CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP014142	Thermus parvatiensis strain RL plasmid pTP143, complete sequence	1 crisprs	NA	0	9	1	0
NZ_CP014141	Thermus parvatiensis strain RL chromosome, complete genome	1 crisprs	c2c9_V-U4,csa3,DEDDh,cas6,cas2	0	0	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP014142_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP014142_1

66526-67226

Orphan

I-C,III-B

Consensus_repeat	Method
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	PILER-CR
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	CRISPRCasFinder
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	CRT

9 spacers

The CRISPR arrays of NZ_CP014142_1

>merge|NZ_CP014142|1|66526-67226|PILER-CR,CRISPRCasFinder,CRT
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAACAGGGGTTGACCAAGGGGAGGTCCTGAGGGGGGCCGGGGTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAACGGTAAGCGGTGTACGTCTTCTGTGCCTCCTGGGGAGGTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAACGAGCCTTCCCTCCTCGTCCGTGCGGGGCCAGAGGGTGTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAACCGGACTGCCTGGAGGGTGTTCACGGGCCGAAAGTAGTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAACCTCGGCTCTCTCCCGGGAGAGCACACCCCCTTTGGGGTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAACCCCCCTCGGGCTTGGCCTCCTCCTCCAGGGAGCGGAGGTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAACCAGGGAGCTAAACCGCGAGGGGCGCGTCCTTCTTGAGGTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAACCCCAGACGAGCATGGACTGCGCCCAGCAGGTCTCTTCCAGGTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAACTAAGCGCCCGCAAGAGGGCATCAACCTCAGTCATGGGGTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC

>NZ_CP014142|1|1|66526-67226|PILER-CR
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	AGGGGTTGACCAAGGGGAGGTCCTGAGGGGGGCCGGG
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	GGTAAGCGGTGTACGTCTTCTGTGCCTCCTGGGGAG
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	GAGCCTTCCCTCCTCGTCCGTGCGGGGCCAGAGGGT
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	CGGACTGCCTGGAGGGTGTTCACGGGCCGAAAGTA
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	CTCGGCTCTCTCCCGGGAGAGCACACCCCCTTTGGG
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	CCCCCTCGGGCTTGGCCTCCTCCTCCAGGGAGCGGAG
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	CAGGGAGCTAAACCGCGAGGGGCGCGTCCTTCTTGAG
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	CCCAGACGAGCATGGACTGCGCCCAGCAGGTCTCTTCCAG
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	TAAGCGCCCGCAAGAGGGCATCAACCTCAGTCATGGG
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC

>NZ_CP014142|1|1|66526-67226|CRISPRCasFinder
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	AGGGGTTGACCAAGGGGAGGTCCTGAGGGGGGCCGGG
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	GGTAAGCGGTGTACGTCTTCTGTGCCTCCTGGGGAG
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	GAGCCTTCCCTCCTCGTCCGTGCGGGGCCAGAGGGT
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	CGGACTGCCTGGAGGGTGTTCACGGGCCGAAAGTA
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	CTCGGCTCTCTCCCGGGAGAGCACACCCCCTTTGGG
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	CCCCCTCGGGCTTGGCCTCCTCCTCCAGGGAGCGGAG
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	CAGGGAGCTAAACCGCGAGGGGCGCGTCCTTCTTGAG
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	CCCAGACGAGCATGGACTGCGCCCAGCAGGTCTCTTCCAG
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	TAAGCGCCCGCAAGAGGGCATCAACCTCAGTCATGGG
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC

>NZ_CP014142|1|1|66526-67226|CRT
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	AGGGGTTGACCAAGGGGAGGTCCTGAGGGGGGCCGGG
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	GGTAAGCGGTGTACGTCTTCTGTGCCTCCTGGGGAG
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	GAGCCTTCCCTCCTCGTCCGTGCGGGGCCAGAGGGT
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	CGGACTGCCTGGAGGGTGTTCACGGGCCGAAAGTA
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	CTCGGCTCTCTCCCGGGAGAGCACACCCCCTTTGGG
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	CCCCCTCGGGCTTGGCCTCCTCCTCCAGGGAGCGGAG
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	CAGGGAGCTAAACCGCGAGGGGCGCGTCCTTCTTGAG
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	CCCAGACGAGCATGGACTGCGCCCAGCAGGTCTCTTCCAG
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC	TAAGCGCCCGCAAGAGGGCATCAACCTCAGTCATGGG
GTTTCAATCCTCACCGGCCCTTTCGGGCCGGTGCAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP014142.1\|WP_008631400.1\|76043_76706_+\|nickel-permease	unknown	unknown	gnl\|CDD\|225911
NZ_CP014142.1\|WP_008633013.1\|56444_56633_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014142.1\|WP_008630830.1\|49994_51119_-\|transposase	unknown	unknown	gnl\|CDD\|376573
NZ_CP014142.1\|WP_008631380.1\|70526_71090_-\|cob(I)yrinic-acid-a,c-diamide-adenosyltransferase	unknown	unknown	gnl\|CDD\|376827
NZ_CP014142.1\|WP_008631402.1\|76702_77803_+\|cobalt-precorrin-5B-(C(1))-methyltransferase	unknown	unknown	gnl\|CDD\|234615
NZ_CP014142.1\|WP_014630524.1\|71121_71658_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|366645
NZ_CP014142.1\|WP_038035114.1\|59156_59774_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227645
NZ_CP014142.1\|WP_167345979.1\|51225_52539_-\|IS256-family-transposase	unknown	unknown	gnl\|CDD\|307151
NZ_CP014142.1\|WP_060384868.1\|55728_56142_-\|type-II-toxin-antitoxin-system-VapC-family-toxin	unknown	unknown	gnl\|CDD\|224761
NZ_CP014142.1\|WP_060384865.1\|52829_53783_+\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376564
NZ_CP014142.1\|WP_014511290.1\|77795_78494_+\|precorrin-8X-methylmutase	unknown	unknown	gnl\|CDD\|376825
NZ_CP014142.1\|WP_024119299.1\|75248_75782_+\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366010
NZ_CP014142.1\|WP_008633599.1\|49642_49885_-\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|273625
NZ_CP014142.1\|WP_014511293.1\|72384_74193_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014142.1\|WP_060384866.1\|53813_55034_+\|IS256-like-element-ISTth4-family-transposase	unknown	unknown	gnl\|CDD\|307151
NZ_CP014142.1\|WP_060384869.1\|56717_57527_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014142.1\|WP_008631365.1\|56138_56354_-\|ribbon-helix-helix-protein,-CopG-family	unknown	unknown	unknown
NZ_CP014142.1\|WP_008631406.1\|78494_79706_+\|bifunctional-cobalt-precorrin-7-(C(5))-methyltransferase/cobalt-precorrin-6B-(C(15))-methyltransferase	unknown	unknown	gnl\|CDD\|381171
NZ_CP014142.1\|WP_008631408.1\|79702_80374_+\|precorrin-2-C(20)-methyltransferase	unknown	unknown	gnl\|CDD\|381172
NZ_CP014142.1\|WP_060384865.1\|67462_68416_+\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376564

