339847_1340750_+	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_059577215.1\|1340859_1342005_+	outer membrane protein assembly factor BamC	NA	NA	NA	NA
WP_038750423.1\|1342009_1342786_+	MBL fold metallo-hydrolase	U5PVD0	Bacillus_phage	1.6e-08	27.9
WP_081989776.1\|1342956_1343211_-	hypothetical protein	NA	NA	NA	NA
WP_082717344.1\|1343442_1344606_-	cupin domain-containing protein	NA	NA	NA	NA
WP_059577221.1\|1344698_1345250_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_059577254.1\|1345229_1346516_-	hypothetical protein	NA	NA	NA	NA
WP_156437453.1\|1346502_1349172_-	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	9.3e-27	24.0
WP_059577227.1\|1349343_1350645_+\|integrase	integrase family protein	C7BGE7	Burkholderia_phage	1.7e-146	58.1
WP_082716535.1\|1350595_1350838_-	AlpA family phage regulatory protein	C7BGF0	Burkholderia_phage	4.2e-19	60.5
WP_059577256.1\|1350846_1351320_-	hypothetical protein	B5TA88	Burkholderia_phage	3.9e-05	70.6
WP_059627740.1\|1351328_1351658_-	hypothetical protein	NA	NA	NA	NA
WP_085701508.1\|1351771_1353091_-	pyridoxal phosphate biosynthetic protein PdxJ	NA	NA	NA	NA
WP_085701509.1\|1353090_1353540_-	ACP synthase	NA	NA	NA	NA
WP_059583872.1\|1353536_1354142_-	hypothetical protein	NA	NA	NA	NA
WP_085701510.1\|1354138_1354474_-	hypothetical protein	NA	NA	NA	NA
WP_156437577.1\|1354528_1354747_-	hypothetical protein	NA	NA	NA	NA
WP_059584690.1\|1355281_1355767_-	helix-turn-helix transcriptional regulator	A0A193GYL7	Enterobacter_phage	3.8e-11	40.2
WP_060821736.1\|1355915_1356143_+	hypothetical protein	B5WZX6	Pseudomonas_phage	7.1e-05	49.0
WP_059710783.1\|1356235_1356763_+	hypothetical protein	C7BGG0	Burkholderia_phage	2.6e-29	47.3
WP_059710784.1\|1356838_1358206_+	replicative DNA helicase	C7BGG1	Burkholderia_phage	3.6e-176	69.0
WP_082717480.1\|1358247_1359258_+	helix-turn-helix domain-containing protein	C7BGG2	Burkholderia_phage	4.1e-84	48.8
WP_059584694.1\|1359271_1359679_+	hypothetical protein	C7BGG3	Burkholderia_phage	6.5e-33	52.0
WP_082717481.1\|1360104_1360674_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_082717482.1\|1360636_1362625_+\|terminase	phage terminase large subunit family protein	A0A2D1GMT1	Marinobacter_phage	7.1e-181	53.3
WP_004533700.1\|1362635_1362842_+	hypothetical protein	NA	NA	NA	NA
WP_059584700.1\|1362838_1364332_+\|portal	phage portal protein	A0A2H4JFL5	uncultured_Caudovirales_phage	4.9e-134	51.0
WP_059584703.1\|1364328_1365402_+\|protease	Clp protease ClpP	A0A2H4JDI2	uncultured_Caudovirales_phage	1.9e-47	38.1
WP_059584705.1\|1365428_1365773_+\|head	head decoration protein	NA	NA	NA	NA
WP_082717483.1\|1365806_1366832_+\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	2.8e-109	59.1
WP_059584710.1\|1366835_1367126_+	hypothetical protein	NA	NA	NA	NA
WP_059584713.1\|1367127_1367658_+\|tail	phage tail protein	A0A2H4JBV1	uncultured_Caudovirales_phage	1.6e-10	28.8
WP_059584715.1\|1367647_1368181_+	hypothetical protein	Q9JML9	Wolbachia_phage	1.1e-22	41.1
WP_059584717.1\|1368183_1368864_+\|plate	phage baseplate assembly protein V	Q9JML8	Wolbachia_phage	3.4e-18	34.4
WP_156437578.1\|1368972_1370373_+	hypothetical protein	NA	NA	NA	NA
WP_082717484.1\|1370465_1370663_+	hypothetical protein	NA	NA	NA	NA
WP_038717482.1\|1370659_1371004_+\|plate	phage baseplate protein	A0A2H4JA09	uncultured_Caudovirales_phage	6.1e-24	50.9
WP_059584722.1\|1371000_1371894_+\|plate	baseplate J protein	D5LGZ3	Escherichia_phage	8.4e-49	41.0
WP_059584724.1\|1371886_1372462_+\|tail	phage tail protein I	Q6QI98	Burkholderia_phage	2.7e-32	43.8
WP_059584727.1\|1372449_1374255_+\|tail	tail fiber protein	A4JWS9	Burkholderia_virus	1.4e-151	67.7
WP_059584729.1\|1374268_1374955_+\|tail	phage tail protein	E5E3Q6	Burkholderia_phage	2.0e-58	58.6
WP_059584732.1\|1375018_1376188_+\|tail	phage tail sheath family protein	A0A2H4J869	uncultured_Caudovirales_phage	3.4e-159	72.7
WP_059584735.1\|1376198_1376702_+\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	4.3e-42	50.6
WP_038777205.1\|1376767_1377070_+\|tail	phage tail assembly protein	V5YST8	Pseudomonas_phage	2.5e-05	37.2
WP_059584738.1\|1377157_1379557_+\|tail	phage tail tape measure protein	A0A2H4JG00	uncultured_Caudovirales_phage	3.4e-68	34.0
WP_059584740.1\|1379565_1380447_+\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	1.6e-31	37.5
1379612:1379636	attR	NA	NA	NA	NA
WP_024430935.1\|1380421_1380628_+\|tail	phage tail protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	6.9e-15	59.7
WP_059584742.1\|1380637_1381690_+	late control protein	A0A2H4JBF6	uncultured_Caudovirales_phage	1.3e-77	43.9
WP_059584744.1\|1381765_1381960_+	hypothetical protein	NA	NA	NA	NA
WP_059584747.1\|1381952_1382450_+	lysozyme	A4JX20	Burkholderia_virus	3.8e-67	79.4
WP_059584749.1\|1382449_1382998_+	lysozyme	A4JX21	Burkholderia_virus	1.3e-71	84.4
WP_085701511.1\|1383141_1383930_+	DNA adenine methylase	Q8W6S4	Burkholderia_virus	1.4e-151	96.9
WP_156437472.1\|1383965_1384547_-	LysR family transcriptional regulator	A4PE26	Ralstonia_virus	1.4e-33	45.4
WP_082717547.1\|1384675_1385278_-	hypothetical protein	NA	NA	NA	NA
WP_082758377.1\|1385619_1386129_-	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	6.1e-20	39.9
WP_059584022.1\|1386125_1386551_-	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	3.4e-16	50.6
WP_156437593.1\|1387186_1387921_+	hypothetical protein	NA	NA	NA	NA
WP_157131148.1\|1388008_1388735_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	6.5e-07	34.2
WP_156437553.1\|1389031_1390135_+	hypothetical protein	NA	NA	NA	NA
WP_059574446.1\|1390481_1390742_+	hypothetical protein	NA	NA	NA	NA
WP_059670996.1\|1390751_1392374_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.3e-55	30.5
WP_082717279.1\|1392473_1392887_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.9e-16	38.5
WP_059584105.1\|1392826_1393288_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_156437539.1\|1393398_1394283_-	hypothetical protein	NA	NA	NA	NA
WP_059576509.1\|1394874_1395336_+	excisionase family DNA-binding protein	K4ICM4	Acidithiobacillus_phage	2.5e-49	66.7
WP_059576511.1\|1395340_1395916_+	PIN domain-containing protein	K4HZX4	Acidithiobacillus_phage	8.6e-71	68.8
WP_156432330.1\|1396230_1397365_+\|transposase	IS3 family transposase	Q716C2	Shigella_phage	9.4e-21	31.4
WP_082717298.1\|1397521_1397740_-	DNA mismatch repair protein	NA	NA	NA	NA
WP_156437435.1\|1398434_1398764_-	hypothetical protein	NA	NA	NA	NA
WP_038750414.1\|1399033_1399306_+	hypothetical protein	NA	NA	NA	NA
WP_038750411.1\|1399572_1400376_-	inositol monophosphatase	NA	NA	NA	NA
WP_082717294.1\|1400665_1401592_+	RNA methyltransferase	NA	NA	NA	NA
WP_059574469.1\|1401776_1402559_+	serine O-acetyltransferase	NA	NA	NA	NA
WP_038750403.1\|1402859_1403660_-	UDP-2,3-diacylglucosamine diphosphatase	NA	NA	NA	NA
WP_038750400.1\|1403683_1404175_-	peptidyl-prolyl cis-trans isomerase	A0A2H4UTF4	Bodo_saltans_virus	8.2e-06	29.8
WP_038750397.1\|1404255_1404831_-	peptidylprolyl isomerase	A0A1V0SCU1	Indivirus	1.8e-12	40.0
WP_081989787.1\|1404875_1405541_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_038750392.1\|1405831_1407229_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	4.8e-43	33.1
WP_038750389.1\|1407276_1408218_+	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
WP_038750386.1\|1408321_1409293_+	acetyl-CoA carboxylase carboxyltransferase subunit alpha	NA	NA	NA	NA
WP_059574471.1\|1409336_1410806_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA

DBSCAN-SWA_5

1523861 : 1626264

107

uncultured_Caudovirales_phage(28.57%)

head,tail,plate,portal,tRNA,protease,integrase,transposase,capsid

attL 1511226:1511246|attR 1638690:1638710

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1511226:1511246	attL	NA	NA	NA	NA
WP_082717630.1\|1523861_1524440_+\|tRNA	tRNA adenosine(34) deaminase TadA	S4VYT2	Pandoravirus	6.7e-07	31.8
WP_059574558.1\|1524496_1525438_+	muramoyltetrapeptide carboxypeptidase	NA	NA	NA	NA
WP_038745067.1\|1525774_1526470_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_038745070.1\|1526582_1528118_+	NCS1 family nucleobase:cation symporter-1	NA	NA	NA	NA
WP_038745072.1\|1528128_1529058_+	aspartate/glutamate racemase family protein	NA	NA	NA	NA
WP_038745073.1\|1529203_1530154_+	allantoinase PuuE	NA	NA	NA	NA
WP_081989399.1\|1530150_1530675_+	2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase	NA	NA	NA	NA
WP_038745139.1\|1530916_1531930_+	allantoicase	NA	NA	NA	NA
WP_038745075.1\|1531926_1532439_+	ureidoglycolate lyase	NA	NA	NA	NA
WP_038745077.1\|1533191_1534385_-	urate hydroxylase PuuD	NA	NA	NA	NA
WP_100185261.1\|1534434_1534794_-	hydroxyisourate hydrolase	NA	NA	NA	NA
WP_038745082.1\|1535335_1536748_+	8-oxoguanine deaminase	NA	NA	NA	NA
WP_010104452.1\|1536935_1537865_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_157131149.1\|1537880_1538231_+	hypothetical protein	NA	NA	NA	NA
WP_038745088.1\|1538537_1538747_-	dodecin domain-containing protein	NA	NA	NA	NA
WP_082717632.1\|1538889_1539777_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_038745092.1\|1539916_1540405_-	hypothetical protein	NA	NA	NA	NA
WP_038745095.1\|1540730_1541162_-	large conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
WP_059574564.1\|1541346_1542549_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_038745099.1\|1542662_1543343_-	PspA/IM30 family protein	NA	NA	NA	NA
WP_100185264.1\|1543847_1546385_+	penicillin-binding protein 1A	NA	NA	NA	NA
WP_038744680.1\|1546882_1547338_-	DUF3574 domain-containing protein	NA	NA	NA	NA
WP_038744679.1\|1547863_1548895_-	threonine/serine dehydratase	NA	NA	NA	NA
WP_038744677.1\|1548962_1550180_-	acetylornithine deacetylase	NA	NA	NA	NA
WP_157131150.1\|1550223_1550838_-	hypothetical protein	NA	NA	NA	NA
WP_059574570.1\|1550887_1551844_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_059574590.1\|1552301_1555775_-	transcription-repair coupling factor	NA	NA	NA	NA
WP_038744672.1\|1555891_1556602_+	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	NA	NA	NA	NA
WP_038744671.1\|1556642_1557131_+	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_038744668.1\|1557645_1558173_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_038744667.1\|1558250_1558799_-	peroxiredoxin	NA	NA	NA	NA
WP_038744665.1\|1558997_1560356_-	HAMP domain-containing protein	NA	NA	NA	NA
WP_004199523.1\|1560423_1561149_-	two-component system response regulator OmpR	W8CYM9	Bacillus_phage	8.1e-34	36.7
WP_009904927.1\|1561236_1561419_+	hypothetical protein	NA	NA	NA	NA
WP_081989357.1\|1561370_1561715_+	hypothetical protein	NA	NA	NA	NA
WP_059574591.1\|1561923_1563336_+	DUF1800 domain-containing protein	NA	NA	NA	NA
WP_059574593.1\|1563418_1564666_+	DUF1501 domain-containing protein	NA	NA	NA	NA
WP_038744661.1\|1564682_1565519_-	presqualene diphosphate synthase HpnD	NA	NA	NA	NA
WP_043036221.1\|1565984_1567007_+\|integrase	integrase	A0A1B1P9F9	Acinetobacter_phage	1.3e-66	46.0
WP_043037115.1\|1567003_1567306_-	hypothetical protein	NA	NA	NA	NA
WP_059627740.1\|1567856_1568186_-	hypothetical protein	NA	NA	NA	NA
WP_085701512.1\|1568299_1569619_-	pyridoxal phosphate biosynthetic protein PdxJ	NA	NA	NA	NA
WP_004538495.1\|1569618_1570068_-	hypothetical protein	NA	NA	NA	NA
WP_059608763.1\|1570064_1570670_-	hypothetical protein	NA	NA	NA	NA
WP_004538497.1\|1570666_1571002_-	hypothetical protein	NA	NA	NA	NA
WP_059577261.1\|1571056_1571245_-	hypothetical protein	NA	NA	NA	NA
WP_059581319.1\|1571380_1572586_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_082717526.1\|1572834_1573323_-	hypothetical protein	NA	NA	NA	NA
WP_082717527.1\|1573276_1573777_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_059584220.1\|1573894_1574104_+	hypothetical protein	NA	NA	NA	NA
WP_082742035.1\|1574189_1574717_+	hypothetical protein	C7BGG0	Burkholderia_phage	7.4e-29	47.3
WP_059584693.1\|1574792_1576160_+	replicative DNA helicase	C7BGG1	Burkholderia_phage	8.0e-176	68.8
WP_082717480.1\|1576201_1577212_+	helix-turn-helix domain-containing protein	C7BGG2	Burkholderia_phage	4.1e-84	48.8
WP_059584694.1\|1577225_1577633_+	hypothetical protein	C7BGG3	Burkholderia_phage	6.5e-33	52.0