Protein	Function_ID	Function_description	E-value
NZ_CP014142.1\|WP_008630830.1\|49994_51119_-\|transposase	gnl\|CDD\|376573	pfam01609, DDE_Tnp_1, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. This family contains transposases for IS4, IS421, IS5377, IS427, IS402, IS1355, IS5, which was original isolated in bacteriophage lambda.	2.5778e-06
NZ_CP014142.1\|WP_008631400.1\|76043_76706_+\|nickel-permease	gnl\|CDD\|225911	COG3376, HoxN, High-affinity nickel permease [Inorganic ion transport and metabolism].	3.07609e-12
NZ_CP014142.1\|WP_060384868.1\|55728_56142_-\|type-II-toxin-antitoxin-system-VapC-family-toxin	gnl\|CDD\|224761	COG1848, COG1848, Predicted nucleic acid-binding protein, contains PIN domain [General function prediction only].	2.67559e-07
NZ_CP014142.1\|WP_060384866.1\|53813_55034_+\|IS256-like-element-ISTth4-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	2.22661e-88
NZ_CP014142.1\|WP_008631380.1\|70526_71090_-\|cob(I)yrinic-acid-a,c-diamide-adenosyltransferase	gnl\|CDD\|376827	pfam02572, CobA_CobO_BtuR, ATP:corrinoid adenosyltransferase BtuR/CobO/CobP. This family consists of the BtuR, CobO, CobP proteins all of which are Cob(I)alamin adenosyltransferase, EC:2.5.1.17, involved in cobalamin (vitamin B12) biosynthesis. These enzymes catalyze the adenosylation reaction: ATP + cob(I)alamin + H2O <=> phosphate + diphosphate + adenosylcobalamin.	1.5886e-94
NZ_CP014142.1\|WP_008631402.1\|76702_77803_+\|cobalt-precorrin-5B-(C(1))-methyltransferase	gnl\|CDD\|234615	PRK00075, cbiD, cobalt-precorrin-6A synthase; Reviewed.	9.12503e-144
NZ_CP014142.1\|WP_014630524.1\|71121_71658_-\|hypothetical-protein	gnl\|CDD\|366645	pfam01442, Apolipoprotein, Apolipoprotein A1/A4/E domain. These proteins contain several 22 residue repeats which form a pair of alpha helices. This family includes: Apolipoprotein A-I. Apolipoprotein A-IV. Apolipoprotein E.	1.11399e-06
NZ_CP014142.1\|WP_038035114.1\|59156_59774_+\|hypothetical-protein	gnl\|CDD\|227645	COG5340, COG5340, Predicted transcriptional regulator [Transcription].	5.61226e-08
NZ_CP014142.1\|WP_008631408.1\|79702_80374_+\|precorrin-2-C(20)-methyltransferase	gnl\|CDD\|381172	cd11645, Precorrin_2_C20_MT, Precorrin-2 C20-methyltransferase, also named CobI or CbiL. Precorrin-2 C20-methyltransferase (also known as S-adenosyl-L-methionine--precorrin-2 methyltransferase) participates in the pathway toward the biosynthesis of cobalamin (vitamin B12). There are two distinct cobalamin biosynthetic pathways in bacteria. The aerobic pathway requires oxygen, and cobalt is inserted late in the pathway; the anaerobic pathway does not require oxygen, and cobalt insertion is the first committed step towards cobalamin synthesis. Precorrin-2 C20-methyltransferase catalyzes methylation at the C-20 position of a cyclic tetrapyrrole ring of precorrin-2 using S-adenosylmethionine as a methyl group source to produce precorrin-3A. In the anaerobic pathway, cobalt is inserted into precorrin-2 by CbiK to generate cobalt-precorrin-2, which is the substrate for CbiL, a C20 methyltransferase. In Clostridium difficile, CbiK and CbiL are fused into a bifunctional enzyme. In the aerobic pathway, the precorrin-2 C20-methyltransferase is named CobI. This family includes CbiL and CobI precorrin-2 C20-methyltransferases, both as stand-alone enzymes and when CbiL forms part of a bifunctional enzyme.	4.17642e-55
NZ_CP014142.1\|WP_060384865.1\|52829_53783_+\|IS110-family-transposase	gnl\|CDD\|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	3.65918e-29
NZ_CP014142.1\|WP_014511290.1\|77795_78494_+\|precorrin-8X-methylmutase	gnl\|CDD\|376825	pfam02570, CbiC, Precorrin-8X methylmutase. This is a family Precorrin-8X methylmutases also known as Precorrin isomerase, CbiC/CobH, EC:5.4.1.2. This enzyme catalyzes the reaction: Precorrin-8X <=> hydrogenobyrinate. This enzyme is part of the Cobalamin (vitamin B12) biosynthetic pathway and catalyzes a methyl rearrangement.	4.71423e-95
NZ_CP014142.1\|WP_024119299.1\|75248_75782_+\|histidine-phosphatase-family-protein	gnl\|CDD\|366010	pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members.	2.25961e-45
NZ_CP014142.1\|WP_008633599.1\|49642_49885_-\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	gnl\|CDD\|273625	TIGR01439, Uncharacterized_protein_Mb2626, looped-hinge helix DNA binding domain, AbrB family. This DNA-binding domain family includes AbrB, a transition state regulator in Bacillus subtilis, whose DNA-binding domain structure in solution was determined by NMR. The domain binds DNA as a dimer in what is termed a looped-hinge helix fold. Some members of the family have two copies of the domain in tandem. The domain is found usually at the N-terminus of a small protein. This model excludes members of family TIGR02609. [Regulatory functions, DNA interactions].	0.000519482
NZ_CP014142.1\|WP_167345979.1\|51225_52539_-\|IS256-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	1.0226e-88
NZ_CP014142.1\|WP_060384865.1\|67462_68416_+\|IS110-family-transposase	gnl\|CDD\|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	3.65918e-29
NZ_CP014142.1\|WP_008631406.1\|78494_79706_+\|bifunctional-cobalt-precorrin-7-(C(5))-methyltransferase/cobalt-precorrin-6B-(C(15))-methyltransferase	gnl\|CDD\|381171	cd11644, Precorrin-6Y-MT, Precorrin-6Y methyltransferase (also named CbiE). CbiE (precorrin-6Y methyltransferase, also known as cobalt-precorrin-7 C(5)-methyltransferase, also known as cobalt-precorrin-6Y C(5)-methyltransferase) catalyzes the methylation of C-5 in cobalt-precorrin-7 to form cobalt-precorrin-8. It participates in the pathway toward the biosynthesis of cobalamin (vitamin B12). There are two distinct cobalamin biosynthetic pathways in bacteria. The aerobic pathway requires oxygen, and cobalt is inserted late in the pathway; the anaerobic pathway does not require oxygen, and cobalt insertion is the first committed step towards cobalamin synthesis. CbiE functions in the anaerobic pathway, it is a subunit of precorrin-6Y C5,15-methyltransferase, a bifunctional enzyme: cobalt-precorrin-7 C(5)-methyltransferase (CbiE)/cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) (CbiT), that catalyzes two methylations (at C-5 and C-15) in precorrin-6Y, as well as the decarboxylation of the acetate side chain located in ring C, in order to generate precorrin-8X. CbiE and CbiT can be found fused (CbiET, also called CobL), or on separate protein chains (CbiE and CbiT). In the aerobic pathway, a single enzyme called CobL catalyzes the methylations at C-5 and C-15, and the decarboxylation of the C-12 acetate side chain of precorrin-6B.	1.94779e-68