WP_082717481.1\|1578058_1578628_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_004533700.1\|1580588_1580795_+	hypothetical protein	NA	NA	NA	NA
WP_059584700.1\|1580791_1582285_+\|portal	phage portal protein	A0A2H4JFL5	uncultured_Caudovirales_phage	4.9e-134	51.0
WP_059584703.1\|1582281_1583355_+\|protease	Clp protease ClpP	A0A2H4JDI2	uncultured_Caudovirales_phage	1.9e-47	38.1
WP_059584705.1\|1583381_1583726_+\|head	head decoration protein	NA	NA	NA	NA
WP_082717483.1\|1583759_1584785_+\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	2.8e-109	59.1
WP_059584710.1\|1584788_1585079_+	hypothetical protein	NA	NA	NA	NA
WP_059584713.1\|1585080_1585611_+\|tail	phage tail protein	A0A2H4JBV1	uncultured_Caudovirales_phage	1.6e-10	28.8
WP_059584715.1\|1585600_1586134_+	hypothetical protein	Q9JML9	Wolbachia_phage	1.1e-22	41.1
WP_059584717.1\|1586136_1586817_+\|plate	phage baseplate assembly protein V	Q9JML8	Wolbachia_phage	3.4e-18	34.4
WP_085701513.1\|1586925_1587642_+	hypothetical protein	NA	NA	NA	NA
WP_157131151.1\|1587686_1588325_+	hypothetical protein	NA	NA	NA	NA
WP_082717484.1\|1588417_1588615_+	hypothetical protein	NA	NA	NA	NA
WP_038717482.1\|1588611_1588956_+\|plate	phage baseplate protein	A0A2H4JA09	uncultured_Caudovirales_phage	6.1e-24	50.9
WP_059584722.1\|1588952_1589846_+\|plate	baseplate J protein	D5LGZ3	Escherichia_phage	8.4e-49	41.0
WP_157131152.1\|1589838_1590654_+\|tail	phage tail protein I	Q6QI98	Burkholderia_phage	1.5e-31	43.7
WP_059584729.1\|1592219_1592906_+\|tail	phage tail protein	E5E3Q6	Burkholderia_phage	2.0e-58	58.6
WP_059584732.1\|1592969_1594139_+\|tail	phage tail sheath family protein	A0A2H4J869	uncultured_Caudovirales_phage	3.4e-159	72.7
WP_059584735.1\|1594149_1594653_+\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	4.3e-42	50.6
WP_038777205.1\|1594718_1595021_+\|tail	phage tail assembly protein	V5YST8	Pseudomonas_phage	2.5e-05	37.2
WP_059584738.1\|1595108_1597508_+\|tail	phage tail tape measure protein	A0A2H4JG00	uncultured_Caudovirales_phage	3.4e-68	34.0
WP_059584740.1\|1597516_1598398_+\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	1.6e-31	37.5
WP_024430935.1\|1598372_1598579_+\|tail	phage tail protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	6.9e-15	59.7
WP_059584742.1\|1598588_1599641_+	late control protein	A0A2H4JBF6	uncultured_Caudovirales_phage	1.3e-77	43.9
WP_059584744.1\|1599716_1599911_+	hypothetical protein	NA	NA	NA	NA
WP_059584747.1\|1599903_1600401_+	lysozyme	A4JX20	Burkholderia_virus	3.8e-67	79.4
WP_059608752.1\|1600400_1600946_+	lysozyme	A4JX21	Burkholderia_virus	7.3e-72	83.9
WP_059643804.1\|1601089_1601878_+	DNA adenine methylase	Q8W6S4	Burkholderia_virus	1.1e-150	96.2
WP_059580656.1\|1601913_1602615_-	LysR family transcriptional regulator	A4PE26	Ralstonia_virus	2.1e-34	42.8
WP_082717550.1\|1602617_1603220_-	hypothetical protein	NA	NA	NA	NA
WP_082717551.1\|1603561_1604071_-	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	4.7e-20	38.8
WP_059580669.1\|1604067_1604493_-	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	2.7e-13	43.6
WP_076823392.1\|1604552_1604834_-	hypothetical protein	NA	NA	NA	NA
WP_059580888.1\|1604830_1605298_-	hypothetical protein	C7BGE3	Burkholderia_phage	1.2e-49	62.3
WP_059580673.1\|1605377_1606049_+	DUF159 family protein	Q8W6R8	Burkholderia_virus	2.1e-116	85.6
WP_156437499.1\|1606420_1606993_+	hypothetical protein	NA	NA	NA	NA
WP_156437500.1\|1607223_1608579_+	hypothetical protein	NA	NA	NA	NA
WP_059580676.1\|1609708_1611640_+	AAA family ATPase	NA	NA	NA	NA
WP_152611629.1\|1612092_1612284_-	hypothetical protein	NA	NA	NA	NA
WP_038744660.1\|1612522_1612984_+	MEKHLA domain-containing protein	NA	NA	NA	NA
WP_059580679.1\|1613263_1613887_-	phospholipase D family protein	NA	NA	NA	NA
WP_059580680.1\|1614077_1615187_-	class II histone deacetylase	A0A2K9L2T7	Tupanvirus	2.7e-36	30.6
WP_059580686.1\|1615233_1616421_-	MFS transporter	NA	NA	NA	NA
WP_038744653.1\|1616451_1617507_-	porin	NA	NA	NA	NA
WP_081989356.1\|1617839_1618988_+	response regulator transcription factor	NA	NA	NA	NA
WP_059580690.1\|1619082_1620072_+	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_156437501.1\|1620248_1620419_+	hypothetical protein	NA	NA	NA	NA
WP_038744647.1\|1620538_1620988_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_100185339.1\|1621081_1622245_-	glycerate kinase	NA	NA	NA	NA
WP_156432540.1\|1622523_1622676_+	hypothetical protein	NA	NA	NA	NA
WP_038744644.1\|1622695_1624042_+	trigger factor	NA	NA	NA	NA
WP_038744642.1\|1624178_1624832_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	6.3e-54	57.5
WP_038744641.1\|1624992_1626264_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	5.4e-134	59.0
1638690:1638710	attR	NA	NA	NA	NA