>NZ_CP014142.1|WP_038035114.1|59156_59774_+|hypothetical-protein
MSRHEKERELYRMALAQGGVFTLDQARRYGIDRKGASYRVRTGLWERLARGIYRLSFAPLSQDEDLVRIALWASSYRGLVAFSHETALALHGLSDLLPDRYHLTVPRGFSRKPRWQVVLHRRDLAPADTEERPGYRVTTPLRTLLDVAETSRVPEEQLWLAVHQALDRGLVSQKRLEAALPGLSVRARARLLRALRSHALGAVSA
>NZ_CP014142.1|WP_060384869.1|56717_57527_+|hypothetical-protein
MQQDREHPLYYLDAETLLVATYIWVDDELKALQAQDFKLPPKQKHQKATLAELLTLAIFLLLQGQDLAKGYLAAKTTLKAYFPFLPHLSRFYRVLQKAQGLLAHLAMRLSGGQGLLQVVDLKPIPLAHGHRIHGLSLPEAAMGVGPLGAFAGYVLMPVMNERGLFFRWAILPGNARETWGRDLLDGLPAVLGDRGFRWVQGVKTPPYRVRGGRVRNWIETRFSVMVRSLGLHRIEARSYWGLVARVNLILLVHNLIRSRVLLRMAGVEL
>NZ_CP014142.1|WP_008633013.1|56444_56633_+|hypothetical-protein
MRLEGGGAWATAEVQVEALPARVVLSACSEGGACRSLALPREGGPFRLEGLSLAAKLLRYFC
>NZ_CP014142.1|WP_008631365.1|56138_56354_-|ribbon-helix-helix-protein,-CopG-family
MRVTIYLPDHLAQEVEAYRKARPGLSLSALVRELLERELVKRPEALLEVAGLVERAELSAREHDALIREER
>NZ_CP014142.1|WP_060384868.1|55728_56142_-|type-II-toxin-antitoxin-system-VapC-family-toxin
MIPERLVLDAGPLIALLHRSDPDHEEAVRGFRRLAEGGARLFLPMPVLFEVFKWLLFQAGPKAAREGLAKVEEGVVVVPFTLEDLEEVRLLLTRLPGWGGTLEDAGVALLALRLGAPVWTLNYRDLGAFPALRFWTP
>NZ_CP014142.1|WP_060384866.1|53813_55034_+|IS256-like-element-ISTth4-family-transposase
MFNRGAHLSTRRCPVDQDTLRILLREAVRETVAEVLQTVLELDRTAFLQVHGGRRNGYYPRKLETTFGQVDLKVPRDRESRYYPAFLKPYARRLVDVGEVAVALYAAGVSQRKAAEILSLLLGHRYSHETLSALTDEVLEAAGAFRTRPLPEEMAFVYLDGLSLKVFREGEGIVRESVYVALGIAPNGERRVLGFWLLPTESALGWEGVLGELWQRGLRRVLLFITDGLPGLPEAIRRVYPQAEWQRCVVHGVRWSLSQVRARDRGLLAEDLRRVYGAESREEALGALEEVKAAWGSRYPGVVGLWVQDSGAFLRFYGYPKVLWPYLRSTNLMERFIRELRRGTKVRDHKFPKAEAVYKLLYLESERQEGRWAERKLKGFSEVKEVLEKMLQERYAPRTQTLTHNS
>NZ_CP014142.1|WP_060384865.1|52829_53783_+|IS110-family-transposase
MTFAGIDVSKPHLDLALVSNSPKPTRLRFPNTPEGRQALLAALAHHNPAWVALEPTGPYHLPLLRLLAEKGLPVALVNPYHLAAFRKAKGERNKTDRQDALLLARYAQVYHEDLRAYTLPPETLQTLKALVGYREDLAGREQAILNQMEAAEWAGSREVLALLQKELSCVKALLGEVEARIQALLAALPEAEVLMGLPGVGPQVAAAVLALLPPELWGRAKAAASYAGLIPEREESGKSVERGRLSRKGPPLLRRKLYMGALVAVRHDPEMRAFYHRLLSRGKTKKQALLAVAHKLLRRMMGRLREYYAGQPAQGVA
>NZ_CP014142.1|WP_167345979.1|51225_52539_-|IS256-family-transposase
MFNRGAHLSTRRCPVDQDTLRILLREAVRETVAEVLQTVLELDRTAFLQVHGGRRNGYYPRKLETTFGQVDLKVPRDRESRYYPAFLKPYARRLVDVGEVAVALYAAGVSQRKAAEILSLLLGHRYSHETLSALTDEVLEAAGAFRTRPLPEEMAFVYLDGLSLKVFREGEGIVRESVYVALGIAPNGERRVLGFWLLPTESALGWEGVLGELWQRGLRRVLLFITDGLPGLPEAIRRVYPQAEWQRCVVHGVRWSLSQVRARDRGLLAEDLRRVYGAESREEALGALEEVKAAWGSRYPGVVGLWVQDSGAFLRFYGYPKVLWPYLRSTNLMERFIREVRRGTKVRDHKFPKEEAVYKLLYLESERQAASRSEHLAGRWAERKLKGFSEVKEVLEKMLQERYAPRTQTLTHNRTLPTSPFRGKSPLAGAARIWYRG
>NZ_CP014142.1|WP_008630830.1|49994_51119_-|transposase
MRGALAAGSARVSEMVASLPSPLQNRFHQAKALYRFLSNPRVEAEALLDRVYQESATALEGEEVLVLLDLSPVVKPYARALEGIARVGKDRRPGYELLTALGLDPAGRLALGYAHLVAYGERGFASLPKEVEGAIEAARERLGGVGRRLVYVADRGFDDRKVFGQVLALGEEFVVRVYRDRKLGEGGSLAKVASSLALPCGEEVELRVGGRYQRVRLHFGWREVEVEGRRLHLVVCRVPALGRRGEWWLLTSLPVRGREEAARVVEAYRRRWEVERFFRLLKTGLGLETFQVRGLARIRKVVAVLLGLAVFLWEVERLGDPFKGFLLQLGGKLGLPSERDGPYLLLRGLVRLLNYEVTQELLKQAKGGRGRSFG
>NZ_CP014142.1|WP_008633599.1|49642_49885_-|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein
MELAKLSRKGQLSIPKRLLKALGVEGEAYFLVELAPEGGLLLRPAGVYPLEVYTEERLQELLAEDTLTEEERARLAALAR
>NZ_CP014142.1|WP_060384865.1|67462_68416_+|IS110-family-transposase
MTFAGIDVSKPHLDLALVSNSPKPTRLRFPNTPEGRQALLAALAHHNPAWVALEPTGPYHLPLLRLLAEKGLPVALVNPYHLAAFRKAKGERNKTDRQDALLLARYAQVYHEDLRAYTLPPETLQTLKALVGYREDLAGREQAILNQMEAAEWAGSREVLALLQKELSCVKALLGEVEARIQALLAALPEAEVLMGLPGVGPQVAAAVLALLPPELWGRAKAAASYAGLIPEREESGKSVERGRLSRKGPPLLRRKLYMGALVAVRHDPEMRAFYHRLLSRGKTKKQALLAVAHKLLRRMMGRLREYYAGQPAQGVA
>NZ_CP014142.1|WP_008631380.1|70526_71090_-|cob(I)yrinic-acid-a,c-diamide-adenosyltransferase
MEEPKRQKPYAKPQGERRGLLLVYTGDGKGKSTAAFGLALRAHGRGLKVRIFQFIKHGTARFGEHRAFSLLGIPIEGLGDGFTWRSRDLARSAALAQEGWGRAKEALLSGTYDLVVLDEATYPLRYGWVSLEEFLEVLRARPPHVHVVVTGRGAPEALLELADTVTEMRKVKHAFDQGVPAQRGIEH
>NZ_CP014142.1|WP_014630524.1|71121_71658_-|hypothetical-protein
MSEDRLLERLEKLEGVVETTVAVLPPLIQDLSRRIDALREEVKAELREREARLEERFQGLEKRIQEVETKLESRIQNLEARLERQIQETETRLGTRIQEVEAKLERQIQETEAQLEARIHAVETKLEGRIQEVENRLEAQILALRQEMKAEIGSAFNRVMLYLTAVGVVLALLSVFFR
>NZ_CP014142.1|WP_014511293.1|72384_74193_-|hypothetical-protein
MGRWELERAWDLLEEGDLLEALEHAERAYRRHPKDPEARFLYGYLRFTSDGAYEGLRLMELGAKAMGGEACAELWRIYGTEFPAHLLDLARFLERRGLPLPGDTAWAEAVLEEQGLPPEVAREVERWLYQEDIPSLEGFFRKRPSPYPGYLLVRLYLARGAFLRAQGLAGELGEAWGGDWRVELARLLARFPQEGPSLAEEVRPLLARRPKDPHLAEGLALLALGVGEGRVALELDRAFDPPLRARFPHLEEPLEAEEEGRPLVPLGLFLSPGRADVSPPPFAWEAFRSWLPRLGLGELTLWGRPFLRSGLLSPEDVRQEMREGVMRLRFLEEGRPPFVPLASLGELLGASPEEREAASAAASPGELAHFRKAFPDSLLLELYALLYRPFGDWPEGRVRRLLREELPWGVREALRLRLELGRDPLAPLSPPEPPPGDLWPEEFLFTWLLLAPPEEEVEEAFLVPPGNRAVNLDWLNVYPLRVRRLEAQRPWRKEPLPEGGGLEDWARRLPLSLRTFWLVELEVDEGMGLEDLLDPETLRDLLEGLAPGARSLLARLVREGRLPLSQAEEKALAQLERRFLAFVGAGEVGLPGDLRRALFRAL
>NZ_CP014142.1|WP_024119299.1|75248_75782_+|histidine-phosphatase-family-protein
MELWLVRHGETLWNREGRLLGWTDLPLTAEGEAQARRLKGALPSLPAFSSDLLRARRTAELAGFSPRLYPELREIHFGTLEGAPWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRFLEGLKAPAVLFTHGGVVRAVLRALGEDGLVPPGSAVAVDWPRRVLVRLALDGEEATG
>NZ_CP014142.1|WP_008631400.1|76043_76706_+|nickel-permease
MTGLELLAVALGMRHGVDPDHLAAVDGLSRVRPSPLNGVLFALGHGGVVTLLAFPAASLLGRVDLEALHLPAFLLLLVAALNLYRLLKPAPPTPPKGLPLLNPLLLGVLFGLGFETASQLSALALSAELSPLRLGAFFTLGMLLVDGVDGLLASRLQNLAKDSQRAEEASRLLGWAVVAVALVLALAELGGVDLEAFALPLGLGLFGLLVSLRLYALRPA
>NZ_CP014142.1|WP_008631402.1|76702_77803_+|cobalt-precorrin-5B-(C(1))-methyltransferase
MSHPYPPPRDKKGSRIGFTTGANAAAAAKAAALALLGEAPEVVDIWLPAGWRQPFRVFRLERKGDGVLVGMIKDAGDDPDVTHGAEIQAFVRFASEDRLEGGEGVGVVTKPGLGVPVGEPAINPVPRRMIWEAVREVTERPLAVTIAIPGGEELAKKTLNPRLGILGGLSVLGTTGVVKPYSTSAFRMSVVQAVGVARANGLLEIAATTGGKSERFAQRLLPHLPEMAFIEMGDFVGDVLRAARKVGVEVVRVVGMIGKISKMADGKTMTHAAGGEVNLSLLLSLLKEAGASPKALKEAEGAATARRFLEIALEEGLELFFVNLVRLAQEKLQAYIGERPFVSVALTDFDEGRCLAAWPDREVYRG
>NZ_CP014142.1|WP_014511290.1|77795_78494_+|precorrin-8X-methylmutase
MDDLIKAQKNPAHQMTEKGRAIEEESFRIVDEEAGPHGFSPLEWPVVRRMIHATADFEYKALTRFSQGAVEAGLKAIQAGARILVDARMIACGLNPERLRLFGNEVVELLAHPEVVARAKATGGTRAEAAVAYAWEKGLLDGAIVGVGNAPTFLLALVEAIRQGARPALVLGMPVGFVNVLEAKRALMEAPVPWIVTEGRKGGSTLVVAALHALIRLAADGGVDTSRAYREG
>NZ_CP014142.1|WP_008631406.1|78494_79706_+|bifunctional-cobalt-precorrin-7-(C(5))-methyltransferase/cobalt-precorrin-6B-(C(15))-methyltransferase
MVYVIGMGARGREGLSLKALRRLEEAEVLIGGRRHLAHFPDHPGEKVPVQGPLEALLDLAEARLKEGKKVAFLASGDPLFYGIGKRVLERFPEAEVHPAPTAFQEAFARLKLPWDQARFFSLHGRPLGGVLLELSLSPLSVVYTDPEHTPAGIARALLEMGVDARAHVAERLGEEDERVRSFAGLKEVAEERFLDPNVLILEAKGPLPPRLGFFPDEAFEQRMPKKGLITKREVRLLALGLLGLPPDGVLWDIGAGTGSVGIEAARLAPWGEVYAVEKNPESWPHIVENARRFGAFNLHLVKGEAPEALKGLPAPHAVFVGGSGGELEEILRVSLKALRPGGRLVVAAITLENLLAAYGFLKGTGLPLEGFQVQASRVVPLARYHRLEAQNPITLLAVTKEGA
>NZ_CP014142.1|WP_008631408.1|79702_80374_+|precorrin-2-C(20)-methyltransferase
MKLYLIGLGPGDPELLTLKALRLIQRLPVLFYPKEEGREPIALGIARPFLPEGKPLLPLPLFTGGDPKEAERARREAARRVREALSRYGEGGYLVLGDSLLYASPLNLLPHLEGVAVEAVPGISAHQLAAASLLKPIALGEEGFAAVTGLGPVDPEGLDRFQSVFVYKAKDLEALERAFPDREGWAFLRLGMPGERVLPLGAAKGVARDYWTLVGLWRKGGKR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP014142_1	1.1\|66563\|37\|NZ_CP014142\|PILER-CR,CRISPRCasFinder,CRT	66563-66599	37	NZ_CP014142	Thermus parvatiensis strain RL plasmid pTP143, complete sequence	66563-66599	0	1.0
NZ_CP014142_1	1.2\|66637\|36\|NZ_CP014142\|PILER-CR,CRISPRCasFinder,CRT	66637-66672	36	NZ_CP014142	Thermus parvatiensis strain RL plasmid pTP143, complete sequence	66637-66672	0	1.0
NZ_CP014142_1	1.3\|66710\|36\|NZ_CP014142\|PILER-CR,CRISPRCasFinder,CRT	66710-66745	36	NZ_CP014142	Thermus parvatiensis strain RL plasmid pTP143, complete sequence	66710-66745	0	1.0
NZ_CP014142_1	1.3\|66710\|36\|NZ_CP014142\|PILER-CR,CRISPRCasFinder,CRT	66710-66745	36	NZ_AP017921	Thermus thermophilus strain TMY plasmid pTMY, complete sequence	17330-17365	0	1.0
NZ_CP014142_1	1.4\|66783\|35\|NZ_CP014142\|PILER-CR,CRISPRCasFinder,CRT	66783-66817	35	NZ_CP014142	Thermus parvatiensis strain RL plasmid pTP143, complete sequence	66783-66817	0	1.0
NZ_CP014142_1	1.5\|66855\|36\|NZ_CP014142\|PILER-CR,CRISPRCasFinder,CRT	66855-66890	36	NZ_CP014142	Thermus parvatiensis strain RL plasmid pTP143, complete sequence	66855-66890	0	1.0
NZ_CP014142_1	1.6\|66928\|37\|NZ_CP014142\|PILER-CR,CRISPRCasFinder,CRT	66928-66964	37	NZ_CP014142	Thermus parvatiensis strain RL plasmid pTP143, complete sequence	66928-66964	0	1.0
NZ_CP014142_1	1.6\|66928\|37\|NZ_CP014142\|PILER-CR,CRISPRCasFinder,CRT	66928-66964	37	NZ_AP017921	Thermus thermophilus strain TMY plasmid pTMY, complete sequence	17037-17073	0	1.0
NZ_CP014142_1	1.7\|67002\|37\|NZ_CP014142\|PILER-CR,CRISPRCasFinder,CRT	67002-67038	37	NZ_CP014142	Thermus parvatiensis strain RL plasmid pTP143, complete sequence	67002-67038	0	1.0
NZ_CP014142_1	1.8\|67076\|40\|NZ_CP014142\|PILER-CR,CRISPRCasFinder,CRT	67076-67115	40	NZ_CP014142	Thermus parvatiensis strain RL plasmid pTP143, complete sequence	67076-67115	0	1.0
NZ_CP014142_1	1.9\|67153\|37\|NZ_CP014142\|PILER-CR,CRISPRCasFinder,CRT	67153-67189	37	NZ_CP014142	Thermus parvatiensis strain RL plasmid pTP143, complete sequence	67153-67189	0	1.0
NZ_CP014142_1	1.3\|66710\|36\|NZ_CP014142\|PILER-CR,CRISPRCasFinder,CRT	66710-66745	36	NC_010878	Thermus sp. 4C plasmid pL4C, complete sequence	12706-12741	1	0.972
NZ_CP014142_1	1.6\|66928\|37\|NZ_CP014142\|PILER-CR,CRISPRCasFinder,CRT	66928-66964	37	NC_010878	Thermus sp. 4C plasmid pL4C, complete sequence	12413-12449	2	0.946
NZ_CP014142_1	1.3\|66710\|36\|NZ_CP014142\|PILER-CR,CRISPRCasFinder,CRT	66710-66745	36	NC_016634	Thermus sp. CCB_US3_UF1 plasmid pTCCB09, complete sequence	15041-15076	3	0.917