DBSCAN-SWA_6

1728774 : 1740645

uncultured_Mediterranean_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038749136.1\|1728774_1731261_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	1.5e-42	37.0
WP_006026979.1\|1731353_1731680_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_081989624.1\|1731711_1732314_+	recombination protein RecR	NA	NA	NA	NA
WP_038749138.1\|1732381_1733587_+	CoA transferase	NA	NA	NA	NA
WP_038749141.1\|1733692_1734454_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	2.8e-61	52.3
WP_059580904.1\|1734450_1735452_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	7.7e-35	48.9
WP_081989626.1\|1735457_1736336_+	peptidoglycan DD-metalloendopeptidase family protein	A0A0S2SXL7	Bacillus_phage	3.3e-05	34.3
WP_038749147.1\|1736347_1737436_+	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	3.0e-32	35.4
WP_059580814.1\|1737443_1738220_+	3'-5' exonuclease	R9ZX90	Cellulophaga_phage	2.2e-05	31.2
WP_059580817.1\|1738310_1739171_-	endonuclease	NA	NA	NA	NA
WP_038749154.1\|1739247_1740645_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	8.9e-29	25.4

DBSCAN-SWA_7

2230109 : 2303761

Klosneuvirus(18.18%)

tRNA,transposase,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059583093.1\|2230109_2232977_+\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	2.0e-144	38.6
WP_038751293.1\|2233063_2233945_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.9e-69	47.9
WP_038751295.1\|2234016_2234631_-	DUF4136 domain-containing protein	NA	NA	NA	NA
WP_059583089.1\|2234720_2237114_-	CHASE2 domain-containing protein	NA	NA	NA	NA
WP_059583086.1\|2237124_2238495_-	peptidase M23	NA	NA	NA	NA
WP_004193573.1\|2238491_2239196_-	response regulator transcription factor	NA	NA	NA	NA
WP_038751300.1\|2239520_2239907_-	hypothetical protein	NA	NA	NA	NA
WP_004193727.1\|2240238_2240469_-	sulfurtransferase TusA family protein	NA	NA	NA	NA
WP_059583083.1\|2240612_2241650_-	hypothetical protein	NA	NA	NA	NA
WP_038751304.1\|2241662_2242697_-	inositol 2-dehydrogenase	NA	NA	NA	NA
WP_059583195.1\|2242689_2243571_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_059583081.1\|2243812_2244862_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_059583078.1\|2244962_2246108_+	ABC transporter permease	NA	NA	NA	NA
WP_059583075.1\|2246120_2246921_+	sugar ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.3e-13	28.4
WP_059583072.1\|2246934_2248953_+	5-dehydro-2-deoxygluconokinase	NA	NA	NA	NA
WP_059583192.1\|2248949_2250965_+	3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (decyclizing)	NA	NA	NA	NA
WP_052145134.1\|2250961_2251915_+	myo-inosose-2 dehydratase	NA	NA	NA	NA
WP_059583069.1\|2251915_2252719_+	5-deoxy-glucuronate isomerase	NA	NA	NA	NA
WP_059583064.1\|2252942_2253647_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.3e-09	32.3
WP_059583060.1\|2253643_2255860_-	branched-chain amino acid ABC transporter ATP-binding protein/permease	A0A2R8FFL6	Cedratvirus	3.6e-08	26.9
WP_038751321.1\|2255852_2256788_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_059583054.1\|2256792_2257245_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_038751325.1\|2257450_2258599_-	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_038751326.1\|2258814_2259150_+	YbjQ family protein	NA	NA	NA	NA
WP_038751328.1\|2259283_2259820_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_059583051.1\|2259974_2261555_-	PDZ domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	1.5e-08	23.8
WP_059627728.1\|2262201_2263863_-	YbfB/YjiJ family MFS transporter	NA	NA	NA	NA
WP_156437581.1\|2265043_2265394_+	hypothetical protein	NA	NA	NA	NA
WP_038751334.1\|2265365_2267990_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	9.3e-80	39.5
WP_059583034.1\|2269109_2270330_+	CoA transferase	NA	NA	NA	NA
WP_156437582.1\|2270563_2270920_+	hypothetical protein	NA	NA	NA	NA
WP_059583030.1\|2271797_2273507_+\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	4.5e-184	56.4
WP_081989902.1\|2273831_2274299_-	NUDIX hydrolase	A0A2I6PFL2	Proteus_phage	5.0e-21	42.0
WP_038751339.1\|2274326_2274713_-	hypothetical protein	NA	NA	NA	NA
WP_059583189.1\|2274955_2277001_-	glycoside hydrolase family 3 protein	NA	NA	NA	NA
WP_059583026.1\|2277151_2278012_+	M15 family metallopeptidase	NA	NA	NA	NA
WP_059583022.1\|2278054_2279425_-	c-type cytochrome	NA	NA	NA	NA
WP_038751342.1\|2279658_2281242_+	acid phosphatase	NA	NA	NA	NA
WP_038751343.1\|2281643_2282837_+	trans-2-enoyl-CoA reductase family protein	NA	NA	NA	NA
WP_038751344.1\|2282933_2283566_-	response regulator transcription factor	NA	NA	NA	NA
WP_038751345.1\|2283566_2285642_-	response regulator	A0A1V0SGR3	Hokovirus	1.1e-11	26.4
WP_059583019.1\|2286056_2287022_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_082717362.1\|2287037_2289383_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_059583010.1\|2289499_2290339_-	molecular chaperone	NA	NA	NA	NA
WP_059583007.1\|2290356_2290890_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_038751350.1\|2290971_2291532_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_059583186.1\|2291585_2292131_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_038751435.1\|2292958_2293852_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_145986777.1\|2293872_2294208_+	hypothetical protein	NA	NA	NA	NA
WP_038751352.1\|2294272_2295538_+	MFS transporter	NA	NA	NA	NA
WP_059583002.1\|2295582_2296527_+	amidohydrolase family protein	NA	NA	NA	NA
WP_038751354.1\|2297027_2297309_+	H-NS histone family protein	NA	NA	NA	NA
WP_081989910.1\|2297776_2298079_-	hypothetical protein	NA	NA	NA	NA
WP_085701528.1\|2298399_2298540_-\|transposase	transposase	NA	NA	NA	NA
WP_156437563.1\|2298495_2298981_+	hypothetical protein	NA	NA	NA	NA
WP_082717361.1\|2299104_2299824_-	hypothetical protein	NA	NA	NA	NA
WP_082717352.1\|2300543_2301236_-	hypothetical protein	NA	NA	NA	NA
WP_081989914.1\|2302098_2302359_-	hypothetical protein	NA	NA	NA	NA
WP_059582999.1\|2302525_2303761_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	2.3e-36	40.0

DBSCAN-SWA_8

2326949 : 2462708

137

Ralstonia_phage(42.47%)

head,tail,plate,terminase,integrase,transposase

attL 2323472:2323492|attR 2423207:2423227

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2323472:2323492	attL	NA	NA	NA	NA
WP_059582965.1\|2326949_2328800_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_156437564.1\|2328907_2329516_+	hypothetical protein	NA	NA	NA	NA
WP_059583179.1\|2330026_2330317_+	hypothetical protein	NA	NA	NA	NA
WP_052145136.1\|2332608_2333478_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_059582959.1\|2333657_2333873_-	hypothetical protein	NA	NA	NA	NA
WP_060820863.1\|2334244_2334634_-	DUF4150 domain-containing protein	NA	NA	NA	NA
WP_038751380.1\|2334646_2335309_-	DUF3540 domain-containing protein	NA	NA	NA	NA
WP_059582951.1\|2335354_2336437_-	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_059582946.1\|2336433_2338911_-	DUF2169 domain-containing protein	NA	NA	NA	NA
WP_059582943.1\|2338942_2341249_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	2.3e-26	24.5
WP_059582938.1\|2341320_2342373_-	type VI secretion protein ImpA	NA	NA	NA	NA
WP_038751388.1\|2342446_2343511_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_038751390.1\|2343510_2345400_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_100185346.1\|2345430_2345913_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_059582934.1\|2345995_2347075_-	ImpE/SciE family protein	NA	NA	NA	NA
WP_059582930.1\|2347071_2347773_-	TagK domain-containing protein	NA	NA	NA	NA
WP_059582926.1\|2348292_2351034_+	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	6.7e-81	32.0
WP_038751399.1\|2351067_2351622_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_059582918.1\|2353326_2353812_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_059582915.1\|2353901_2354405_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_038751408.1\|2354426_2355773_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_082717349.1\|2355849_2357139_+	type VI secretion system protein TssL	NA	NA	NA	NA
WP_059582907.1\|2357163_2361282_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_059582900.1\|2361770_2367710_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	2.1e-188	37.8
WP_156437565.1\|2368251_2368896_+	hypothetical protein	NA	NA	NA	NA
WP_059582890.1\|2369061_2369460_+	hypothetical protein	Q6JIH0	Burkholderia_virus	4.9e-57	89.3
WP_156437566.1\|2369758_2370469_+	hypothetical protein	NA	NA	NA	NA
WP_059584105.1\|2370850_2371312_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_082717279.1\|2371251_2371665_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.9e-16	38.5
WP_059670996.1\|2371764_2373387_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.3e-55	30.5
WP_059574446.1\|2373396_2373657_-	hypothetical protein	NA	NA	NA	NA
WP_059580591.1\|2373933_2374200_-	hypothetical protein	NA	NA	NA	NA
WP_059580587.1\|2374299_2375067_-	hypothetical protein	NA	NA	NA	NA
WP_059580616.1\|2375440_2376460_+\|integrase	site-specific integrase	W6MYA3	Pseudomonas_phage	6.2e-48	39.0
WP_059580584.1\|2376516_2377536_+\|integrase	site-specific integrase	A0A1L7DQ84	Ralstonia_phage	2.2e-77	48.1
WP_156437469.1\|2377654_2377999_-	hypothetical protein	NA	NA	NA	NA
WP_059580577.1\|2377986_2378442_-	lysozyme	A0A1S6L191	Ralstonia_phage	2.8e-32	52.0
WP_006026405.1\|2378441_2378660_-	hypothetical protein	NA	NA	NA	NA
WP_059580574.1\|2378663_2380460_-\|terminase	phage terminase large subunit	A0A1L7DQE6	Ralstonia_phage	7.3e-278	77.8
WP_059580570.1\|2380449_2380764_-	hypothetical protein	A0A1S6L1A7	Ralstonia_phage	1.0e-09	45.3
WP_043282551.1\|2380760_2380949_-	hypothetical protein	NA	NA	NA	NA
WP_099975900.1\|2380958_2381387_-	hypothetical protein	A0A1S5NV54	Burkholderia_phage	1.2e-13	33.8
WP_059580568.1\|2381362_2382928_-	hypothetical protein	A0A1S6L1B3	Ralstonia_phage	7.6e-37	49.4
WP_059580565.1\|2383007_2387906_-	transglycosylase SLT domain-containing protein	A0A1L7DQA5	Ralstonia_phage	2.3e-241	37.2
WP_082717637.1\|2387973_2390079_-	hypothetical protein	A0A0A1I5M8	Burkholderia_phage	1.7e-79	34.3
WP_059580556.1\|2390268_2391174_-	hypothetical protein	B5BTX1	Ralstonia_phage	4.3e-16	37.7