1. spacer 1.1|66563|37|NZ_CP014142|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014142 (Thermus parvatiensis strain RL plasmid pTP143, complete sequence) position: , mismatch: 0, identity: 1.0

aggggttgaccaaggggaggtcctgaggggggccggg	CRISPR spacer
aggggttgaccaaggggaggtcctgaggggggccggg	Protospacer
*************************************

2. spacer 1.2|66637|36|NZ_CP014142|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014142 (Thermus parvatiensis strain RL plasmid pTP143, complete sequence) position: , mismatch: 0, identity: 1.0

ggtaagcggtgtacgtcttctgtgcctcctggggag	CRISPR spacer
ggtaagcggtgtacgtcttctgtgcctcctggggag	Protospacer
************************************

3. spacer 1.3|66710|36|NZ_CP014142|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014142 (Thermus parvatiensis strain RL plasmid pTP143, complete sequence) position: , mismatch: 0, identity: 1.0

gagccttccctcctcgtccgtgcggggccagagggt	CRISPR spacer
gagccttccctcctcgtccgtgcggggccagagggt	Protospacer
************************************

4. spacer 1.3|66710|36|NZ_CP014142|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP017921 (Thermus thermophilus strain TMY plasmid pTMY, complete sequence) position: , mismatch: 0, identity: 1.0

gagccttccctcctcgtccgtgcggggccagagggt	CRISPR spacer
gagccttccctcctcgtccgtgcggggccagagggt	Protospacer
************************************

5. spacer 1.4|66783|35|NZ_CP014142|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014142 (Thermus parvatiensis strain RL plasmid pTP143, complete sequence) position: , mismatch: 0, identity: 1.0

cggactgcctggagggtgttcacgggccgaaagta	CRISPR spacer
cggactgcctggagggtgttcacgggccgaaagta	Protospacer
***********************************

6. spacer 1.5|66855|36|NZ_CP014142|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014142 (Thermus parvatiensis strain RL plasmid pTP143, complete sequence) position: , mismatch: 0, identity: 1.0

ctcggctctctcccgggagagcacaccccctttggg	CRISPR spacer
ctcggctctctcccgggagagcacaccccctttggg	Protospacer
************************************

7. spacer 1.6|66928|37|NZ_CP014142|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014142 (Thermus parvatiensis strain RL plasmid pTP143, complete sequence) position: , mismatch: 0, identity: 1.0

ccccctcgggcttggcctcctcctccagggagcggag	CRISPR spacer
ccccctcgggcttggcctcctcctccagggagcggag	Protospacer
*************************************

8. spacer 1.6|66928|37|NZ_CP014142|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP017921 (Thermus thermophilus strain TMY plasmid pTMY, complete sequence) position: , mismatch: 0, identity: 1.0

ccccctcgggcttggcctcctcctccagggagcggag	CRISPR spacer
ccccctcgggcttggcctcctcctccagggagcggag	Protospacer
*************************************

9. spacer 1.7|67002|37|NZ_CP014142|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014142 (Thermus parvatiensis strain RL plasmid pTP143, complete sequence) position: , mismatch: 0, identity: 1.0

cagggagctaaaccgcgaggggcgcgtccttcttgag	CRISPR spacer
cagggagctaaaccgcgaggggcgcgtccttcttgag	Protospacer
*************************************

10. spacer 1.8|67076|40|NZ_CP014142|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014142 (Thermus parvatiensis strain RL plasmid pTP143, complete sequence) position: , mismatch: 0, identity: 1.0

cccagacgagcatggactgcgcccagcaggtctcttccag	CRISPR spacer
cccagacgagcatggactgcgcccagcaggtctcttccag	Protospacer
****************************************

11. spacer 1.9|67153|37|NZ_CP014142|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014142 (Thermus parvatiensis strain RL plasmid pTP143, complete sequence) position: , mismatch: 0, identity: 1.0

taagcgcccgcaagagggcatcaacctcagtcatggg	CRISPR spacer
taagcgcccgcaagagggcatcaacctcagtcatggg	Protospacer
*************************************

12. spacer 1.3|66710|36|NZ_CP014142|PILER-CR,CRISPRCasFinder,CRT matches to NC_010878 (Thermus sp. 4C plasmid pL4C, complete sequence) position: , mismatch: 1, identity: 0.972

gagccttccctcctcgtccgtgcggggccagagggt	CRISPR spacer
gagcctcccctcctcgtccgtgcggggccagagggt	Protospacer
******.*****************************

13. spacer 1.6|66928|37|NZ_CP014142|PILER-CR,CRISPRCasFinder,CRT matches to NC_010878 (Thermus sp. 4C plasmid pL4C, complete sequence) position: , mismatch: 2, identity: 0.946

ccccctcgggcttggcctcctcctccagggagcggag	CRISPR spacer
ccccctcgggcctcgcctcctcctccagggagcggag	Protospacer
***********.* ***********************

14. spacer 1.3|66710|36|NZ_CP014142|PILER-CR,CRISPRCasFinder,CRT matches to NC_016634 (Thermus sp. CCB_US3_UF1 plasmid pTCCB09, complete sequence) position: , mismatch: 3, identity: 0.917

gagccttccctcctcgtccgtgcggggccagagggt	CRISPR spacer
gagcctcccctccccgtccgtgcggggccagaggga	Protospacer
******.******.*********************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

28134 : 68416

uncultured_virus(33.33%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008630830.1\|28134_29259_+\|transposase	transposase	NA	NA	NA	NA
WP_008633641.1\|29313_30342_-	DUF393 domain-containing protein	NA	NA	NA	NA
WP_008633626.1\|32837_33344_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_008633618.1\|34803_35400_+	hypothetical protein	NA	NA	NA	NA
WP_060384860.1\|35421_35847_+	osmotic signal transduction-like protein	NA	NA	NA	NA
WP_008633616.1\|35945_37124_+	DNA repair exonuclease	NA	NA	NA	NA
WP_060384861.1\|37104_39822_+	SMC family ATPase	G3MAB6	Bacillus_virus	1.2e-08	23.5
WP_060384862.1\|39829_40108_-	hypothetical protein	A0MN33	Thermus_phage	5.1e-05	30.7
WP_015717156.1\|41521_41830_+	hypothetical protein	NA	NA	NA	NA
WP_008633608.1\|45326_45635_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_060384863.1\|45627_45822_+	hypothetical protein	NA	NA	NA	NA
WP_167345978.1\|46742_46919_+	hypothetical protein	NA	NA	NA	NA
WP_008633604.1\|46890_47367_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_060384864.1\|48714_49149_-	ParA family protein	NA	NA	NA	NA
WP_008633600.1\|49206_49662_-	PIN domain-containing protein	NA	NA	NA	NA
WP_008633599.1\|49642_49885_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_008630830.1\|49994_51119_-\|transposase	transposase	NA	NA	NA	NA
WP_167345979.1\|51225_52539_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	2.0e-22	37.4
WP_060384865.1\|52829_53783_+\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	5.0e-07	33.6
WP_060384866.1\|53813_55034_+\|transposase	IS256-like element ISTth4 family transposase	A0A218MNI5	uncultured_virus	2.4e-22	35.4
WP_060384868.1\|55728_56142_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_008631365.1\|56138_56354_-	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_008633013.1\|56444_56633_+	hypothetical protein	NA	NA	NA	NA
WP_060384869.1\|56717_57527_+	hypothetical protein	NA	NA	NA	NA
WP_038035114.1\|59156_59774_+	hypothetical protein	NA	NA	NA	NA
WP_060384865.1\|67462_68416_+\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	5.0e-07	33.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP014141

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP014141_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP014141_1

826521-826619

Orphan

Consensus_repeat	Method
CATCTCCTGCCGCAGGCTTTGGAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP014141_1

>merge|NZ_CP014141|1|826521-826619|CRISPRCasFinder
CACCTCCTGGCGGAGGCTCGCCATCTCCTGCCGCAGGCTTTGGATTTCCCCGCGCAGCTCGGTGGTCTCCGCCTTCATCTCCTGCCGCAGGCTTTGGAT

>NZ_CP014141|1|1|826521-826619|CRISPRCasFinder
CACCTCCTGGCGGAGGCTCGCCAT	CTCCTGCCGCAGGCTTTGGATTTCCCCGCGCAGCTCGGTGGTCTCCGCCTT
CATCTCCTGCCGCAGGCTTTGGAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP014141.1\|WP_038035109.1\|831289_831661_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	unknown	unknown	gnl\|CDD\|227302
NZ_CP014141.1\|WP_008631329.1\|817677_818412_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|187625
NZ_CP014141.1\|WP_060384349.1\|833933_835622_+\|biosynthetic-type-acetolactate-synthase-large-subunit	unknown	unknown	gnl\|CDD\|272915
NZ_CP014141.1\|WP_008631303.1\|830582_831293_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	unknown	unknown	gnl\|CDD\|236714
NZ_CP014141.1\|WP_060384348.1\|832797_833778_+\|YpdA-family-putative-bacillithiol-disulfide-reductase	unknown	unknown	gnl\|CDD\|188533
NZ_CP014141.1\|WP_008631307.1\|828432_828807_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	unknown	unknown	gnl\|CDD\|226912
NZ_CP014141.1\|WP_060384345.1\|825140_825503_-\|DUF86-domain-containing-protein	unknown	unknown	gnl\|CDD\|225236
NZ_CP014141.1\|WP_008631300.1\|831647_832115_-\|type-II-transport-protein	unknown	unknown	gnl\|CDD\|378793
NZ_CP014141.1\|WP_060384342.1\|818408_818942_-\|Uma2-family-endonuclease	unknown	unknown	gnl\|CDD\|99749
NZ_CP014141.1\|WP_008631305.1\|829078_830569_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379567
NZ_CP014141.1\|WP_008631320.1\|823874_824531_+\|chromosome-segregation-protein-ScpA	unknown	unknown	gnl\|CDD\|224273
NZ_CP014141.1\|WP_060384343.1\|818938_819478_-\|Uma2-family-endonuclease	unknown	unknown	gnl\|CDD\|99749
NZ_CP014141.1\|WP_008631309.1\|827019_828369_-\|O-antigen-polymerase	unknown	unknown	gnl\|CDD\|377422
NZ_CP014141.1\|WP_060384346.1\|825489_825789_-\|nucleotidyltransferase-family-protein	unknown	unknown	gnl\|CDD\|224583
NZ_CP014141.1\|WP_060384347.1\|832169_832640_-\|type-II-transport-protein	unknown	unknown	gnl\|CDD\|378793
NZ_CP014141.1\|WP_060384344.1\|820520_821126_-\|3-isopropylmalate-dehydratase-small-subunit	unknown	unknown	gnl\|CDD\|179314
NZ_CP014141.1\|WP_060384341.1\|814544_815597_+\|spermidine/putrescine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270308
NZ_CP014141.1\|WP_026234201.1\|825811_826354_-\|Uma2-family-endonuclease	unknown	unknown	gnl\|CDD\|99749
NZ_CP014141.1\|WP_008631333.1\|813768_814548_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224098
NZ_CP014141.1\|WP_141607720.1\|826803_827046_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|240227

Protein	Function_ID	Function_description	E-value
NZ_CP014141.1\|WP_038035109.1\|831289_831661_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	gnl\|CDD\|227302	COG4967, PilV, Tfp pilus assembly protein PilV [Cell motility and secretion / Intracellular trafficking and secretion].	8.92988e-08
NZ_CP014141.1\|WP_008631329.1\|817677_818412_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|187625	cd05367, SPR-like_SDR_c, sepiapterin reductase (SPR)-like, classical (c) SDRs. Human SPR, a member of the SDR family, catalyzes the NADP-dependent reduction of sepiaptern to 7,8-dihydrobiopterin (BH2). In addition to SPRs, this subgroup also contains Bacillus cereus yueD, a benzil reductase, which catalyzes the stereospecific reduction of benzil to (S)-benzoin. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.5146e-44
NZ_CP014141.1\|WP_060384349.1\|833933_835622_+\|biosynthetic-type-acetolactate-synthase-large-subunit	gnl\|CDD\|272915	TIGR00118, Probable_acetolactate_synthase_large_subunit, acetolactate synthase, large subunit, biosynthetic type. Two groups of proteins form acetolactate from two molecules of pyruvate. The type of acetolactate synthase described in this model also catalyzes the formation of acetohydroxybutyrate from pyruvate and 2-oxobutyrate, an early step in the branched chain amino acid biosynthesis; it is therefore also termed acetohydroxyacid synthase. In bacteria, this catalytic chain is associated with a smaller regulatory chain in an alpha2/beta2 heterotetramer. Acetolactate synthase is a thiamine pyrophosphate enzyme. In this type, FAD and Mg++ are also found. Several isozymes of this enzyme are found in E. coli K12, one of which contains a frameshift in the large subunit gene and is not expressed. [Amino acid biosynthesis, Pyruvate family].	0
NZ_CP014141.1\|WP_008631303.1\|830582_831293_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	gnl\|CDD\|236714	PRK10557, PRK10557, prepilin peptidase-dependent protein.	0.000443433
NZ_CP014141.1\|WP_060384348.1\|832797_833778_+\|YpdA-family-putative-bacillithiol-disulfide-reductase	gnl\|CDD\|188533	TIGR04018, thioredoxin_reductase, putative bacillithiol system oxidoreductase, YpdA family. Members of this protein family, including YpdA from Bacillus subtilis, are apparent oxidoreductases present only in species with an active bacillithiol system. They have been suggested actually to be thiol disulfide oxidoreductases (TDOR), although the evidence is incomplete. [Unknown function, Enzymes of unknown specificity].	6.18104e-171
NZ_CP014141.1\|WP_008631307.1\|828432_828807_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	gnl\|CDD\|226912	COG4537, ComGC, Competence protein ComGC [Intracellular trafficking and secretion].	3.83615e-11
NZ_CP014141.1\|WP_060384345.1\|825140_825503_-\|DUF86-domain-containing-protein	gnl\|CDD\|225236	COG2361, COG2361, Uncharacterized conserved protein [Function unknown].	1.11666e-27
NZ_CP014141.1\|WP_008631300.1\|831647_832115_-\|type-II-transport-protein	gnl\|CDD\|378793	pfam12019, GspH, Type II transport protein GspH. GspH is involved in bacterial type II export systems. Like all pilins, GspH has an N-terminus alpha helix. This helix is followed by nine beta strands forming two beta sheets, one of five antiparallel strands and one of four antiparallel strands. GspH is a minor pseudopilin; it is expressed much less than other pseudopilins in the type II secretion pilus (major pilins). The function and localization of minor pseudo-pilins are still to be fully unraveled. It has been suggested that some minor pseudopilins may assemble either into the base or the tip of pili, or both. They function as initiators or regulators of pilus biogenesis and dynamics, and/or as adaptors between various pseudopilin component and other members of the T2SS.	9.55763e-11
NZ_CP014141.1\|WP_060384342.1\|818408_818942_-\|Uma2-family-endonuclease	gnl\|CDD\|99749	cd06260, DUF820, Domain of unknown function (DUF820). This family consists of hypothetical proteins that are greatly expanded in cyanobacteria. The proteins are found sporadically in other bacteria. They have been predicted to belong to the PD-(D/E)xK superfamily of nucleases.	4.125e-33
NZ_CP014141.1\|WP_008631305.1\|829078_830569_-\|hypothetical-protein	gnl\|CDD\|379567	pfam14341, PilX_N, PilX N-terminal. This domain is found at the N-terminus of the PilX prepilin-like proteins which are involved in type 4 fimbrial biogenesis.	0.000102788
NZ_CP014141.1\|WP_008631320.1\|823874_824531_+\|chromosome-segregation-protein-ScpA	gnl\|CDD\|224273	COG1354, scpA, Rec8/ScpA/Scc1-like protein (kleisin family) [Replication, recombination, and repair].	6.17525e-09
NZ_CP014141.1\|WP_060384343.1\|818938_819478_-\|Uma2-family-endonuclease	gnl\|CDD\|99749	cd06260, DUF820, Domain of unknown function (DUF820). This family consists of hypothetical proteins that are greatly expanded in cyanobacteria. The proteins are found sporadically in other bacteria. They have been predicted to belong to the PD-(D/E)xK superfamily of nucleases.	3.00231e-29
NZ_CP014141.1\|WP_008631309.1\|827019_828369_-\|O-antigen-polymerase	gnl\|CDD\|377422	pfam04932, Wzy_C, O-Antigen ligase. This group of bacterial proteins is involved in the synthesis of O-antigen, a lipopolysaccharide found in the outer membrane in gram-negative bacteria. This family includes O-antigen ligases such as E. coli RfaL.	8.51684e-05
NZ_CP014141.1\|WP_060384346.1\|825489_825789_-\|nucleotidyltransferase-family-protein	gnl\|CDD\|224583	COG1669, COG1669, Predicted nucleotidyltransferases [General function prediction only].	2.93146e-29
NZ_CP014141.1\|WP_060384347.1\|832169_832640_-\|type-II-transport-protein	gnl\|CDD\|378793	pfam12019, GspH, Type II transport protein GspH. GspH is involved in bacterial type II export systems. Like all pilins, GspH has an N-terminus alpha helix. This helix is followed by nine beta strands forming two beta sheets, one of five antiparallel strands and one of four antiparallel strands. GspH is a minor pseudopilin; it is expressed much less than other pseudopilins in the type II secretion pilus (major pilins). The function and localization of minor pseudo-pilins are still to be fully unraveled. It has been suggested that some minor pseudopilins may assemble either into the base or the tip of pili, or both. They function as initiators or regulators of pilus biogenesis and dynamics, and/or as adaptors between various pseudopilin component and other members of the T2SS.	2.65782e-11
NZ_CP014141.1\|WP_060384344.1\|820520_821126_-\|3-isopropylmalate-dehydratase-small-subunit	gnl\|CDD\|179314	PRK01641, leuD, 3-isopropylmalate dehydratase small subunit.	2.74794e-95
NZ_CP014141.1\|WP_060384341.1\|814544_815597_+\|spermidine/putrescine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270308	cd13590, PBP2_PotD_PotF_like, The periplasmic-binding component of ABC transporters involved in uptake of polyamines; possess the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding domain that functions as the primary high-affinity receptors of ABC-type polyamine transport systems. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.54654e-132
NZ_CP014141.1\|WP_026234201.1\|825811_826354_-\|Uma2-family-endonuclease	gnl\|CDD\|99749	cd06260, DUF820, Domain of unknown function (DUF820). This family consists of hypothetical proteins that are greatly expanded in cyanobacteria. The proteins are found sporadically in other bacteria. They have been predicted to belong to the PD-(D/E)xK superfamily of nucleases.	2.05063e-33
NZ_CP014141.1\|WP_008631333.1\|813768_814548_+\|ABC-transporter-permease	gnl\|CDD\|224098	COG1177, PotC, ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism].	8.433e-83
NZ_CP014141.1\|WP_141607720.1\|826803_827046_+\|hypothetical-protein	gnl\|CDD\|240227	PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional.	0.00222391