WP_082717638.1\|2391173_2393327_-\|tail	phage tail protein	A0A0A1I627	Burkholderia_phage	1.9e-211	51.0
WP_080595030.1\|2393734_2394346_-\|tail	phage tail protein	A0A0A1I5V9	Burkholderia_phage	6.3e-48	47.3
WP_006026396.1\|2394403_2395417_-	hypothetical protein	A0A1L7DQF3	Ralstonia_phage	9.0e-132	70.2
WP_059580547.1\|2395553_2396408_-	hypothetical protein	A0A0A1I5M7	Burkholderia_phage	5.2e-48	51.5
WP_059580543.1\|2396414_2397974_-\|tail	phage tail protein	A0A1L7DQD6	Ralstonia_phage	5.7e-178	63.7
WP_009916611.1\|2397973_2398417_-	hypothetical protein	NA	NA	NA	NA
WP_059580540.1\|2398426_2399029_-	hypothetical protein	NA	NA	NA	NA
WP_059580611.1\|2399029_2399461_-	hypothetical protein	NA	NA	NA	NA
WP_059580537.1\|2399468_2399690_-	hypothetical protein	A0A1S6L1E2	Ralstonia_phage	2.1e-09	56.9
WP_059580532.1\|2399718_2402178_-	DNA-directed RNA polymerase	A0A0A8KWP2	Burkholderia_phage	8.3e-264	55.7
WP_059580528.1\|2402177_2403101_-	hypothetical protein	A0A1S6L1C1	Ralstonia_phage	2.1e-66	45.5
WP_059580524.1\|2403114_2403825_-	hypothetical protein	A0A0A1I625	Burkholderia_phage	6.1e-34	42.5
WP_059580521.1\|2403817_2404045_-	hypothetical protein	A0A1S6L1D4	Ralstonia_phage	2.9e-14	54.7
WP_059580516.1\|2404044_2405244_-	hypothetical protein	F1ADQ5	Caulobacter_phage	1.6e-119	56.7
WP_059580512.1\|2405243_2405645_-	hypothetical protein	A0A1L7DQG2	Ralstonia_phage	2.0e-18	51.0
WP_059580509.1\|2405622_2406570_-	hypothetical protein	A0A1L7DQH5	Ralstonia_phage	9.1e-78	50.0
WP_156437468.1\|2406569_2407490_-	hypothetical protein	A0A1L7DQE1	Ralstonia_phage	4.0e-70	55.0
WP_059580606.1\|2407501_2409913_-	DNA polymerase A family protein	A0A1L7DQB7	Ralstonia_phage	1.6e-280	61.9
WP_059580502.1\|2409936_2410173_-	hypothetical protein	NA	NA	NA	NA
WP_059580599.1\|2410174_2411389_-	AAA family ATPase	A0A1S6L1C9	Ralstonia_phage	1.2e-151	65.2
WP_082717634.1\|2411421_2412228_-	hypothetical protein	A0A1L7DQD5	Ralstonia_phage	3.2e-63	47.0
WP_059580498.1\|2412227_2412473_-	hypothetical protein	NA	NA	NA	NA
WP_059608760.1\|2412469_2412922_-	hypothetical protein	NA	NA	NA	NA
WP_059580491.1\|2412921_2413203_-	hypothetical protein	NA	NA	NA	NA
WP_059580487.1\|2413282_2413492_-	hypothetical protein	NA	NA	NA	NA
WP_059580484.1\|2413488_2413707_-	hypothetical protein	NA	NA	NA	NA
WP_059580481.1\|2413703_2413937_-	hypothetical protein	NA	NA	NA	NA
WP_059580473.1\|2414061_2414388_-	hypothetical protein	U3TJY1	Ralstonia_phage	5.8e-08	46.9
WP_059580470.1\|2414384_2414594_-	hypothetical protein	NA	NA	NA	NA
WP_059580469.1\|2414590_2414776_-	hypothetical protein	NA	NA	NA	NA
WP_059580466.1\|2414772_2415120_-	hypothetical protein	A0A0A1I5U1	Burkholderia_phage	2.4e-15	45.9
WP_059580595.1\|2415193_2415670_-	hypothetical protein	A0A1L7DQL1	Ralstonia_phage	2.2e-27	46.5
WP_156437467.1\|2415804_2415981_-	hypothetical protein	NA	NA	NA	NA
WP_059580464.1\|2416128_2416347_-	hypothetical protein	A0A0K2QIZ6	Achromobacter_phage	1.1e-15	56.5
WP_063889461.1\|2416722_2416989_-	hypothetical protein	NA	NA	NA	NA
WP_038749841.1\|2418819_2419650_-	undecaprenyl-diphosphate phosphatase	NA	NA	NA	NA
WP_059580459.1\|2420192_2421101_+	aldose epimerase	NA	NA	NA	NA
WP_038749837.1\|2421324_2422026_+	peptidoglycan DD-metalloendopeptidase family protein	A0A292GJG6	Xanthomonas_phage	8.4e-12	42.7
WP_082717635.1\|2422339_2424007_+	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	5.2e-68	34.8
2423207:2423227	attR	NA	NA	NA	NA
WP_081989693.1\|2424280_2424634_+	DUF2288 domain-containing protein	NA	NA	NA	NA
WP_059580446.1\|2424641_2426036_+	MATE family efflux transporter	NA	NA	NA	NA
WP_038749822.1\|2426246_2426438_-	hypothetical protein	NA	NA	NA	NA
WP_082717636.1\|2426555_2426777_+	hypothetical protein	NA	NA	NA	NA
WP_038749817.1\|2427189_2428008_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_038749814.1\|2428158_2428617_-	phosphohistidine phosphatase SixA	NA	NA	NA	NA
WP_059580443.1\|2429254_2430040_+	glycosyltransferase family 25 protein	A0A1S5NQ44	Burkholderia_phage	1.3e-64	50.4
WP_017880445.1\|2430144_2430939_-	DNA adenine methylase	Q8W6S4	Burkholderia_virus	3.1e-103	67.2
WP_038719145.1\|2431087_2431480_-	hypothetical protein	A0A0U1ZGY3	Ralstonia_phage	9.8e-10	35.3
WP_059580434.1\|2432655_2433228_-	DUF2313 domain-containing protein	NA	NA	NA	NA
WP_059580431.1\|2433224_2434292_-\|plate	baseplate J/gp47 family protein	A0A0M3LQN4	Mannheimia_phage	4.3e-68	42.8
WP_059580426.1\|2434291_2434642_-	hypothetical protein	A0A2H4JDR8	uncultured_Caudovirales_phage	1.9e-25	56.5
WP_006025666.1\|2434707_2435310_-\|plate	phage baseplate assembly protein V	A0A0M3LPA3	Mannheimia_phage	1.3e-37	42.4
WP_059641460.1\|2435306_2436431_-\|tail	phage tail protein	A0A2H4J9E6	uncultured_Caudovirales_phage	3.2e-77	42.6
WP_085701515.1\|2436414_2437725_-	multidrug DMT transporter permease	A0A2H4JGT4	uncultured_Caudovirales_phage	5.9e-43	29.9
WP_038748621.1\|2437726_2439979_-\|tail	tail tape measure protein	A0A0M3LPB6	Mannheimia_phage	2.1e-56	30.5
WP_017880452.1\|2440109_2440508_-	hypothetical protein	NA	NA	NA	NA
WP_059582709.1\|2440504_2440882_-	hypothetical protein	A0A0M3LRV6	Mannheimia_phage	2.8e-22	42.5
WP_059582712.1\|2440911_2442333_-\|tail	phage tail protein	B7SDP8	Haemophilus_phage	1.7e-96	45.4
WP_059582717.1\|2442336_2442564_-	DUF2635 domain-containing protein	A0A0M3LQM9	Mannheimia_phage	8.4e-06	53.6
WP_059608732.1\|2442560_2443229_-	DUF1834 family protein	B7SDP5	Haemophilus_phage	5.9e-31	43.9
WP_059580625.1\|2443233_2443647_-	DUF1320 domain-containing protein	C9DGP4	Escherichia_phage	2.3e-09	33.1
WP_059580628.1\|2443653_2444208_-	hypothetical protein	NA	NA	NA	NA
WP_059580633.1\|2444336_2445230_-	hypothetical protein	A0A0M4UKB9	Ralstonia_phage	1.4e-107	62.0
WP_059641470.1\|2445274_2445685_-	hypothetical protein	A0A0M4TU84	Ralstonia_phage	1.8e-30	53.7
WP_038748613.1\|2445727_2446837_-	hypothetical protein	A0A0M5N0Q6	Ralstonia_phage	2.8e-70	46.1
WP_059580639.1\|2447154_2447739_-	phage virion morphogenesis protein	B7SDZ4	Pseudomonas_virus	7.2e-09	39.3
WP_085701516.1\|2447842_2449156_-\|head	phage head morphogenesis protein	Q6QIB9	Burkholderia_phage	1.8e-60	46.9
WP_085701517.1\|2449145_2450717_-	DUF935 domain-containing protein	A0A0M5MS00	Ralstonia_phage	1.8e-147	52.9
WP_085701518.1\|2450746_2452534_-	hypothetical protein	A0A0M4U7A1	Ralstonia_phage	5.3e-252	73.1
WP_038748608.1\|2452533_2452761_-	hypothetical protein	K4F774	Cronobacter_phage	3.1e-16	47.3
WP_038748607.1\|2452772_2453270_-	DUF1804 family protein	A0A0M3VI86	Ralstonia_phage	1.8e-53	68.7
WP_038748606.1\|2453275_2453482_-	hypothetical protein	NA	NA	NA	NA
WP_081989582.1\|2453478_2453751_-	hypothetical protein	NA	NA	NA	NA
WP_038748604.1\|2453771_2454005_-	conjugal transfer protein TraR	A0A0M4UVB2	Ralstonia_phage	8.7e-06	45.9
WP_038748603.1\|2454005_2454626_-	hypothetical protein	Q6QIC6	Burkholderia_phage	2.2e-08	35.4
WP_038748602.1\|2454606_2454852_-	hypothetical protein	A0A0M4UKB4	Ralstonia_phage	1.8e-09	43.5
WP_085701529.1\|2454856_2455303_-	lysozyme	A0A088FRS5	Escherichia_phage	1.4e-28	51.4
WP_156432330.1\|2455372_2456507_+\|transposase	IS3 family transposase	Q716C2	Shigella_phage	9.4e-21	31.4
WP_038748601.1\|2456759_2457194_-\|transposase	transposase	A0A0A1IWZ1	Pseudomonas_phage	3.4e-19	40.0
WP_059582605.1\|2457190_2457601_-	regulatory protein GemA	A0A0M5MRZ7	Ralstonia_phage	4.9e-28	46.9
WP_156432295.1\|2457667_2458126_-	hypothetical protein	NA	NA	NA	NA
WP_059582598.1\|2458135_2458693_-	hypothetical protein	A0A1S5NV61	Burkholderia_phage	4.5e-08	80.0
WP_017880478.1\|2458706_2459324_-	DUF3164 family protein	Q5ZR10	Pseudomonas_phage	1.1e-60	53.5
WP_059582595.1\|2459357_2459663_-	hypothetical protein	NA	NA	NA	NA
WP_038719153.1\|2459659_2460097_-	hypothetical protein	NA	NA	NA	NA
WP_080109822.1\|2460108_2460426_-	hypothetical protein	NA	NA	NA	NA
WP_059582590.1\|2460480_2460735_-	hypothetical protein	NA	NA	NA	NA
WP_059582586.1\|2460785_2461118_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_038719151.1\|2461104_2461731_-	hypothetical protein	A0A0M3VI82	Ralstonia_phage	3.7e-19	51.9
WP_017880484.1\|2461723_2461954_-	hypothetical protein	NA	NA	NA	NA
WP_038730309.1\|2461961_2462708_-	ATP-binding protein	A0A0U5DWK7	unidentified_phage	2.3e-84	65.5

DBSCAN-SWA_9

2566815 : 2592676

Burkholderia_phage(33.33%)

integrase

attL 2585991:2586008|attR 2594578:2594595

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059575415.1\|2566815_2567841_-	hypothetical protein	A0A0U2QQI2	Escherichia_phage	2.7e-75	46.5
WP_059575413.1\|2567853_2568450_-	hypothetical protein	NA	NA	NA	NA
WP_059575411.1\|2568453_2570301_-	NUDIX domain-containing protein	A0A0U2QW61	Escherichia_phage	4.0e-45	37.4
WP_059575409.1\|2570302_2571139_-	hypothetical protein	A0A0U2I1R8	Escherichia_phage	2.4e-61	44.7
WP_082717585.1\|2571142_2572468_-	DUF1073 domain-containing protein	A0A0U2S5X9	Escherichia_phage	1.7e-90	38.9
WP_059575407.1\|2572600_2573875_-	hypothetical protein	A0A0U2JTW9	Escherichia_phage	7.4e-83	40.2
WP_059575405.1\|2573871_2574342_-	hypothetical protein	A0A2P1MXF5	Escherichia_phage	1.1e-34	50.0
WP_059575403.1\|2574628_2575216_-	hypothetical protein	A9YWZ1	Burkholderia_phage	3.5e-80	77.4
WP_059575401.1\|2575226_2575697_-	RusA family crossover junction endodeoxyribonuclease	A9YWY9	Burkholderia_phage	2.0e-54	71.2
WP_156437407.1\|2575693_2575867_-	hypothetical protein	NA	NA	NA	NA
WP_059575400.1\|2575863_2576484_-	hypothetical protein	NA	NA	NA	NA
WP_059575398.1\|2576452_2577274_-	hypothetical protein	A0A2H4J0Z7	uncultured_Caudovirales_phage	2.6e-12	35.0
WP_082717579.1\|2577359_2577626_-	hypothetical protein	NA	NA	NA	NA
WP_059575393.1\|2577622_2577946_-	transcriptional regulator	NA	NA	NA	NA
WP_059575474.1\|2577942_2578197_-	hypothetical protein	NA	NA	NA	NA
WP_156437408.1\|2578291_2579047_+	LexA family transcriptional repressor	H2BDH4	Pseudomonas_virus	3.9e-15	26.2
WP_059575390.1\|2579062_2579263_+	hypothetical protein	NA	NA	NA	NA
WP_059575472.1\|2580321_2580699_+	DUF1566 domain-containing protein	NA	NA	NA	NA
WP_059575388.1\|2580730_2581051_+	hypothetical protein	Q3HQW8	Burkholderia_phage	1.0e-36	75.7
WP_059575387.1\|2581047_2581443_+	hypothetical protein	NA	NA	NA	NA
WP_059575385.1\|2581439_2581619_+	hypothetical protein	A9YWW6	Burkholderia_phage	1.4e-19	86.2
WP_059575383.1\|2581954_2582239_+	KTSC domain-containing protein	A9YWW2	Burkholderia_phage	1.0e-29	72.7
WP_059575381.1\|2582278_2583319_+	hypothetical protein	H2BD49	Pseudomonas_phage	3.6e-59	47.5
WP_059575379.1\|2583318_2583936_+	hypothetical protein	NA	NA	NA	NA
WP_059575377.1\|2583892_2584699_+	hypothetical protein	NA	NA	NA	NA
WP_059575375.1\|2584732_2585407_+	hypothetical protein	J7I0T4	Pseudomonas_phage	3.2e-24	44.4
WP_157131153.1\|2585334_2586135_+	1-pyrroline-5-carboxylate dehydrogenase	A9YX18	Burkholderia_phage	2.4e-07	60.4
2585991:2586008	attL	NA	NA	NA	NA
WP_059575372.1\|2586324_2586681_+	DUF1566 domain-containing protein	NA	NA	NA	NA
WP_059575370.1\|2586711_2587176_+	DUF1566 domain-containing protein	NA	NA	NA	NA
WP_059575368.1\|2587190_2587568_+	four helix bundle protein	NA	NA	NA	NA
WP_059575469.1\|2587902_2588898_+	RNA-directed DNA polymerase	A0A0N7AE80	Bacillus_phage	1.5e-43	34.6
WP_059575470.1\|2588910_2590146_+	phosphoadenosine phosphosulfate reductase family protein	R9TRT5	Rhizobium_phage	2.2e-172	71.1
WP_059575366.1\|2590142_2590841_+	hypothetical protein	Q8W6Q9	Burkholderia_virus	4.1e-27	49.6
WP_059575364.1\|2590837_2591080_+	hypothetical protein	NA	NA	NA	NA
WP_059575361.1\|2591076_2591409_+	hypothetical protein	A9YWU9	Burkholderia_phage	3.2e-14	62.9
WP_059575359.1\|2591405_2591654_+	hypothetical protein	NA	NA	NA	NA
WP_059575356.1\|2591638_2592676_-\|integrase	site-specific integrase	Q19US1	Mannheimia_phage	1.3e-64	42.4
2594578:2594595	attR	NA	NA	NA	NA

DBSCAN-SWA_10

3044800 : 3055696

Agrobacterium_phage(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038745286.1\|3044800_3047101_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	3.3e-166	41.1
WP_009892611.1\|3047097_3047412_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A218MMY6	uncultured_virus	2.6e-13	44.6
WP_004196460.1\|3047943_3048147_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	6.8e-23	81.8
WP_059581499.1\|3048273_3049869_-	multicopper oxidase family protein	NA	NA	NA	NA
WP_038745290.1\|3050036_3051296_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	5.2e-12	63.0
WP_038745292.1\|3051560_3052139_+	pseudouridine synthase	NA	NA	NA	NA
WP_081463944.1\|3052400_3052616_+	hypothetical protein	NA	NA	NA	NA
WP_038745294.1\|3052810_3053320_+	DUF192 domain-containing protein	A0A1B1IUW8	uncultured_Mediterranean_phage	6.5e-14	43.1
WP_059581496.1\|3053581_3055696_+	elongation factor G	E4ZFJ7	Streptococcus_phage	3.4e-56	26.6

Anti-CRISPR protein detection

Acr_ID: NZ_CP013417.1|WP_059584220.1|1573894_1574104_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_CP013417.1|WP_082742035.1|1574189_1574717_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP013417.1|WP_059584220.1|1573894_1574104_+|hypothetical-protein

1573894_1574104_+

69 aa aa

1523861-1626264

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP013417_1	Orphan	1.3\|2601042\|18\|NZ_CP013417\|CRISPRCasFinder	2601042-2601059	18	1539147-1539164	1

1. spacer 1.3|2601042|18|NZ_CP013417|CRISPRCasFinder matches to NZ_CP013417 position: 1539147-1539164, mismatch: 1

ggcgtgcggcgtgcggcg	CRISPR spacer
ggcgcgcggcgtgcggcg	Protospacer
****.*************

NZ_CP013417.1|WP_082742035.1|1574189_1574717_+|hypothetical-protein

1574189_1574717_+

175 aa aa

1523861-1626264

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP013417_1	Orphan	1.3\|2601042\|18\|NZ_CP013417\|CRISPRCasFinder	2601042-2601059	18	1539147-1539164	1

1. spacer 1.3|2601042|18|NZ_CP013417|CRISPRCasFinder matches to NZ_CP013417 position: 1539147-1539164, mismatch: 1

ggcgtgcggcgtgcggcg	CRISPR spacer
ggcgcgcggcgtgcggcg	Protospacer
****.*************

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP013419

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP013418

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP013417

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information