>NZ_CP014141.1|WP_026234201.1|825811_826354_-|Uma2-family-endonuclease
MGAAKQVRPLTLEEYLALEREAPVKHELVEGFPHAMAGASDRHNRVVVNLVLALGPLARKRGCRLYASGMRLKVDAATVYYPDLMVVCQEDPGEYYKEKPCLVIEVLSDSTEATDRREKLRKYLSLPTLQAYLLLDSRTPRAFGYYREGEGWVYREAEAGTLPLPCLGGHLDLAEVYQGL
>NZ_CP014141.1|WP_060384346.1|825489_825789_-|nucleotidyltransferase-family-protein
MALPTPVSPQALAELCQRYGVRRLLLFGSFARGEADEKSDVDLLVEFFPGRTPGLGFARLQEELTRLFGRRVDLHTLGSLSPYLREEVLREARPIHEAA
>NZ_CP014141.1|WP_060384345.1|825140_825503_-|DUF86-domain-containing-protein
MRRRSLSDRIRLLHMRDACRRALEIARGKDLRSLAPEEETSLALVRLLEILGEAARGISEDFRRLHPEIPWREIVATRNLLIHEYFGVDMEVVATILEQDLPPLLERLEALLATLDQPGR
>NZ_CP014141.1|WP_008631320.1|823874_824531_+|chromosome-segregation-protein-ScpA
MIHLEFPGFSGPPEALREALRRGRLSPRALPVLLIVEQALAQVPEDLQAKSELLPLLAELLVLKLSPEKALTPKEEGEEVPLVQALLDLSETVAFLEARLERRARLLPVAPPPLPRPALRLSPKSLAEAAKGFRRAVLRLPREAFGVREAWERLKGAIRGRVAFQSLPLATWGEKAVGFAALLEAARLGRVRLFQEAPFAPLYVEPVGLLEGDLERTA
>NZ_CP014141.1|WP_060384344.1|820520_821126_-|3-isopropylmalate-dehydratase-small-subunit
MLEKFTVIRGRAVPLRGEDIDTDRILPARFMKVLTFEGLGQYLFYDERFDEKGNPKPHPLNDPRYRGATILLVESGFGSGSSREHAPQAIKRAGFKAIIGESFAEIFFGNATAIGLPCVSLAPEDLGVLFRSVEENPELEVEIDLVNKEVRFGDRTAPLSIREEAREALVEGLWDPIGELLEAGALLDEFDRKLPYPRRAE
>NZ_CP014141.1|WP_060384343.1|818938_819478_-|Uma2-family-endonuclease
MIRHRFSAEDFHRMAEAGILGEDDRVELIRGEVVELSPVGKRHMAALKRLMNALFPLQQAKKALLQVQDPLRLFPDTEPQPDLALLAYRDDFYRERVPEAKDALLVVEVAETSLDHDLQVKLPLYAQAGIPEVWVVDLVREKVHVFRKPQGEGYGEAQALEDGEVSVLGLKVPVKEVLP
>NZ_CP014141.1|WP_060384342.1|818408_818942_-|Uma2-family-endonuclease
MTRHKISLEEFHRMVEAGVFPEDLRLELVEGDLVEMSPIGKRHAAKVAKLTALFGPLVPQKAILFVQSPLVVGESELYPDLALLKPRPDFYEEELPQGRDALLVVEVAESSLRYDLQVKLPLYAQAGVPEVWVVDLEGKRVLVHRKPEGGGYREAEALGPGARLSFHGVEIPAEELL
>NZ_CP014141.1|WP_008631329.1|817677_818412_-|SDR-family-NAD(P)-dependent-oxidoreductase
MRKTLILTGASRGIGKALALELAKEGFDLVLNARKEASLRAVAEEVQALGARAVYVAGSAGKAEVAHALVERAEALGNFAGYIHNAGVLHPGPLLFELAEELFLEVLEANLIAGYQLARFAYPVLRRKGEGLAVYVGSGAAESNLPGIGAYAVAKAAEEHLARQLAAEAPEVACFVYRPGVVETEMQRQAREAQGSAAAVLHRVFRSYKEEGLLLTPEEAARALVRLLPKARAFHGKIATWRDA
>NZ_CP014141.1|WP_060384341.1|814544_815597_+|spermidine/putrescine-ABC-transporter-substrate-binding-protein
MRRIGILFILVALVLLGVFLFRPKGQGADTLYFLNWADFIPEELIQKFEAETGAKVVLDTFESPEAMLAKLKAGADQEFSLVVAPDYYVLQMARDDLIAPLDKGKLKNLSNLDPFFLDPPYDPGLQYSIPYLWGTTGIAYREDLVTGPVDSYAVLFDPEAQVGPFLLLDEMRETIGAALKYLGYSVNTTDPEALAKAKELLIAAKRRSVGFAGGVEALNRILAGDAALSLAYSGDVLQAREEDQRLRYTLAKEGGTLWTDAMVVLKRGPAQELAYRFMDFLLEPENAAALAEYTHYATPVAKAIPLLPEEMRNDPVVFPPEEVRSRLEYLKDLGPDIVLYDQIWTEVKAH
>NZ_CP014141.1|WP_008631333.1|813768_814548_+|ABC-transporter-permease
MRRLLSFHALLVYLFLYLPILVIVALSFNESRRGVHFTGFTLKWYQGLFQDPRVLEYFLNTLTVALVSTLVSTVLGTLLALGLVRYRFPGKGFLRYLLYVPVVMPDVVMGISLLLLFAFSRELLGFPRLSLLTVILGHITFQVAFVTLVVRSRLLLLDPALEEAARDLGARGFQTFFHVTLPLAWPGVAAGALLALTLSLDDFVVTFFTAGPGATTLPLYIYSSVKLGVSPKVHALSTLIIGLSAFFLALGYALTRRKV
>NZ_CP014141.1|WP_141607720.1|826803_827046_+|hypothetical-protein
MVIALKVAQVGGGGWGRGAPHRGPEGPGSAPPGRPPWPGPPHGLRSTWASRFWAGCSAGPGGYSVWAMAPVWSAVVRRLA
>NZ_CP014141.1|WP_008631309.1|827019_828369_-|O-antigen-polymerase
MLGFLAFLSLALINPLGTPRAGIWTEPKTWALVLWTAATWVYLLPLLPRARPRVRPLWPFLLGFAVFLAAGAHAALRSPFPFRAWFGQSTMGDGFAYWVTVGALALGTALLLHFRPGLYRSQLYAVLAAGAVQALSVLPQALWDWRLDYTATLGQTYPGGDPLLSTIWRGQMPIGLTSHRGHVAAVLAMAGVLAAATYLRRRSKAFLGLFAFLSFALWFTYTRGAYLALLGGLAALYPWHRDGRAWLGVFAALLASYGAFLGARTLDLAAVDRAMPALTLEDPDAFSSGRLRFWTLSLEAIARNPWGYGFDGFGLAFPFVADFSGKERRYLQADAPPPVEVVEVGDYGFRYRDQEGKEHWGALASNKAHNLLLDLLLSVGPFGALGYLAAFLSLLWLATKGSEPGLAALGVAYLVYGLTWFECAQFSHLAWWALAAGAGLYLRKAADDR
>NZ_CP014141.1|WP_008631307.1|828432_828807_-|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein
MRNAKGFTLIELLIVIVIIAILAAVLIPNLLNARKRANDTAAVAYTRNVATEIEATRDPATGQVTATTCPTSVTKPAVVQNCTVTTTDNNNNFRVTVTYSGGSKTTVTYDSSTGQLTFGSGSGS
>NZ_CP014141.1|WP_008631305.1|829078_830569_-|hypothetical-protein
MNAKGIALVVALVGMMAVLAFSLAMVQSALGNLKTGGDLLNRAQARQRAEAGVDHALAYLHGKTALSAPQTLPGQGYQVSLTPQGAQGNEIRVESQGQMGLARHTAVAVVRLQSVPTQAQNPLFGQGWISGGRITINGGVDLWGSRLHADQGYANLSGQIRVCDEDGSNCRGINQVNPPPITGGQGVTGTQCNASGNNRVVCNGSTPRYQVCPVYQTPSDPNLTCLDAVTGRAVRWDQATRIQRPDVDAISQGSLGVRVTSPFQDAQTKGFCQYTLTSLDPGQAGELLAFLTSKGITPNTSNVNALLAQALPLFSGSRVCVQGNVTLPNNTTLRDVTFYVGGTFQVNGAATLERVKVAAQGGLNLGNVQATDSKFFANGTVNLNNDATFKGDSTLASRQSLNFNGGADLLNNRALLVVSEGDITFNGRADTHAFMWAGGTITFNGTGAFIGGAVSLGGTIRNGGGQFYIQNSNALNSDLPNTETGTRPRPVVLSRR
>NZ_CP014141.1|WP_008631303.1|830582_831293_-|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein
MRRHGFSLLELLLASALLGSLFLVVLALENSSAILRERERARGRLADELSLTALALARELYTVGYRLTGQALVLSPSPEGDGLTGWFLCEAGMEEVCGESLGQVRGTGYGVSQGVFRWGACTGEGCTPSPTNPVLGGDEIRVEAFRVAYLEGGTWRRQAQAVNLRAEGATPKVSALALYLLASIPVRGGAPAFTPGSTLDYPPGLSPGLLALPPAAGDGRLRAEKLWLVQTPNLAH
>NZ_CP014141.1|WP_038035109.1|831289_831661_-|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein
MGARKGFTLLEVLLALGLLAVVVLAFASLQVTSLRGGRQGRELQAVVREMENFMERLRQDPQGVPTLCNGALTLGGRQGTCTAVPCGVAQDGGLTCPTSGDARAFQVVLEVEGKRLETVVYRP
>NZ_CP014141.1|WP_008631300.1|831647_832115_-|type-II-transport-protein
MAPWVRHGLSLLELLVVLAVLGILGSLAYTNYSTAYRLRAAGAELRTFLLAARTEAIRRGTGVAVVPEGRGLLSCVDENRNRACDAREAVLRRFDPGGYGAALDLRSGFSPGLRFNALGRPNTGARLALRLGGRTLTLCVGMGGRAREVSGDGCP
>NZ_CP014141.1|WP_060384347.1|832169_832640_-|type-II-transport-protein
MTRRGLTLLELLLVLGILGVLLGLALPLLSPNRLALDQAARSLAAQVTRARLEAIRRNTFVGLQVFTEGAGGYLLFVDQNANRRYDPGEEFGATRFGQGDWARVRLDPEKSALGNMPLLFDPRGIPAKPITATLVLTSGGATRKVVISQQGRARLE
>NZ_CP014141.1|WP_060384348.1|832797_833778_+|YpdA-family-putative-bacillithiol-disulfide-reductase
MVDVLVVGAGPVGLCAALWAKRLGLSHLVLERGTVAETVFRFPRDMVFFSEAKNIEIGGHPLVAQGPKPTRKEALLYYQRVAEREGLSVLTYTEVLSIRGREGAFQVLARDRKGERAFSARYVVVATGYFGNPNRLGVPGEELPHVFHRYEEAAPFFGREVAVVGGSNSAVEAALDLYRGGAKVTLVHRGKWVRPSVKYWLLPDFENRVKEGSIRAVMEARVEAITPEGLWLRRPEGREFLPADFVLVLIGYRAEDRLLREAGVAYEGERPWLSPEWETSVPGLFAVGSCAYGPDTRSVFIENGREHARAALTAIAARVRGLTPRP
>NZ_CP014141.1|WP_060384349.1|833933_835622_+|biosynthetic-type-acetolactate-synthase-large-subunit
MKGAEALLRALEREGVEVIFGHPGGAIMPTYDALYDSPIRHILVRHEQGGVHAATAYARASGRVGVVMATSGPGALNLVTGLADAMMDSTPVVAITGNVPRALIGTDAFQEADVTGVTMPITKHNYLVQDVNEIPRVVKEAFHIAATGRPGPVLIDIPKDVQLAEFTGSFDVRLDLPGYKPTLKGHPKQIERALDALEKAERPVLMVGGGAQHAHAELLAFAEKTGLPVITTLMGLGAFPGNHPLWLGMPGMHGTVAANRAIHHADVILAIGLRFDDRVTGKVSRFAPHAHTIIHVDIDPAEIGKLVRTHIPIVGDSRLVLKELLKGAKALRLAAWWRELEEWRTRYPLRYKPRPHLQSQEVIRAFHEATGGHAIVTTGVGQHQMFAAQFFPVTRPRSFLTSGGLGTMGVGLPFAIGAKIARPEELVIDFDGDGSFQMTLQELATVVKYKLDVKIVILNNGYLGMVRQWQDLFHAKRYSEVYLADSNPDFARLAEAYGIKGVRVERKEDLMKGVEAVLNADGPVVAEFKVYHEEGVFPMIPAGGAAEDMILEPPEEKEEVGA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

94062 : 147850

Streptococcus_phage(27.27%)

tRNA,holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008630830.1\|94062_95187_-\|transposase	transposase	NA	NA	NA	NA
WP_008630830.1\|95351_96476_-\|transposase	transposase	NA	NA	NA	NA
WP_082709610.1\|98290_99256_+	hypothetical protein	NA	NA	NA	NA
WP_060384009.1\|99793_100498_-	hypothetical protein	NA	NA	NA	NA
WP_038035684.1\|100506_101733_-	YvcK family protein	A1IMD5	Streptococcus_phage	2.1e-34	34.2
WP_008634076.1\|102541_103459_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	2.0e-13	29.5
WP_014628849.1\|103455_104034_-	peptide deformylase	E3SLL2	Synechococcus_phage	1.8e-15	37.6
WP_060384010.1\|105567_106713_-	phosphopentomutase	NA	NA	NA	NA
WP_008634066.1\|106972_107944_-	cell division protein ZapE	NA	NA	NA	NA
WP_008634062.1\|109008_109599_+	cysteine hydrolase	A0A2K9L6K4	Tupanvirus	1.2e-16	35.6
WP_008634060.1\|109591_110149_+	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
WP_011174019.1\|110124_110721_+	hypothetical protein	NA	NA	NA	NA
WP_008634057.1\|110710_111514_+	histidinol-phosphatase	NA	NA	NA	NA
WP_014628840.1\|111489_111756_-	hypothetical protein	NA	NA	NA	NA
WP_008634053.1\|112478_112811_-	DUF190 domain-containing protein	NA	NA	NA	NA
WP_008634050.1\|113212_113686_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.4e-23	41.1
WP_060384011.1\|113672_114077_-	DUF4395 family protein	NA	NA	NA	NA
WP_008634046.1\|114165_114933_-	SAM-dependent chlorinase/fluorinase	NA	NA	NA	NA
WP_060384012.1\|116419_117112_+	hypothetical protein	NA	NA	NA	NA
WP_008634036.1\|119986_120382_-	transcriptional repressor	NA	NA	NA	NA
WP_060384013.1\|121386_121836_-	peptidylprolyl isomerase	NA	NA	NA	NA
WP_060384014.1\|121944_122859_+	cysteine synthase A	A0A1X9I5F1	Streptococcus_phage	7.5e-77	49.7
WP_014628830.1\|122871_123219_+\|holin	phage holin family protein	NA	NA	NA	NA
WP_060384015.1\|123215_123647_-	CBS domain-containing protein	A0A2I6B2H4	Macacine_betaherpesvirus	1.1e-06	28.3
WP_060384016.1\|123690_124497_-	universal stress protein	NA	NA	NA	NA
WP_060384017.1\|124493_125630_-	MFS transporter	NA	NA	NA	NA
WP_060384018.1\|125851_127675_+	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_060384019.1\|127730_129305_+	alpha-D-glucose phosphate-specific phosphoglucomutase	A0A1X9I671	Streptococcus_phage	8.8e-17	26.6
WP_060384020.1\|129319_130162_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_060384021.1\|130158_131034_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_008634018.1\|131084_132374_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_008630619.1\|132457_133147_-\|transposase	IS5-like element ISTth7 family transposase	NA	NA	NA	NA
WP_008634012.1\|133570_133777_+	cold-shock protein	Q9AZD3	Lactococcus_phage	4.8e-16	63.2
WP_060384022.1\|133833_134589_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.7e-42	40.7
WP_060384023.1\|134585_135311_+	peptidoglycan editing factor PgeF	NA	NA	NA	NA
WP_060384024.1\|138506_139592_+	type IV pilus twitching motility protein PilT	NA	NA	NA	NA
WP_060384025.1\|139602_141012_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_008634005.1\|141017_142019_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	1.2e-48	36.7
WP_008634004.1\|142015_142648_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_038035673.1\|146020_146536_-	hypothetical protein	NA	NA	NA	NA
WP_014629763.1\|146556_147111_-\|transposase	DDE transposase family protein	NA	NA	NA	NA
WP_008630619.1\|147160_147850_-\|transposase	IS5-like element ISTth7 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

1050758 : 1106032

Staphylococcus_phage(33.33%)

integrase,transposase

attL 1030065:1030084|attR 1069267:1069286

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1030065:1030084	attL	NA	NA	NA	NA
WP_060384463.1\|1050758_1051700_+\|integrase	tyrosine-type recombinase/integrase	W8EHC2	Mycobacterium_phage	3.1e-09	30.3
WP_014510310.1\|1051807_1052392_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_060384464.1\|1052378_1053350_+	1,2-phenylacetyl-CoA epoxidase subunit A	NA	NA	NA	NA
WP_060384465.1\|1053359_1053875_+	phenylacetic acid degradation protein	NA	NA	NA	NA
WP_060384466.1\|1054606_1055062_+	phenylacetate-CoA oxygenase subunit PaaJ	NA	NA	NA	NA
WP_060384467.1\|1058334_1059087_+	LamB/YcsF family protein	NA	NA	NA	NA
WP_008632378.1\|1061738_1062224_-	thiol reductase thioredoxin	NA	NA	NA	NA
WP_156423365.1\|1063665_1063833_-	hypothetical protein	NA	NA	NA	NA
WP_060384468.1\|1064005_1064428_-	thioesterase family protein	NA	NA	NA	NA
WP_060384469.1\|1064430_1065765_-	phenylacetate--CoA ligase	NA	NA	NA	NA
WP_060384835.1\|1065721_1066111_-	hydroxyphenylacetyl-CoA thioesterase PaaI	NA	NA	NA	NA
WP_060384472.1\|1068598_1069576_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
1069267:1069286	attR	NA	NA	NA	NA
WP_060384473.1\|1070880_1071840_-	3,4-dihydroxyphenylacetate 2,3-dioxygenase	NA	NA	NA	NA
WP_060384474.1\|1071827_1072277_-	flavin reductase	NA	NA	NA	NA
WP_060384475.1\|1072273_1073725_-	4-hydroxyphenylacetate 3-monooxygenase, oxygenase component	NA	NA	NA	NA
WP_060384476.1\|1073688_1075284_-	5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase	NA	NA	NA	NA
WP_060384477.1\|1075280_1076021_-	2-hydroxyhepta-2,4-diene-1,7-dioate isomerase	NA	NA	NA	NA
WP_060384478.1\|1076017_1076917_-	2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase	NA	NA	NA	NA
WP_060384479.1\|1080453_1081218_-	hypothetical protein	NA	NA	NA	NA
WP_060384480.1\|1083285_1084128_+	DegV family protein	A0A0N9SI50	Staphylococcus_phage	4.1e-13	33.3
WP_060384481.1\|1084102_1084954_+	DegV family protein	NA	NA	NA	NA
WP_060384482.1\|1085488_1086526_+	fatty acid desaturase	A0A1V0SAL5	Catovirus	5.0e-29	28.3
WP_060384483.1\|1086533_1087286_+	triose-phosphate isomerase	NA	NA	NA	NA
WP_008632333.1\|1087282_1087678_-	PIN domain-containing protein	NA	NA	NA	NA
WP_008632330.1\|1087674_1087899_-	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_008632327.1\|1088027_1089158_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A068A1P5	Thermus_phage	8.7e-152	70.5
WP_019550163.1\|1089150_1089567_-\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	2.2e-23	41.1
WP_060384484.1\|1089729_1091193_+	hypothetical protein	NA	NA	NA	NA
WP_008632324.1\|1091516_1091720_+	hypothetical protein	NA	NA	NA	NA
WP_081481460.1\|1092862_1094014_+	hypothetical protein	NA	NA	NA	NA
WP_008632315.1\|1095382_1096507_+\|transposase	transposase	NA	NA	NA	NA
WP_008632309.1\|1096554_1096818_+	hypothetical protein	NA	NA	NA	NA
WP_038035326.1\|1097065_1098025_+	hypothetical protein	NA	NA	NA	NA
WP_060384485.1\|1099020_1099932_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	5.6e-24	33.5
WP_015716433.1\|1103762_1104278_-	hypothetical protein	NA	NA	NA	NA
WP_014629763.1\|1104298_1104853_-\|transposase	DDE transposase family protein	NA	NA	NA	NA
WP_082367395.1\|1104907_1106032_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_3

1752672 : 1774840

Thermus_virus(90.62%)

integrase

attL 1752610:1752654|attR 1771796:1771840

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1752610:1752654	attL	NA	NA	NA	NA
WP_141607718.1\|1752672_1753722_-\|integrase	tyrosine-type recombinase/integrase	Q859R3	Thermus_virus	1.7e-197	95.4
WP_038035068.1\|1753887_1754781_-	restriction endonuclease	Q859R2	Thermus_virus	1.9e-170	98.0
WP_081481418.1\|1754858_1755572_-	helix-turn-helix domain-containing protein	Q859R0	Thermus_virus	5.0e-105	85.6
WP_008630989.1\|1755636_1755840_+	helix-turn-helix domain-containing protein	B3XVT0	Thermus_virus	4.0e-07	61.7
WP_167345971.1\|1755836_1756013_+	hypothetical protein	B3XVT1	Thermus_virus	2.0e-18	96.6
WP_008630979.1\|1756126_1756351_+	helix-turn-helix domain-containing protein	Q859Q8	Thermus_virus	1.1e-34	95.9
WP_008630977.1\|1756347_1756791_+	hypothetical protein	Q859Q7	Thermus_virus	2.1e-48	100.0
WP_008630973.1\|1757035_1758262_+	hypothetical protein	Q859U0	Thermus_virus	1.9e-197	91.0
WP_038034990.1\|1758251_1758611_+	hypothetical protein	Q859T8	Thermus_virus	6.1e-43	76.3
WP_060384765.1\|1758594_1759602_+	phosphoadenosine phosphosulfate reductase family protein	R9TRT5	Rhizobium_phage	1.0e-34	32.1
WP_038034987.1\|1759684_1759966_+	hypothetical protein	Q859T6	Thermus_virus	2.5e-44	98.9
WP_008630963.1\|1760674_1761076_+	hypothetical protein	Q859T4	Thermus_virus	5.1e-14	66.3
WP_050927489.1\|1760987_1761509_+	hypothetical protein	Q859T3	Thermus_virus	5.0e-70	92.9
WP_008630959.1\|1761486_1762020_+	N-acetylmuramoyl-L-alanine amidase	C8CHK8	Thermus_virus	1.4e-75	82.2
WP_156423376.1\|1762007_1762160_+	hypothetical protein	Q859T1	Thermus_virus	2.8e-13	76.6
WP_008630955.1\|1762159_1762348_+	hypothetical protein	B3XVS9	Thermus_virus	3.7e-15	88.6
WP_008630953.1\|1762348_1763029_+	AAA family ATPase	Q859T0	Thermus_virus	1.3e-123	96.0
WP_008630952.1\|1763163_1763580_+	hypothetical protein	Q859S9	Thermus_virus	1.4e-67	94.2
WP_008630950.1\|1763591_1764107_+	hypothetical protein	Q859S8	Thermus_virus	5.1e-91	95.3
WP_008630948.1\|1764115_1764991_+	hypothetical protein	Q859S7	Thermus_virus	1.4e-144	93.8
WP_050927501.1\|1765068_1765398_+	hypothetical protein	Q859S6	Thermus_virus	4.6e-13	63.4
WP_038035056.1\|1765400_1765655_+	hypothetical protein	Q859S5	Thermus_virus	8.3e-10	97.0
WP_038035053.1\|1765651_1766302_+	hypothetical protein	Q859S4	Thermus_virus	2.7e-81	90.8
WP_008630941.1\|1766301_1766526_+	hypothetical protein	Q859S3	Thermus_virus	2.2e-27	100.0
WP_038034985.1\|1766515_1766818_+	hypothetical protein	Q859S2	Thermus_virus	5.5e-37	91.0
WP_038035049.1\|1767056_1767485_+	hypothetical protein	C8CHM2	Thermus_virus	4.6e-37	63.4
WP_008630936.1\|1767774_1768227_+	hypothetical protein	Q859S0	Thermus_virus	2.8e-77	98.7
WP_038035048.1\|1768373_1769396_+	hypothetical protein	C8CHM6	Thermus_virus	2.5e-105	79.9
WP_008630934.1\|1769405_1770512_+	hypothetical protein	C8CHM7	Thermus_virus	1.1e-74	45.2
WP_038035044.1\|1770959_1771460_+	transglycosylase SLT domain-containing protein	Q859R5	Thermus_virus	1.4e-85	93.3
WP_008630931.1\|1771456_1771729_+	hypothetical protein	NA	NA	NA	NA
WP_060384768.1\|1771913_1772801_-	acyltransferase	M1HKK6	Paramecium_bursaria_Chlorella_virus	2.5e-05	32.1
1771796:1771840	attR	NA	NA	NA	NA
WP_008630929.1\|1772845_1773751_-	GTPase Era	NA	NA	NA	NA
WP_060384769.1\|1773835_1774840_+	DNA-protecting protein DprA	S6BFL3	Thermus_phage	9.2e-20	33.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP014142

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP014141

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection