CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_AP014628	Pseudomonas sp. St29	4 crisprs	DinG,csa3,cas3,PD-DExK,DEDDh,WYL,RT	0	0	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_AP014628_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_AP014628_1

2799376-2799467

Orphan

Consensus_repeat	Method
CGTAGGAGCTGGCTTGCCAGCGAAGCGGCCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_AP014628_1

>merge|NZ_AP014628|1|2799376-2799467|CRISPRCasFinder
CGTAGGAGCTGGCTTGCCAGCGAAGCGGCCCCTACCTCGGGTGCAACTGTTACCGCTATTGCGTAGGAGCTGGCTTGCCAGCGAAGAGGCCC

>NZ_AP014628|1|1|2799376-2799467|CRISPRCasFinder
CGTAGGAGCTGGCTTGCCAGCGAAGCGGCCC	CTACCTCGGGTGCAACTGTTACCGCTATTG
CGTAGGAGCTGGCTTGCCAGCGAAGAGGCCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_AP014628.1\|WP_060843281.1\|2806113_2806488_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014628.1\|WP_060843277.1\|2802221_2803157_-\|phytanoyl-CoA-dioxygenase-family-protein	unknown	unknown	unknown
NZ_AP014628.1\|WP_060843280.1\|2805450_2806083_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_AP014628.1\|WP_060838803.1\|2801321_2802215_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_AP014628.1\|WP_060843279.1\|2803792_2805340_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_AP014628.1\|WP_060843273.1\|2794280_2795720_+\|M10-family-metallopeptidase	unknown	unknown	gnl\|CDD\|369942
NZ_AP014628.1\|WP_148659688.1\|2788823_2789168_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014628.1\|WP_041117563.1\|2790065_2790395_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014628.1\|WP_060843276.1\|2799541_2801188_-\|GMC-family-oxidoreductase-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|235000
NZ_AP014628.1\|WP_060843274.1\|2796606_2797356_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226728
NZ_AP014628.1\|WP_016968706.1\|2793702_2793999_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014628.1\|WP_060838808.1\|2807925_2808588_-\|response-regulator	unknown	unknown	gnl\|CDD\|182612
NZ_AP014628.1\|WP_060843282.1\|2806516_2807929_-\|sensor-histidine-kinase-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|182388
NZ_AP014628.1\|WP_060843271.1\|2790964_2793325_+\|DNA-polymerase-II	unknown	unknown	gnl\|CDD\|235595
NZ_AP014628.1\|WP_060843278.1\|2803275_2803695_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014628.1\|WP_060843269.1\|2788435_2788750_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|294006
NZ_AP014628.1\|WP_129405577.1\|2795849_2796452_+\|SUKH-3-domain-containing-protein	unknown	unknown	gnl\|CDD\|379608
NZ_AP014628.1\|WP_060843272.1\|2793331_2793661_-\|DHCW-motif-cupin-fold-protein	unknown	unknown	gnl\|CDD\|380395
NZ_AP014628.1\|WP_060838809.1\|2808610_2809255_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|131573
NZ_AP014628.1\|WP_060843275.1\|2797642_2799265_-\|MHS-family-MFS-transporter	unknown	unknown	gnl\|CDD\|340927

Protein	Function_ID	Function_description	E-value
NZ_AP014628.1\|WP_060843282.1\|2806516_2807929_-\|sensor-histidine-kinase-N-terminal-domain-containing-protein	gnl\|CDD\|182388	PRK10337, PRK10337, sensor protein QseC; Provisional.	2.43475e-62
NZ_AP014628.1\|WP_060843280.1\|2805450_2806083_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.39325e-20
NZ_AP014628.1\|WP_060843271.1\|2790964_2793325_+\|DNA-polymerase-II	gnl\|CDD\|235595	PRK05762, PRK05762, DNA polymerase II; Reviewed.	0
NZ_AP014628.1\|WP_060843279.1\|2803792_2805340_-\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	3.82255e-67
NZ_AP014628.1\|WP_060843273.1\|2794280_2795720_+\|M10-family-metallopeptidase	gnl\|CDD\|369942	pfam08548, Peptidase_M10_C, Peptidase M10 serralysin C terminal. Serralysins are peptidases related to mammalian matrix metallopeptidases (MMPs). The peptidase unit is found at the N terminal while this domain at the C terminal forms a corkscrew and is thought to be important for secretion of the protein through the bacterial cell wall. This domain contains the calcium ion binding domain pfam00353.	1.69823e-117
NZ_AP014628.1\|WP_060843276.1\|2799541_2801188_-\|GMC-family-oxidoreductase-N-terminal-domain-containing-protein	gnl\|CDD\|235000	PRK02106, PRK02106, choline dehydrogenase; Validated.	0
NZ_AP014628.1\|WP_060843274.1\|2796606_2797356_-\|hypothetical-protein	gnl\|CDD\|226728	COG4278, COG4278, Uncharacterized conserved protein [Function unknown].	1.70411e-47
NZ_AP014628.1\|WP_060838808.1\|2807925_2808588_-\|response-regulator	gnl\|CDD\|182612	PRK10643, PRK10643, two-component system response regulator PmrA.	4.44038e-84
NZ_AP014628.1\|WP_060838803.1\|2801321_2802215_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	4.632e-37
NZ_AP014628.1\|WP_060843272.1\|2793331_2793661_-\|DHCW-motif-cupin-fold-protein	gnl\|CDD\|380395	cd06990, cupin_DUF861, domain of unknown function DUF 861, cupin domain. This family contains proteins which seem to be specific to bacteria and some fungi. The function of this family is unknown but contains a cupin domain without a metal binding site. Cupins are a functionally diverse superfamily originally discovered based on the highly conserved motif found in germin and germin-like proteins. This conserved motif forms a beta-barrel fold found in all of the cupins, giving rise to the name cupin (cupa is the Latin term for small barrel).	0.00785585
NZ_AP014628.1\|WP_129405577.1\|2795849_2796452_+\|SUKH-3-domain-containing-protein	gnl\|CDD\|379608	pfam14433, SUKH-3, SUKH-3 immunity protein. This family belongs to the SUKH superfamily and functions as immunity proteins in bacterial toxin systems.	1.63911e-12
NZ_AP014628.1\|WP_060843269.1\|2788435_2788750_+\|hypothetical-protein	gnl\|CDD\|294006	cd03707, EFTU_III, Domain III of Elongation Factor (EF) Tu. EF-Tu consists of three structural domains, designated I, II, and III. Domain III adopts a beta barrel structure. Domain III is involved in binding to both charged tRNA and to elongation factor Ts (EF-Ts). EF-Ts is the guanine-nucleotide-exchange factor for EF-Tu. EF-Tu and EF-G participate in the elongation phase during protein biosynthesis on the ribosome. Their functional cycles depend on GTP binding and its hydrolysis. The EF-Tu complexed with GTP and aminoacyl-tRNA delivers tRNA to the ribosome, whereas EF-G stimulates translocation, a process in which tRNA and mRNA movements occur in the ribosome. Crystallographic studies revealed structural similarities ("molecular mimicry") between tertiary structures of EF-G and the EF-Tu-aminoacyl-tRNA ternary complex. Domains III, IV, and V of EF-G mimic the tRNA structure in the EF-Tu ternary complex; domains III, IV and V can be related to the acceptor stem, anticodon helix and T stem of tRNA respectively.	0.00363575
NZ_AP014628.1\|WP_060838809.1\|2808610_2809255_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|131573	TIGR02521, Uncharacterized_protein_HI_0366, type IV pilus biogenesis/stability protein PilW. Members of this family are designated PilF and PilW. This outer membrane protein is required both for pilus stability and for pilus function such as adherence to human cells. Members of this family contain copies of the TPR (tetratricopeptide repeat) domain.	1.38827e-06
NZ_AP014628.1\|WP_060843275.1\|2797642_2799265_-\|MHS-family-MFS-transporter	gnl\|CDD\|340927	cd17369, MFS_ShiA_like, Shikimate transporter and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli shikimate transporter (ShiA), inner membrane metabolite transport protein YhjE, and other putative metabolite transporters. ShiA is involved in the uptake of shikimate, an aromatic compound involved in siderophore biosynthesis. It has been suggested that YhjE may mediate the uptake of osmoprotectants. The ShiA-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	5.16418e-123

>NZ_AP014628.1|WP_060843275.1|2797642_2799265_-|MHS-family-MFS-transporter
MSEHVQPLTPTLQDTTAQGGQKVIFASSLGTVFEWYDFFLYGALAAVISKQFFAGVNDTTAFIFALMAFAAGFVVRPFGALVFGRLGDMIGRKYTFLATIVLMGMATFAVGLLPNYASIGIAAPIILVALRMLQGLALGGEYGGAATYVAEHAPQGKRGLHTSWIQSTATLGLLLSLLVVLACRYFTGDQFEVWGWRLPFLLSIVLLGISTWIRMSLHESPAFLKMKEEGRASKAPIRESFGKWENLKVVLIALFSINAGQAVTFYAAQFYVLFFLTQFLKMDPALANSLLIISVVIGAPMFIFFGWLSDKVGRKPVLMLGLLLATLLYFPIFKALAHYANPAIDQASRQAPISVSADPATCTFQFDPVGKARFDSPCDKVKTFLVKQGLPYSSVAAPAGSPVQVSVGEVKIDGFDEAALRGAVTLAGYPQQADTQNVNKPMVVVLIVALILIAAMCYGPLAALMVELFPTRIRYTSMSLPYHIGNGWFGGFLPTVSFALVVYTGDIFYGLWYPVLITGVSLVVGLLCLRETRDVDINHG
>NZ_AP014628.1|WP_060843274.1|2796606_2797356_-|hypothetical-protein
MLLIFPTVLALALILMLWRRQNALRALRREAHIRNFTLPPRLFEPLRTQHPHLSLKDCQLVAQGLRQFFLAYLKGGQHYVSMPSQVVDDLWHEFILHTRDYQQFCDKAFGQFLHHTPAAVLGQDAARKSDNGLRRVWRLACLEENINPAQPSRLPLLFALDAKLKIARGFHYVADCQSLRRLTDNATTAAVVHCGSELYSSSFDSDSSSSGSDSDGSRFGGDGDSGGSDGGGGDSSGCGGGGCGGGGGD
>NZ_AP014628.1|WP_129405577.1|2795849_2796452_+|SUKH-3-domain-containing-protein
MTRRAADSLPAGAVYRAFAVFLHFDYLRRMNLLTPNIEPFFRDAGWAPGRAVVVDSHVPRAHPAFRILQAFGELTVGHTGAGAECASSDIEFGCPACPDEQVHGWQEALHTHFVCLGDVHHGHAQLWLDSQGRLFSNGLVAPIMLFVGHDFAQGVEALLKGYRLRPMLLPSQEEVMVWGERFRTGDPLVLTPGFFHARAL
>NZ_AP014628.1|WP_060843273.1|2794280_2795720_+|M10-family-metallopeptidase
MSKTLSQINENAIIPGAAASSAYLQVQTFSHLYDRGGSALVNGKPSFTADQAADSILRKGLSWHDQNGDGKIDLTYSFLTEKPANYNPALGSFSEFSALQKAQALLSLQSWSDVANVTFSEAAKGGDGHMTFGNYNVSTGGAAFAYLPSGGSYDGQSWYLINDQYRVNETPGNGNYGRQTLTHEIGHTLGLSHPGVYNAGNGNPTYNDVTYAQDTRGYSLMSYWSEGNTGQNFSKDGSGAYASAPLLDDIVAVQKLYGANLETRADDTVYGFNSNTGRDFYSADSNADKLVFAVWDGGGNDTLDFSGFSQNQKINLNQGGFSDVGGLVGNVSIAHGVTVENAIGGSGNDLLIGNAAANILEGGAGNDILYGGGGGDTLWGGAGADTFVFGAASDSTFDAPDWIMDFASGEDKIDLSGLFASTGATLNFVSGFTGHAGDAILTYFVETNQTSLMIDLTGHGAVDFAVGTVGQAAVTDIIA
>NZ_AP014628.1|WP_016968706.1|2793702_2793999_-|hypothetical-protein
MRKILLLGTLMIFAGAAHAEGIPLFNVSCPGNLAVSADQGGPIYINGKAVKNSAVDDRHFQVKTAEITLAISVEDDDSVTVKYTDKHGASGLCEAVDD
>NZ_AP014628.1|WP_060843272.1|2793331_2793661_-|DHCW-motif-cupin-fold-protein
MHISALPFVTTDWSTIEPTEHRGETGSAFWRTRQFGAIRVRMVEYTPGYLADHWCSKGHILLCLEGELHTELEDGRRFVLTPGMSYQVADNAEPHRSSTARGAKLFVVD
>NZ_AP014628.1|WP_060843271.1|2790964_2793325_+|DNA-polymerase-II
MDVQQGFVLTRHWRDTPAGTEVEFWLATDQGPRRLRLPLQTSVAFIPAVQRPQAERLLADDPDVELRPLQLRDFHQRPVLGLYCPQHNQLMRLDKTLRRAGVEVFEADVRPPERYLMERFITAPVSFGGLPGPDGLLLEAQMKPAPDYRPTLKLVSLDIETSERGELYSIALEGCGQRQVYMLGKAREDDSAVDFDLEFCASREQLLEKLNQWLAEHDPDAIIGWNLVQFDLRVLHEHARRLAVPLRLGRGGEEMQWREHGSRTHYFASAAGRLIIDGIEALRSATWSFPSFSLENVAQTLLGEGKSIDNPYQRMDEINRMFAEDKPALARYNLKDCELVTRIFAKTELLTFLLERATVTGLPADRSGGSVAAFTHLYMPLMHRQGFVAPNLGELPPQASPGGFVMDSRPGFYESVLVLDYKSLYPSIIRSFLIDPVGLVEGLRQPDEQYSVAGFRGARFSRTRHCLPSIVTRVAEGREVAKREHNAPLSQALKIIMNAFYGVLGSSGCRFFDPRLASSITLRGHEIMARTRQLIEAQGHQVIYGDTDSTFVWLGSLHDEEQAALIGRALVAHVNQWWREHLQQEYGLESALELQFETHYKRFLMPTIRGAEEGSKKRYAGLVQRADGRQEMVYKGLETVRTDWSPLAREFQQELYRRIFHRQPYQDYVRDYVHRTLAGQLDDLLIYRKRLRRPLDDYERNVPPHVRAARLADDYNREQGRPLQYQNGGWIRYVITLAGPEPLENRRAAIDYEHYLTRQLQPVADAILPFVQDDFSTLVGGQMGLF
>NZ_AP014628.1|WP_041117563.1|2790065_2790395_-|hypothetical-protein
MNLNNQPTIDELARMFAAQKDSHDSHILWIAKSGQVHIDCLSPHSHEAEFDQNNRELAARLKMYRRGQGYVGKKAAADKDFIGRVLETLKAEWQSLRDKSEVRVIDRFC
>NZ_AP014628.1|WP_148659688.1|2788823_2789168_+|hypothetical-protein
MRDELIGYLRGLSDINYQYRAWVQREASDTFYDELDYAIHFLFDDTGLATDARSWIGLVLLGEAEAQSVEDVVRSINELFLLHGVELEDAEYLATPEWMRIVESSKEALAVFLR
>NZ_AP014628.1|WP_060843269.1|2788435_2788750_+|hypothetical-protein
MNMRTAGFRASISFLSPDSGGRLTMPEGDGYAPYFHTDTLDEGLAVRIIGIPEGASFASLLSVEVELTYHRFLSYGELQLGQGFYLTEGSKRVAEGVIESELRY
>NZ_AP014628.1|WP_060843276.1|2799541_2801188_-|GMC-family-oxidoreductase-N-terminal-domain-containing-protein
MLPAFDAYDYIVVGAGPAGCLLANRLSANPQHRVLLLEAGGRDNYPWIHIPVGYLFCIGNPRTDWCFKTEAEPGLQGRSLSYPRGKVLGGCSSINGMIYMRGQAADYDGWAAAGNPGWSWQDVLPLFKKSENHFAGGSELHGAAGEWRVERQRLSWPILDAFRTAAQQSGIGNIDDFNGGDNEGCGYFQVNQKAGVRWNAAKAFLKPIAQRPNLVVLTGVEVQRLILEDGRATAVHASCQGRLEQFKARREIILCAGAIGSPSILQRSGIGPAPLLQRLGVGVSHALPGVGENLQDHLQLRLIYQLENARTLNQIAGSLWGKMGMGLRYLYDRSGPLSMAPSQLGAFARSGPEQTRANLEYHVQPLSLERFGEPLHSFPAFTASVCDLRPQSRGRVEIRSVDAGAAPLIQPNYLSHPEDLRIAADAIRLTRRIVGAPALQPFKPCEYLPGPQLQTEEQLHEAAARIGTTIFHPVGTCRMGSDAHAVVDAQLRVHGIPGLRIADASIMPRITSGNTCSPTLMIAEKAAELILASVPRSTVQHKQPATPA
>NZ_AP014628.1|WP_060838803.1|2801321_2802215_+|LysR-family-transcriptional-regulator
MFDWNDLRYFLELQRSGRLLTAARRLNTTHATVARHIEAVEKALGTALFVQHAQGYELTPAGEALLKHAEAMENVALLVQEEITQSSAPLGKIRVGVTEGLGVKFLAGRMSALFERYPGLEVELVAVPRFVSILNREAEISIHLERPSADMLVTRKLTDYRLALYASPSYLDRAPPLRSREDLGRHAWIGYVDDLLFSQELMFLNQFCRNPQVVFHSTSVIAQQEAARSGLGIAVLPCYMAAADPQLVPLLPAESIQRAYWISTRRELHKSVRLRVVWDYLMELCAAQQQVLLGPQS
>NZ_AP014628.1|WP_060843277.1|2802221_2803157_-|phytanoyl-CoA-dioxygenase-family-protein
MNLPSVLSENTPLLVNPLRLEQDDLRHFQERGFIKLRQLLTPTAIEHLSELVDSQLRPCRTSAPAHGDGFSRLTHQLGQIGILERLYRQPAFTQVLTRLTGCRLIVSEAQSFELQTGRSGFAWHYDSLNFRYIRPQDPAFSLWLPLQPIRPEQQGGGMAWVPLSRCSAQANFQFSRLLAEKLARGEAIEDFSAHLRQTYCTPGLLTDSFEQQRIEDSFDPGDALLFSKYLWHRSSPLLPGDLQRRQAVSLRLLDWRARLDPLLQEGETRSAGGLGMGREGGPLNPVSYGSRFVDIQPGAPIRSSAHCGPIL
>NZ_AP014628.1|WP_060843278.1|2803275_2803695_-|hypothetical-protein
MNRMSAWLLSLTAVCSAAQATSAVDAARQSLKNYGLAHCLAERFTEPSAMRQDVGHALGMYGVLGAGRYDVQQNEDTLEILHNPYTATTDYVAQAYEQASGSSKYSRDKVVLHACLEVYNSRAFDEFIQTQDRYIRPDG
>NZ_AP014628.1|WP_060843279.1|2803792_2805340_-|MFS-transporter
MLAANAHSSPCGRLFMDRYRRPALVAAAYLGTFLASLDISIVNVALPTLQHTLATGLGGLQWVINAYAICLSACMLSAGPLGDRFGHKRCWLIGVLLFCLGSLLCALAQELALLLAGRAVQGLAGALLIPGAMPILSHAFPEPRQRAHVIGGWSAFSALALILGPLLGGLLLEHLGWQSIFLINLPIGLLALLLGGWGISERKHPQHAALDPLGQVLSMLCLGALTYGLIVAGESGFASRAALASWLLASLALLGLILVERRVQRPLVPLALLRQRPFAVANLASFILGFSCYSSLFFFSIFLQQIQGWSAADSGLRMLPQFAVTGVVSMLFGRLHRRIPLPWLMIGGYGLVGLAMSAMAGFDAHTPYWLVGSLFALLGLGMGLAVPATGLVVMACAPAERAGIASASMNALRQTGMSVGIALLGSLMSARAVQVLSESGAAAGFHGAAELARQAVTEHRLPLHAPLFGELYGAAMTSGFRLAMALAGCASLLAMGLLLLTRQHAARAPVVEACQ
>NZ_AP014628.1|WP_060843280.1|2805450_2806083_+|TetR/AcrR-family-transcriptional-regulator
MSVKSSPVSPPGAAQPRPRTKPAEVRLEELMAAAESLFLSQGVEATTISEIVQRADVAKGTFYHYFPSKNELLVALGQRYTQNYLQRLETAVAACPEDDWVAKVSCWIGTSVQAYLDTYRLHDIVYPNHHHHDRGNPEKSAILTQLLGILDGGQRAGCWSLAQPGVIASLIYAGVHGATDDVIAAGEEDGRALSEAIVQACLRLLGLPVA
>NZ_AP014628.1|WP_060843281.1|2806113_2806488_+|hypothetical-protein
MNRIKLMLGSALAVFLAYQAYGWFYYGTPYQGRNYSPDQAFYYQKYRLFSWRTWIPTMTMPGDGDSSRYSVGGYLRVFKADGTPVGQSYDGCIAVVEVSWYDDAVGGFGCSEHLIALSAKATPD
>NZ_AP014628.1|WP_060843282.1|2806516_2807929_-|sensor-histidine-kinase-N-terminal-domain-containing-protein
MNSIRQRTLTLIIGLLFAGLLILTSFNLHDSNHEIDEVYDAQLAQHARLLLGIMRMPSSSIDQAQLYHAFNLALSQAMPQVDGHPYESKIAFQVWNRKGNLLVRTTSAPVLALQPLAPGFGNEQDGNDHQWRTFTLDDPDSGLRIWVGERVDVRSDLVSRIMRHTLWPNVLGSLLLAVIIWLAIGWGLRPLANMAATLRARPSGSLEPLHLEPLPRELEPMQAALNRMLTQIQELLGRERRFIADAAHELRTPLAVLRVHAQNLLQAGTEQERRASLESLILGVDRAGRLVNQLLTMARLEPKAQVPSEQLIDLAHTVRDSLVQLTPWLLNQGLELSFDVDERAYPIRAEAASIDIALNNLISNAVNFSPANGVINVRLAEVGEHFELSVEDQGPGIDESQRERLFERFYSRGNVNGAGLGLTIVSVIARHLGGRISLDNLPQGGLRATLSIPCHQPLRLGSAWTARREP
>NZ_AP014628.1|WP_060838808.1|2807925_2808588_-|response-regulator
MRLLLIEDDQPLGEGIHQALTREGYTVDWLRDGNSALHALLSETFDLALLDLGLPRLDGLQVLKRLRDSGSTLPVLILTARDATEDRIAGLDAGADDYLIKPFDLDELKARLRALLRRSAGRARVLIEHAGISLDPGTQQVHYHGEPVALTPKEYQLLYELLSPPGRVMTRDRLLQLLYGWNEEAESNTLEVHIHHLRKKFSADLIRTIRGVGYLVEERR
>NZ_AP014628.1|WP_060838809.1|2808610_2809255_-|tetratricopeptide-repeat-protein
MKTLISALLLGCLSLPAWALDAADQQRLNGIQQGWAHIQYQLPAEQRAAAFEQLATQTRAFTQERPALAEAWIWSGIVTSSWAGAQGGLGALSKAKAAKADLELALGLDPKALQGSAYTSLAALYDRVPGWPIGFGDADKAEELLRQALQQNPEGLDSLYFWGDHLYRQGRYGEARVALLKALQAPPRPGREVADQGRREEIRALLAEVGKKIR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_AP014628_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_AP014628_2

3749339-3749431

Orphan

Consensus_repeat	Method
GGGGTACATATCCGTTGCTGCGGGTGCGGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_AP014628_2

>merge|NZ_AP014628|2|3749339-3749431|CRISPRCasFinder
GGGGTACATATCCGTTGCTGCGGGTGCGGCGGCTGGCGGTTTCGCCTTTACGGCGAGGTTTACGGGGTACATATCCGTTGCTGCAGGTGCGGC

>NZ_AP014628|2|2|3749339-3749431|CRISPRCasFinder
GGGGTACATATCCGTTGCTGCGGGTGCGGC	GGCTGGCGGTTTCGCCTTTACGGCGAGGTTTAC
GGGGTACATATCCGTTGCTGCAGGTGCGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_AP014628.1\|WP_060843756.1\|3753339_3754527_-\|type-II-secretion-system-protein-GspL	unknown	unknown	gnl\|CDD\|273768
NZ_AP014628.1\|WP_148659646.1\|3729249_3730197_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225720
NZ_AP014628.1\|WP_060839539.1\|3758324_3759275_-\|DUF4880-domain-containing-protein	unknown	unknown	gnl\|CDD\|226235
NZ_AP014628.1\|WP_060843757.1\|3754523_3755507_-\|type-II-secretion-system-minor-pseudopilin-GspK	unknown	unknown	gnl\|CDD\|377165
NZ_AP014628.1\|WP_060843749.1\|3725943_3727974_+\|type-VI-secretion-system-tip-protein-VgrG	unknown	unknown	gnl\|CDD\|274542
NZ_AP014628.1\|WP_060839536.1\|3756110_3756497_+\|type-II-secretion-system-minor-pseudopilin-GspI	unknown	unknown	gnl\|CDD\|273767
NZ_AP014628.1\|WP_060839529.1\|3746677_3747889_-\|type-II-secretion-system-inner-membrane-protein-GspF	unknown	unknown	gnl\|CDD\|273980
NZ_AP014628.1\|WP_148659645.1\|3728020_3729193_+\|M23-family-metallopeptidase	unknown	unknown	gnl\|CDD\|366703
NZ_AP014628.1\|WP_060839528.1\|3744960_3746124_-\|substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|270283
NZ_AP014628.1\|WP_148659648.1\|3731330_3732242_+\|SEL1-like-repeat-protein	unknown	unknown	gnl\|CDD\|276807
NZ_AP014628.1\|WP_060843752.1\|3732370_3744745_-\|filamentous-haemagglutinin-family-protein	unknown	unknown	gnl\|CDD\|372178
NZ_AP014628.1\|WP_060845138.1\|3756500_3756929_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378647
NZ_AP014628.1\|WP_060839538.1\|3757517_3758129_+\|type-II-secretion-system-minor-pseudopilin-GspJ	unknown	unknown	gnl\|CDD\|227132
NZ_AP014628.1\|WP_060843755.1\|3752786_3753347_-\|type-II-secretion-system-protein-M	unknown	unknown	gnl\|CDD\|377391
NZ_AP014628.1\|WP_060843753.1\|3747888_3749319_-\|type-II-secretion-system-ATPase-GspE	unknown	unknown	gnl\|CDD\|131585
NZ_AP014628.1\|WP_060843751.1\|3730942_3731350_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|197204
NZ_AP014628.1\|WP_060843754.1\|3750402_3752790_-\|type-II-secretion-system-secretin-GspD	unknown	unknown	gnl\|CDD\|274175
NZ_AP014628.1\|WP_060843758.1\|3757059_3757521_+\|type-II-secretion-system-minor-pseudopilin-GspH	unknown	unknown	gnl\|CDD\|130769
NZ_AP014628.1\|WP_148659647.1\|3730183_3730744_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014628.1\|WP_047304124.1\|3755515_3755962_-\|type-II-secretion-system-major-pseudopilin-GspG	unknown	unknown	gnl\|CDD\|130771

Protein	Function_ID	Function_description	E-value
NZ_AP014628.1\|WP_060843756.1\|3753339_3754527_-\|type-II-secretion-system-protein-GspL	gnl\|CDD\|273768	TIGR01709, Type_II_secretion_system_protein_L, type II secretion system protein L. This model represents GspL, protein L of the main terminal branch of the general secretion pathway, also called type II secretion. It transports folded proteins across the bacterial outer membrane and is widely distributed in Gram-negative pathogens. [Protein fate, Protein and peptide secretion and trafficking].	7.10657e-44
NZ_AP014628.1\|WP_148659646.1\|3729249_3730197_+\|hypothetical-protein	gnl\|CDD\|225720	COG3179, COG3179, Predicted chitinase [General function prediction only].	9.33053e-11
NZ_AP014628.1\|WP_060839539.1\|3758324_3759275_-\|DUF4880-domain-containing-protein	gnl\|CDD\|226235	COG3712, FecR, periplasmic ferric-dicitrate binding protein FecR, regulates iron transport through sigma-19 [Inorganic ion transport and metabolism, Signal transduction mechanisms].	7.9468e-63
NZ_AP014628.1\|WP_060843757.1\|3754523_3755507_-\|type-II-secretion-system-minor-pseudopilin-GspK	gnl\|CDD\|377165	pfam03934, T2SSK, Type II secretion system (T2SS), protein K. Members of this family are involved in the Type II protein secretion system. The T2SK family includes proteins such as ExeK, PulK, OutX and XcpX.	8.26972e-62
NZ_AP014628.1\|WP_047304124.1\|3755515_3755962_-\|type-II-secretion-system-major-pseudopilin-GspG	gnl\|CDD\|130771	TIGR01710, Type_II_secretion_system_protein_G, type II secretion system protein G. This model represents GspG, protein G of the main terminal branch of the general secretion pathway, also called type II secretion. It transports folded proteins across the bacterial outer membrane and is widely distributed in Gram-negative pathogens. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis].	3.6837e-58
NZ_AP014628.1\|WP_148659645.1\|3728020_3729193_+\|M23-family-metallopeptidase	gnl\|CDD\|366703	pfam01551, Peptidase_M23, Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.	0.000206074
NZ_AP014628.1\|WP_060839529.1\|3746677_3747889_-\|type-II-secretion-system-inner-membrane-protein-GspF	gnl\|CDD\|273980	TIGR02120, Putative_general_secretion_pathway_protein_F, type II secretion system protein F. This membrane protein is a component of the terminal branch complex of the general secretion pathway (GSP), also known as the"Type II" secretion pathway. The GSP transports proteins (generally virulence-associated cell wall hydrolases) across the outer membrase of the bacterial cell. Transport across the inner membrane is often, but not exclusively handled by the Sec system. This model was constructed from the broader subfamily model, pfam00482 which includes components of pilin complexes (PilC) as well as other related genes. GspF is nearly always gene clustered with other GSP subunits. Some genes from Xylella and Xanthomonas strains score below the trusted cutoff due to excessive divergence from the family such that a sequence from Deinococcus which does not appear to be GspF scores higher. [Protein fate, Protein and peptide secretion and trafficking].	1.36444e-177
NZ_AP014628.1\|WP_060843749.1\|3725943_3727974_+\|type-VI-secretion-system-tip-protein-VgrG	gnl\|CDD\|274542	TIGR03361, VI_Rhs_Vgr, type VI secretion system Vgr family protein. Members of this protein family belong to the Rhs element Vgr protein family (see TIGR01646), but furthermore all are found in genomes with type VI secretion loci. However, members of this protein family, although recognizably correlated to type VI secretion according the partial phylogenetic profiling algorithm, are often found far the type VI secretion locus.	0
NZ_AP014628.1\|WP_060839528.1\|3744960_3746124_-\|substrate-binding-domain-containing-protein	gnl\|CDD\|270283	cd13565, PBP2_PstS, Substrate binding domain of ABC-type phosphate transporter, a member of the type 2 periplasmic-binding fold superfamily. This subfamily contians phosphate binding domain found in PstS proteins that serve as initial receptors in the ABC transport of phosphate in eubacteria and archaea. After binding the ligand, PstS interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The PstS proteins belong to the PBPII superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	6.57288e-28
NZ_AP014628.1\|WP_148659648.1\|3731330_3732242_+\|SEL1-like-repeat-protein	gnl\|CDD\|276807	sd00010, SLR, Sel1-like repeat. Sel1-like repeats (SLRs) share similar alpha-helical conformations with Tetratricopeptide repeats (TPRs), but with different consensus sequence lengths and superhelical topologies. SLRs contain 36 to 44 amino acids and are present in bacteria and eukaryotes but not in archaea. SLR proteins are involved in a variety of functions, and many serve as adaptor proteins for the assembly of macromolecular complexes. The SLR family was named after the Caenorhabditis elegans Sel1 protein which is predicted to fold into 11 SLRs, a transmembrane domain, and an N-terminal signal sequence. The human Sel1L protein contains an additional fibronectin type-II domain and an N-terminal PEST sequence. Its downregulation is associated with the development of breast and pancreatic carcinomas.	3.588e-17
NZ_AP014628.1\|WP_060843752.1\|3732370_3744745_-\|filamentous-haemagglutinin-family-protein	gnl\|CDD\|372178	pfam12545, DUF3739, Filamentous haemagglutinin family outer membrane protein. This domain family is found in bacteria, and is approximately 110 amino acids in length. The family is found in association with pfam05860.	8.80619e-43
NZ_AP014628.1\|WP_060845138.1\|3756500_3756929_-\|hypothetical-protein	gnl\|CDD\|378647	pfam11356, T2SSC, Type II secretion system protein C. This is the greater N-terminal region of GspC-type proteins. GspC proteins form part of the sophisticated transport mechanism of Gram-negative pathogens for injecting divers proteins into their hosts, a type-II secretion system - T2SS. The region is made up of a short N-terminal cytoplasmic domain that is followed by the single transmembrane helix, a Pro-rich linker, and the so-called homology region domain in the periplasm. This inner membrane GspC interacts with the outer membrane secretin GspD via periplasmic domains, an interaction which is critical for the effectiveness of type II secretion.	6.17714e-06
NZ_AP014628.1\|WP_060839538.1\|3757517_3758129_+\|type-II-secretion-system-minor-pseudopilin-GspJ	gnl\|CDD\|227132	COG4795, PulJ, Type II secretory pathway, component PulJ [Intracellular trafficking and secretion].	6.31388e-22
NZ_AP014628.1\|WP_060843755.1\|3752786_3753347_-\|type-II-secretion-system-protein-M	gnl\|CDD\|377391	pfam04612, T2SSM, Type II secretion system (T2SS), protein M. This family of membrane proteins consists of Type II secretion system protein M sequences from several Gram-negative (diderm) bacteria. The precise function of these proteins is unknown, though in Vibrio cholerae, the T2SM (EpsM) protein interacts with the T2SL (EpsL) protein, and also forms homodimers.	4.93012e-22
NZ_AP014628.1\|WP_060843753.1\|3747888_3749319_-\|type-II-secretion-system-ATPase-GspE	gnl\|CDD\|131585	TIGR02533, Type_II_secretion_system_protein_E, type II secretion system protein E. This family describes GspE, the E protein of the type II secretion system, also called the main terminal branch of the general secretion pathway. This model separates GspE from the PilB protein of type IV pilin biosynthesis. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis].	0
NZ_AP014628.1\|WP_060843751.1\|3730942_3731350_+\|hypothetical-protein	gnl\|CDD\|197204	cd09105, PLDc_vPLD1_2_like_2, Catalytic domain, repeat 2, of vertebrate phospholipases, PLD1 and PLD2, and similar proteins. Catalytic domain, repeat 2, of phospholipase D (PLD, EC 3.1.4.4) found in yeast, plants, and vertebrates, and their bacterial homologs. PLDs are involved in signal transduction, vesicle formation, protein transport, and mitosis by participating in phospholipid metabolism. They hydrolyze the terminal phosphodiester bond of phospholipids resulting in the formation of phosphatidic acid and alcohols. Phosphatidic acid is an essential compound involved in signal transduction. PLDs also catalyze the transphosphatidylation of phospholipids to acceptor alcohols, by which various phospholipids can be synthesized. Both prokaryotic and eukaryotic PLDs have two HKD motifs (H-x-K-x(4)-D, where x represents any amino acid residue) that characterizes the phospholipase D (PLD) superfamily. PLDs are active as bi-lobed monomers. Each monomer contains two domains, each of which carries one copy of the HKD motif. Two HKD motifs from two domains form a single active site. PLDs utilize a common two-step ping-pong catalytic mechanism involving an enzyme-substrate intermediate to cleave phosphodiester bonds. The two histidine residues from the two HKD motifs play key roles in the catalysis. Upon substrate binding, a histidine residue from one HKD motif could function as the nucleophile, attacking the phosphodiester bond to create a covalent phosphohistidine intermediate, while the other histidine residue from the second HKD motif could serve as a general acid, stabilizing the leaving group.	2.43145e-14
NZ_AP014628.1\|WP_060843754.1\|3750402_3752790_-\|type-II-secretion-system-secretin-GspD	gnl\|CDD\|274175	TIGR02517, Putative_type_II_secretion_system_protein_D, type II secretion system protein D. In Gram-negative bacteria, proteins that have first crossed the inner member by Sec-dependent protein transport can be exported across the outer membrane by type II secretion, also called the main terminal branch of the general secretion pathway. Members of this family are general secretion pathway protein D. In Yersinia enterocolitica, a second member of this family is part of a novel second type II secretion system specifically associated with virulence (See ). This family is closely homologous to the type IV pilus outer membrane secretin PilQ (TIGR02515) and to the type III secretion system pore YscC/HrcC (TIGR02516). [Protein fate, Protein and peptide secretion and trafficking].	0
NZ_AP014628.1\|WP_060843758.1\|3757059_3757521_+\|type-II-secretion-system-minor-pseudopilin-GspH	gnl\|CDD\|130769	TIGR01708, Type_II_secretion_system_protein_H, type II secretion system protein H. This model represents GspH, protein H of the main terminal branch of the general secretion pathway, also called type II secretion. It transports folded proteins across the bacterial outer membrane and is widely distributed in Gram-negative pathogens. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis].	1.02097e-24
NZ_AP014628.1\|WP_060839536.1\|3756110_3756497_+\|type-II-secretion-system-minor-pseudopilin-GspI	gnl\|CDD\|273767	TIGR01707, Type_II_secretion_system_protein_I, type II secretion system protein I. This model represents GspI, one of two proteins highly conserved at their N-termini and described by pfam02501 but easily separable phylogenetically. The other is GspJ. Both GspI and GspJ are proteins of the type II secretion pathway, or main terminal branch of the general secretion pathway. This pathway carries proteins across the outer membrane. Note that proteins of type II secretion are cryptic in E. coli K-12 - present but not yet demonstrated to act on any target.	2.93412e-19

>NZ_AP014628.1|WP_060843753.1|3747888_3749319_-|type-II-secretion-system-ATPase-GspE
MPSQSPQLPYAWAKSHRILLRHSEEGATLLVCPSTPGWSIGEARRQFGPARLERIRDEELDGLLATAYADTGSAAAVVGAAENEVDLDRLMQDMPEITDLLDTQDGAPVIRMINALLTQAARDEASDIHIEPFETHSVVRYRVDGTLRDVVSPRKALHGALVSRIKIMAQLDIAEKRLPQDGRIALRVAGRPIDIRVSTVPTGHGERVVMRLLDKQAGRLQLETLGMDPDLLARLDTLIRQPHGIVLVTGPTGSGKTTSLYAALARLDASTSNILTVEDPVEYDLPGISQIQVNAKIDMTFALALRAILRQDPDVIMIGEIRDLETAQIAVQASLTGHLVLATLHTNDAVSAVNRLVDMGVEPFLLASSMLGVLAQRLVRRLCNQCKAADSANPGTWRPVGCPACNHIGYSGRTGIHELFCIDDDIRSLIHQGADEQALRAAARRAGMLSMREDGERWVRSGATAAEEILRVTRDA
>NZ_AP014628.1|WP_060839529.1|3746677_3747889_-|type-II-secretion-system-inner-membrane-protein-GspF
MNRYRYEAADALGKIESGHLEADSQGAAFASLRSRGLTALQVQLDSNGAATGTGGVFSPRLSDNDLAWATRQLASLLGASLPLEAALSATVEQAERKHIAQALSAVRADVRSGMRLAEALAARPRDFPEIYRALIAAGEESGDLAQVMERLADYIEERNGLRGKILTAFIYPGVVGLVSIGIVIFLLSYVVPQVVSAFSQARQDLPGLTLAMLNASDFIRAWGLECFGAMAAGFWGWRLYLRNPRARLSWHSRILRLPLFGRFVLGLNTARFASTLAILSGAGVPLLRALDAARQTLSNDRLSQSVSEATAKVREGANLAAALRVEKVFPPVLIHLIASGEKTGALPPMLERAAQTLSRDIERRAMGMTALLEPLMIVVMGGVVLVIVMAVMLPIIEINQLVT
>NZ_AP014628.1|WP_060839528.1|3744960_3746124_-|substrate-binding-domain-containing-protein
MFKRNVLAASLTLAALCSAQAALADINGGGATLPQPLYQTAGVLTAGFAPYIGVGSGNGKAAFLNNDYTKFVAGTTGKNVHWAGSDSKLSSTELSNYAAAHNAAWGPLIQVPSVATSVAIPFNKAGATAVDLSVDQLCGVFSGRLSKWEDIPSSGRTGPLTVVYRSESSGTTELFTRFLNAKCAETGTFNVTTTFASSYTGGLPAGAVAATGSQGVMTALNAADSRITYMSPDYAAPTLAGLDDATKVARVAGVSPAPGNVSAAIGGVAIPALADRANPDKWVPVFGKAGVAGTVPYPDSGYPILGFTNLIFSQCYADATQTSQVRDFFARHYGQNTSSNNDDAIQANRFVPLPASWKGVIRTTFLTASNGLSIGNSNVCNNIGRPQ
>NZ_AP014628.1|WP_060843752.1|3732370_3744745_-|filamentous-haemagglutinin-family-protein
MVRCKPPVKSPAMRHDGELPILRLKPLAHAIALLMMAGSAHGATAFSSGWFADKGASQAATAARTSGQVPGIPPLSQQTRANQQLQRSLSNLNSTVAAIAAQQAAQAAARQAAFGTVSQIPDGLGQGGLKVDNSLTQGWINAKGPVQSQSGGKTTVTIEQTADKAILNWETFNVGRNTTVDFQQQSNWALLNKVNDPNGRPSEIQGQIKGAGTVMIMNRNGVIFSGTSQVNVRNLVAAAASISDEQFTQRGLYVDANGTQPTFTDALGKVQVQRGALIQTHPAASSTESGGYALLLGAEVENAGTIVTAKGQTTLAAGDSFYIRRGVGTSGNQHSTTRGNEVATALKPGSSAGNVSNSGLIMASTGDITLTGHRVQQNGVALASTSVDTRGTIHLLNAASDGTGSVTLGQGSTTAILLDSSGSTALDSQRNNGQINLDGTPTNLITGQFNNLSSVADRSDQSRVEIVSGGTVDFQNGSITLATGGQVAVSAGQRSLVRDGAVIDVAGAVGVKVAMESNTIKINVQGNEQRDSAGNRDSGQLINNDVWVDLRELVFVPAGTNGYATDRWYTAGGLLEVGGYLGTQGHNIGEWMAQGGTLTFTGKDVVTQSGAQLNLSGGTVDVQAGYIQQTWLKGVDGRLYELSRAPGDLLYTGIYKGYVDSSPRWGRTDYYYNPLIAQQRRYEAGYTVGRDAGKLVIGTGNAVLEGQLISEVFKGDRQTQAPNVKLDGYQQSHKAAAQRAQLIIGNYTPIYNKTTGTLGHALGASTDQVLIAGNQQKIADGLDLATALPANRQGQLVLDSDQLNGFQLGAIKVGAKQQIQVNGALKVADGGDITLFGPQVQLNANLTAHGGSLNAGNVLKQVDVNRNFVVGDVILAPSGGAQARVDVAAGVKLDVSGRWSNLALDPADNSGLAFINGGKLSLRSSGDLNLGNGTLVDASSGASLGYDGKATGGKGGDVTLAADGKLDLNGELRGYGVNGGGTLALQAHKVLIGAKDVAAQAGTLQLAEGFFNKGFGAYDITGNEGLTVADGAKVEVNLPVYRVGAQAGSSATGSDPATVLERWLPELYQQDPLKGVLTQRRGAGLTLSAGNQYATAAQLASTALNVGQGAVISVDPGQAINLRSVGQLTMNGTLNAWGGSVSLGGLSLPPASAEAANAAGHGRSIWVGEQALIDVAARAVSAVDNRGRQYGQVRDGGKIAIGGEIDLATGIAKASDLFVVVREGARLEASGAQAALDIPGQGRVQVASNGGSISFASNNGLYLDGSFVARAGGAGAAGGSLSLALESPYYIKNAVNDRVLKARELVLSQVHQGSTLPDSAEAAAAGLEYGHGRLGVDQVRAGGFDNLALLSNGLLSFDGDVSLNMGQSLRLYSGALNLSEGAAANSRVNLSAPYLLLAGILAPPEAKDQYLRPVSTGTPSQRATQARFNASAQLIDVRGNVVFGSKGNLIQADSSLVGVERRGFDDVQLTSQGDLRFLAGAGADVIAKGISTQLLTHGDMTLRAAQLYPVTEVGARVLAGYLNDASGVSINFDPARTLTIGRTGNGQSAVPYSAFGRLQLGAATIKQGGVVRAPLGLIEIGNLGSSKVELLPGSLTSVSGKGLVLPYGGTVDGQIYKYNGKTVTFLGQGSLANENSDLSVGVILGGKSVQVLPDATVDLSGGGELLGAGFVSGRGGSTDARYSPLVQIGANGSFVLPGLGSNPIYAIVPGVQPGYAPVAPEGGAVDPLIGQQISIGAGVPGLAAGTYTLMPSTYALMPGAFRVEINGLAGLGSEGATQQLRNGSWSTAGRLSIAHTGISNSVASQLILTSADTLRRYSQYNETGYAQFALADAAKLGVPRPMLPVDAKTLKLALQPGAGAQAFSFQGIGRFDAAAGGYGGTVAVLNMGNGDIEVVAAGRSATSGFAGVTLEAESLNALGAARLMLGGMTLIKYGQPGNFITLAEGLNAAKGSITLREGATLAAPEVFLVSNTGAIVVEQGASINSIGRGKASYDARDGFTYQMANVLAVSNGLLNVINKGKASGTSGGIKLGSCASPPCSGQTALYSEGSIVALSDRNFELGDQLSYGTRHLNLGLNTINVGSPEALAAAAAGGRLPSGMTLTQQVLDRLLHGDTRFGAPALETLQLSARDAFNFYGSTTLDTYDPLTGKSLLSNLMLSTPAIYGAGEASDVARIHTANLIWQGGQTPAGAVVAGGAGTGSGRLEVNAERIEFGYGAFAQPSSTQTFDRLALGFANVDLNASQRITANHKGSLAVYQSQGAYDPVKGFAYSGGNLNILTPLMTGEAGSVNRITAGGAIDISASAGPRGTANGQGAELSLQGDSIRLASAVVLPSGKVTLGARGDVSLTDGSLIDVAGRAIAFNDLTRYGAGGEVLLESRAGNVLQAAGATIDLSASNNQAGKLRAVALDSAAGQVDLAGKLLGASSGSYDAGGTQVPYLGGAVEIQAQRLGGSGTLDEQFAALNQRLNQGQVFGARSFQLKQGDLSIGNGVKANSVNVSVDHGSLRVNGLIDASGERVGSINLAAGNGLTLEAGAMLDAHGSRLRVDSYGKIIDSPNRATVVLGSGLGRLTLADGARIDLRHGTDVAVGSAAGQNDGRSRGTLELNAPRLFKPDGSSNDIDIDARGRLDIRGARSIAVNGMVSYDDAPQKNDAVSGRPYQEITQDYLTKKHDLSTAFINAALQNSDLLQNKLAGLNNATYADALHLRPGVEIVSKTADGDLVVQGDLDLSGYRYASLNPHTRKDDNVYGSGEVGSLTLRAGGDLNIYGSINDGFAPPPPTDDDNGWVLLAGIDYTGGVQVVPGTGVTLADGSRFPAGSILNFDLPIKAQTLPAGTRLPVAATLNQPLVLPAGTVLAAAVRDASGNVLFAAGTLLSQGQTLAAGSTLDAGYLLGSDASVASLTWPKGVPLPGRLGSREMVTLSGNKPLLRGALLPAGTDVKLPGGATSVQLRAQDSGRQGKNWAVAPMLAEGAQSWSIRLVAGADTEAADSRLLQPKPLSGHLRLADSHYGMFGQGTLVWTEEGSLGWFGDDSRVGQPIDFDEAYPGICEDYLGYCASGGDEYTLLAGGSTRFSVIRTGAADLDLLAAGNLSMESLFGVYTAGSSSTGTAANDPYNRPRALGSNDKVLGNIAGGNEKLVNGGPDSLYRAWYPDGGGNLLLKVGGNLTGNITSLATSNQQRPVNSDLGQDSANVGNWLWRQGNGVSGSQAQATAWWINFGSYAPNMNQGAADQLLGFTGFGTLGGGNLNVEVGGDGGILRPLAADSMAQNISPRSQGLVLAVGSTGRVAADGSLQLTGGGDLNLRVGGVLNPGSQITQGHLNGALVDVRGHAQLSGGALGALTLRYGNQRVDQSPSEVRAYEPLRATSAIATGGLSLLPGDATFSLATRGDLVLQDVADPGRAPQMNAQAFKSGAVNGIGQSWFSLWSERTAVDLFSAGGNLTPLTQTTETDMAAVYPATLRAVAASGSLYYGRASVMDAGNLGPLRALVLAPSNLGQLQLLAGNSIYGGDLSISRSSAAPDSLATIWKPAFVGFLNGVEVLGSGNLSSDGSRVKIGVSPLFAFGPDSASLQWRNPQEPARFYALSGDLLGVNSGRRLTITTMEDPRNGQTYHAGAGPVWMMAGRDIVSSGTPLGGATGGEKEFGGYSFAGNLFVHDNPNDISVVSAGRDILYSSFNVAGPGTLELTAGRNILMEDKVSVTSLGAVAPGDSRPGASIVMQAGFGANGPDFRRFVAAYLEPANLAQPGESLSAGKVAKTYDSELLGWLGARFGFVGDSAQARAYYAALPAEQQRVFAREVYFAELKAAGREYNQEGGVRQGSYARGRAAIAELFPSSDVAGNPITYKGDITLFGGAGVHTNFGGNIQMLTPGGNQTFGIEGTAPPASAGVITQGAGDIQLYSLGSILLGQSRIMTTFGGSIMGWSAAGDINAGRGSKTTVVYTPPKRVYDNWGNVGLSPSVPSTGAGIATLNPIPEVPAGDIDLIAPLGTIDAGEAGIRVSGNVNIAALRVVNAANIQTQGKSSGVPVSATVNTGAMTSASAAGSAASQAAEDAARNQQAAAKQGRASIVTVEVLGFGSEPVQRQREEASRAPGYNPDSPVQVLGAGPLSDQARARLTDEERGQLTL
>NZ_AP014628.1|WP_148659648.1|3731330_3732242_+|SEL1-like-repeat-protein
MPKPLIKTIYYCVIIISLLLNGAAAMAYPGFTCAYERDNNPPLDPQAESWFQQARILEKTRGVKDWKKIVSLYEQAIAKDHWKAMHNLAGLYRTGWPGRPGVEQDTGKMLDLYERMVKLKVPLGYYNWSVITERGKGVLKSERMAASYLFQAAQLGSPLAQVQIGQYFAYALPRHKQDDDMAERYYRCAGAQEDSDAILKTASFYDTAKDNKPRSLFYYQRAASLGNSTGFNYLIGVFKPIPRPIHNFGYKPDEKLCALYSNLSKQLDEDPRLLFPNLMKDHPLPPHPTQGFDAEHPDRRPEL
>NZ_AP014628.1|WP_060843751.1|3730942_3731350_+|hypothetical-protein
MVITACSPEPGSTLAEGEQAHFRDIYVHSKLLVVDDVFSLLSSANINTRSMHTDSELGLAAPDAELAKTWREELWKLHVGESFSDEQGRCNSVKNFKEWNDVMDKNWEHKGRNHPLTAHLTRFWDIETPYAKAVD
>NZ_AP014628.1|WP_148659647.1|3730183_3730744_+|hypothetical-protein
MMRHKFSLRLLALFCSAFCSLQAFSNEQQCLPNMPKTKLEVFGCFQEGDVTILKLAPRDQPTYDTNLENLPTFIVMGKAFNEVLRVLGKGTHQPYNNLIKLPYPSAIIRVTEVSKAVRLKLVKEGWKLLDIKNFTYGKSDGTEGADVVCSTFIKNSSDVFTAVSQCSFLYEDDILKLKDILGSVGH
>NZ_AP014628.1|WP_148659646.1|3729249_3730197_+|hypothetical-protein
MSEGDEPIISAQAQEKLKLHYEALAFWEDMDLKDINPEHWHFPPKEFVRVFRKCGWLSSNELIRALVKAPEPGRQRAEELRVPMNKMLSKYIINTSSIRISHFLAQVGIETGWWEYRQEIGGPRYFRTMYEVITPTEAGEDYDTAIARERNLPTGRRPIELPNPGPNPRPTITRENYMASRPNQIAVKAAGMDNGVANALAGGMVGDGDRFHGRGFLQITGRRNYKNYEQYRARNFTIDPNPNLLATDDYNACDASGFYWAREKINRRADEGSTQTASRVVGAIINRGNPNGILSHNNERRQAFEAIWSVLNDEA
>NZ_AP014628.1|WP_148659645.1|3728020_3729193_+|M23-family-metallopeptidase
MLISPPFLPLAAPNESDEDFINRAMNSTEGAFPLGQNMIWHGGIHLTAPREGNTHLPVRAIADGTVAYVRQPTATNTDTSHPLNYRNGWTDDGCLILKHETDIGEGAHAKVVFYSIYMHLSAIKSVDIAIDMPIYRKDELGTAGRIYGAPHKIHFEVICSQEQLGHFLGRSTGRLTTTRNGRTDSCWGDVHFYIPPEILFYAARPTNPTSATNESAIVHRHIDAYFVSMKYEQGQCTLTTFNESGTRLGERQETQDYEYNLYTTAKSLYPRSPSAGYELLRFGRILGPDLLQPHDAAHWRQVAYPASGAHPAGVGWVNLKSPTVTVYSDADFPHWQGWKLIDDDTDGDGRCQSEQVMELLGISEIPVTPQQRTAHSAMINTPENHKNLND
>NZ_AP014628.1|WP_060843749.1|3725943_3727974_+|type-VI-secretion-system-tip-protein-VgrG
MFSPADQTHFSLDIQGIQHDFQVLAFQGTEAISQPFRFDLQLVSERPFIDLEPLLHQPAFLAFDPQGHGIHGLIQRIAQGDAGQRLSRYSLSLLPHLDYLRHRSNQRIFQQLSAPQIIALILEEHGILGNAYQFQIQHPCPERDYCVQYDESDLHFIQRLCEEEGLHYHFQHSREAHLLVFSDNQSVFRTLGRPTAYVRGSGLVADEPVIKGFNVRLETRTSRITRRDYDFEKPRLQMEAAYKPDAKTQEPDLEDYDYPGRFTDRQRGKFLSQRALERHRADYRQAEGWGDEPRLVSGHFLELTDHPRQAWNDLWLLTRVTHEGKQPQVLEESISSDTEVTDGFQQGYRNRFLATPWEVFFRPPLDHPKPRVLGSQTAVVTGPAGEEIHTDPYGRVKVQFHWDREGQGNDQTSCWLRVASSWAGDRYGALAIPRVGMEVLVDFLEGDPDQPLISGCLYHQEHPTPYALPINKTRSTFKTLSSPGGGGFNEVRVEDRKGAEQIFVHAQRDWDENIQHDQKIRVGHERHDTVEGNSYSELKAEEHRTIHGERKTEIRADDHLNVAHDQHIQLGTAQLLQAGREIHLQAGQKMVIEAASELTVQAGGSFIKLDASGVSVSGALLKVNAGGAAGQGSGVGIEPPMLPGVADKDKAGSLMEKALVNPKQKTKPEEDYPFSL
>NZ_AP014628.1|WP_060843754.1|3750402_3752790_-|type-II-secretion-system-secretin-GspD
MKGSGSNYVRQCRKVAPFLLLALGACSNTTSTTPPPLLVDSELGQPLADTRRSGDALADRERVQAQQATRPKVLHPVTDSRRGQGTPRSTSVPRNPLGDQPVQLNFVEADIQAVVRALARSTGQQFLVDPRVKGNLTLVSEGQVPAHQAYDMLLAALRMQGFAVVDVGGVAQVVPEADAKLLGGPIYSGDKPAGNGMLTRTFRLQYENAVNLIPVLRPIVSPNNPINAYPGNNSIVVTDYAENLQRVAQIIDGIDTPSAIDTDVVAVHNGIAVDIATMVAELLETQGADPTQKISVIGDPRSNSIIIRAGSPERTELARNLVYKLDNAQSNPSNLHVVYLRNAQAGKLAQALRGLLTGESDSTGNDGARAMLSGMGASTQGTQGSTQNSSGTPTASGNLNGSASTSGAYGQGASASSLSGNGQQNDQNTAFSAGGVTIQADATTNTLLISAPDPLYRNLREVIDQLDQRRAQVVIESLIVEVGEDDASEFGVQWQAGNLGGRGGFGGVNLGGSGLVGTPASKTSIDALPKGLNIGVVNGTVDIPGIGKVLDLKVLARALKSKGGTNVLSTPNLLTLDNEAASIFVGQTIPFVTGSYVTGGGGTSNNPFQTVQREEVGLKLNVRPQISEGGTVKLDIYQEVSSVDPRASVDAGTVTNKRAIDTSILLDDGQIMVLGGLLQDGYSQSNDAVPWLSSIPGIGALFRNEKRSITKTNLMVFLRPYIIRDSGAGRSITLNRYDFMRRAQGELQPERSWAMPDMQAPQLPAASKAIPGAVPVSLQGVPQTPRAPIRAVPVQ
>NZ_AP014628.1|WP_060843755.1|3752786_3753347_-|type-II-secretion-system-protein-M
MNKSGLAQYQARWSRLRTQARGHWQALALREKRLLSATALGVLGLLLWWLLIQPPLKKIDYWQAETPKLRSQAEALEVLLHEAAGTDRQGADLEQSLRQTLDRAGLKDRYQLQRTDQAGPESWRLTFEQAPADAVVGWLLGTPRQLSLQVVEARLQRAAPATAQDSAGTLSGTVRMDQAQGAKEAS
>NZ_AP014628.1|WP_060843756.1|3753339_3754527_-|type-II-secretion-system-protein-GspL
MSRLRLALPPLAELLHAPRPLAVPVECARLDRAGRVTALGRRALEALAQDARGLALECFLHPQDSLLACIELPPLPAARTKAAVDCAAQALILGCGEQMHVAHGPRDAQGQVTLSWLPISRLQALGELLQQAGLKLSGLYPAPYALAVPAPGQHNLCLLDGQLLLRHSAAQASVEPLVEETLEQLRASGAGLGWIGDDAPEGALQRLPVEQRWSGAAPAWGLQAGAMATRGAVQGWGRALGCCALAVAVWVVGLNLYAAREAEQGLRLKNQMSQRVRQVFPQLPVVLNPLQQARQQLAAQQGGAADPSQGFVNLLLQAGSAMPFMVGSVQSLSFADQRLQLELLPDTPKRTDSGWQGALTQAGYSVQAEGNGWTLSPATGEPADLAADAPGAEDE
>NZ_AP014628.1|WP_060843757.1|3754523_3755507_-|type-II-secretion-system-minor-pseudopilin-GspK
MNSHSPCAAKQRGMAIISALLIAAVVAVLAAGMLSRQTVLTRAVEAEQARIVGGGALQGGLEFSRQLLWEARQREVLTRLDQPWARPIGDPALGASGGGFQGRLQDLQGKFNLRNLVFNQQVDPEQVQSFQQLCQLLGVDAALSRRISQRVIASYPQRLSSPAATAGTPGAFNSGRLTSPGAAVQTLPPRQPMLRSLDDLLGVQGVDEALLARLEPYVSVLPGNTWINGNTASAEVLAVAVPGLSLSRARALVAERDAGHWFINRGDFVNRLRMPFAAQERIKVGITSEWFLLQGQVRRDQRRITLHALLHRPEDRMPQVIWSRVGA
>NZ_AP014628.1|WP_047304124.1|3755515_3755962_-|type-II-secretion-system-major-pseudopilin-GspG
MDIAPVTSTAAPRGQRGFTLIEIMVVVVILGILAVMVVPKVLDRPDQARATAAKQDIAGLMQALKLYRLDHGSYPSMNQGLKVLVERPANAKDSNWRSYLERLPNDPWGRPYHYLNPGANGEVDVFSLGADGQPDGEGVNADIGSWQL
>NZ_AP014628.1|WP_060839536.1|3756110_3756497_+|type-II-secretion-system-minor-pseudopilin-GspI
MQALRKQAGFTLIEVLVALAIIAVAMAAAVRVAALMTQSNGLLRDKSLALLAAQSRLAELRLEGRWPSGLKSVDCDQGRLALRCEQSIGATALPGLLRVSVQVRERGREAPPLARLETLLGRPQEPGR
>NZ_AP014628.1|WP_060845138.1|3756500_3756929_-|hypothetical-protein
MLRAADFSAPRVLQYTALLAALAGVATWSSLLLTPAESQTPAVAPQVLAARSDSPALQWFANQPSAVEVKVSGVLAGARGAVAILRLNDGPPRSFLAGEQLTPGVRLAAVEADGVLIERGAEQSRIKVSKLPDSPLLPRLTR
>NZ_AP014628.1|WP_060843758.1|3757059_3757521_+|type-II-secretion-system-minor-pseudopilin-GspH
MPSGKQRGFTLIELMVVLVIIGIASAAVGLSIKPDPLQTLRKDAERLAQLLQVAQAEARADGRPITWRATAKGFAFSRRAESGSGIDDLRGDPLLRPRAWETPGLQVRIEPGPRLILNAEWITPPLRLVLSDGRHSLGVERSAAGQLRVVNQP
>NZ_AP014628.1|WP_060839538.1|3757517_3758129_+|type-II-secretion-system-minor-pseudopilin-GspJ
MKPGQSGFTLIEVLVAVMLMAIVSLIAWRGLDSVTRADTHLKASTEQTEELLRSLNQLERDVALRAAVQLREPIQSDSEEAEPDSPVPLSVRSSDSKGFRLEVIRSAANPGDGLQRVRWWLKGDTLYRAAAEPRDRYPLPAPRDGVAVLRRVSDLQVRVWESGKGWRQLSGNRRDNPQGLEIRLTRQTPQGQEHYRQVLGPLP
>NZ_AP014628.1|WP_060839539.1|3758324_3759275_-|DUF4880-domain-containing-protein
MNIFSISPPQASADQQLLSEARDWLVLLTSGRATAADARALRQWCAQSPQHAAAFEQTKALWHCLQPAAVQLEQQSRPRHFGRRAFLGGALAASAALFMVRYTVPGGLAGLTADFSTAVGEQRRVDLAEGLSLELNTQTRISRRDPAPGEQAFELLEGEVEVFSQRQQPLQVQAGDGRLSARQARFNLRNTDHQVCVTCIEGSLQVAVAGRSIRLDSGRQLTYDAKTVGEPTAVDPRNVLAWREQVLVFDNASLDTVISEINRYRPGMLVLLNAELGRRKVQARFTLNQLAGVALLIRDAYGAKCTELPGGVVLLS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_AP014628_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_AP014628_3

4318803-4318928

Orphan

Consensus_repeat	Method
TCGCATCGTCGCACCTGCCGCATCGTCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_AP014628_3

>merge|NZ_AP014628|3|4318803-4318928|CRISPRCasFinder
CGCACCTGTCGCACCTGTCGCATCGTCGCACCTGCCGCATCGTCGTATCGTCGTATCGTCGTATCGTCGTACCGTCGCACCGTCGCACCGTCGCACCCTCGCACCGTCGCACCTGCCGCATCGTCG

>NZ_AP014628|3|3|4318803-4318928|CRISPRCasFinder
CGCACCTGTCGCACCTGTCGCATCGTCG	CACCTGCCGCATCGTCGTATCGTCGTATCGTCGTATCGTCGTACCGTCGCACCGTCGCACCGTCGCACCC
TCGCACCGTCGCACCTGCCGCATCGTCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_AP014628.1\|WP_060840068.1\|4310601_4310901_+\|YceK/YidQ-family-lipoprotein	unknown	unknown	gnl\|CDD\|369217
NZ_AP014628.1\|WP_060844069.1\|4315328_4315997_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NZ_AP014628.1\|WP_060844075.1\|4325885_4327277_+\|aldehyde-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|184426
NZ_AP014628.1\|WP_016967798.1\|4313477_4313996_-\|SgcJ/EcaC-family-oxidoreductase	unknown	unknown	gnl\|CDD\|227212
NZ_AP014628.1\|WP_060844070.1\|4319080_4319878_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380379
NZ_AP014628.1\|WP_082729339.1\|4311006_4311354_+\|YceK/YidQ-family-lipoprotein	unknown	unknown	gnl\|CDD\|369217
NZ_AP014628.1\|WP_060840076.1\|4318317_4318770_+\|response-regulator	unknown	unknown	gnl\|CDD\|381103
NZ_AP014628.1\|WP_060845156.1\|4323055_4324084_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014628.1\|WP_060844068.1\|4311396_4312170_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|238923
NZ_AP014628.1\|WP_060844073.1\|4324273_4324894_+\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
NZ_AP014628.1\|WP_060840073.1\|4314168_4315332_+\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|226951
NZ_AP014628.1\|WP_060840071.1\|4312418_4313420_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378890
NZ_AP014628.1\|WP_060844066.1\|4310197_4310509_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014628.1\|WP_060844072.1\|4322239_4322923_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014628.1\|WP_060844071.1\|4321058_4322087_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014628.1\|WP_060840078.1\|4319963_4320962_+\|bile-acid:sodium-symporter	unknown	unknown	gnl\|CDD\|372642
NZ_AP014628.1\|WP_060840075.1\|4315993_4318321_+\|CHASE3-domain-containing-protein	unknown	unknown	gnl\|CDD\|274362
NZ_AP014628.1\|WP_173664441.1\|4324906_4325797_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176133
NZ_AP014628.1\|WP_060844076.1\|4327543_4327792_+\|Arc-family-DNA-binding-protein	unknown	unknown	gnl\|CDD\|367702
NZ_AP014628.1\|WP_060844077.1\|4328035_4330216_+\|TonB-dependent-siderophore-receptor	unknown	unknown	gnl\|CDD\|273805

Protein	Function_ID	Function_description	E-value
NZ_AP014628.1\|WP_060840068.1\|4310601_4310901_+\|YceK/YidQ-family-lipoprotein	gnl\|CDD\|369217	pfam07119, DUF1375, Protein of unknown function (DUF1375). This family consists of several hypothetical, putative lipoproteins of around 80 residues in length. Members of this family seem to be specific to the Class Gammaproteobacteria. The function of this family is unknown.	1.79461e-14
NZ_AP014628.1\|WP_060844069.1\|4315328_4315997_+\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	1.5626e-68
NZ_AP014628.1\|WP_060844075.1\|4325885_4327277_+\|aldehyde-dehydrogenase-family-protein	gnl\|CDD\|184426	PRK13968, PRK13968, putative succinate semialdehyde dehydrogenase; Provisional.	0
NZ_AP014628.1\|WP_016967798.1\|4313477_4313996_-\|SgcJ/EcaC-family-oxidoreductase	gnl\|CDD\|227212	COG4875, COG4875, Uncharacterized protein conserved in bacteria with a cystatin-like fold [Function unknown].	7.45751e-57
NZ_AP014628.1\|WP_060844070.1\|4319080_4319878_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|380379	cd06124, cupin_NimR-like_N, AraC/XylS family transcriptional regulators similar to NimR, N-terminal cupin domain. This family contains mostly bacterial proteins containing an AraC/XylS family helix-turn-helix (HTH) DNA-binding domain C-terminal to a cupin domain, and may be possible transcriptional regulators. Included in this family is Escherichia coli HTH-type transcriptional regulator NimR (also called YeaM) that negatively regulates expression of the nimT operon and its own expression. Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	1.40977e-32
NZ_AP014628.1\|WP_082729339.1\|4311006_4311354_+\|YceK/YidQ-family-lipoprotein	gnl\|CDD\|369217	pfam07119, DUF1375, Protein of unknown function (DUF1375). This family consists of several hypothetical, putative lipoproteins of around 80 residues in length. Members of this family seem to be specific to the Class Gammaproteobacteria. The function of this family is unknown.	9.92684e-14
NZ_AP014628.1\|WP_060840076.1\|4318317_4318770_+\|response-regulator	gnl\|CDD\|381103	cd17551, REC_RpfG-like, phosphoacceptor receiver (REC) domain of cyclic di-GMP phosphodiesterase response regulator RpfG and similar proteins. Cyclic di-GMP phosphodiesterase response regulator RpfG, together with sensory/regulatory protein RpfC, constitute a two-component system implicated in sensing and responding to the diffusible signal factor (DSF) that is essential for cell-cell signaling. RpfC is a hybrid sensor/histidine kinase that phosphorylates and activates RpfG, which degrades cyclic di-GMP to GMP, leading to the activation of Clp, a global transcriptional regulator that regulates a large set of genes in the DSF pathway. RpfG contains a CheY-like receiver domain attached to a histidine-aspartic acid-glycine-tyrosine-proline (HD-GYP) cyclic di-GMP phosphodiesterase domain. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	3.07839e-49
NZ_AP014628.1\|WP_060844068.1\|4311396_4312170_-\|EAL-domain-containing-protein	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	9.14001e-57
NZ_AP014628.1\|WP_060844073.1\|4324273_4324894_+\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	4.42704e-39
NZ_AP014628.1\|WP_060840073.1\|4314168_4315332_+\|sensor-histidine-kinase	gnl\|CDD\|226951	COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms].	7.45835e-42
NZ_AP014628.1\|WP_060840071.1\|4312418_4313420_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|378890	pfam12625, Arabinose_bd, Arabinose-binding domain of AraC transcription regulator, N-term. AraC is a bacterial transcriptional regulatory protein with a DNA-binding domain at the C-terminus, HTH_AraC, pfam00165, and this dimerization domain which harbours the arabinose-binding pocket at the N-terminus. AraC positively and negatively regulates expression of the proteins required for the uptake and catabolism of the sugar L-arabinose 1,2,3].	8.63564e-32
NZ_AP014628.1\|WP_173664441.1\|4324906_4325797_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176133	cd08442, PBP2_YofA_SoxR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold. YofA is a LysR-like transcriptional regulator of cell growth in Bacillus subtillis. YofA controls cell viability and the formation of constrictions during cell division. YofaA positively regulates expression of the cell division gene ftsW, and thus is essential for cell viability during stationary-phase growth of Bacillus substilis. YofA shows significant homology to SoxR from Arthrobacter sp. TE1826. SoxR is a negative regulator for the sarcosine oxidase gene soxA. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine, which is involved in the metabolism of creatine and choline. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.25346e-89
NZ_AP014628.1\|WP_060844077.1\|4328035_4330216_+\|TonB-dependent-siderophore-receptor	gnl\|CDD\|273805	TIGR01783, Ferrienterobactin_receptor, TonB-dependent siderophore receptor. This subfamily model encompasses a wide variety of TonB-dependent outer membrane siderophore receptors. It has no overlap with TonB receptors known to transport other substances, but is likely incomplete due to lack of characterizations. It is likely that genuine siderophore receptors will be identified which score below the noise cutoff to this model at which point the model should be updated. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	4.43311e-113
NZ_AP014628.1\|WP_060840078.1\|4319963_4320962_+\|bile-acid:sodium-symporter	gnl\|CDD\|372642	pfam13593, SBF_like, SBF-like CPA transporter family (DUF4137). These family members are 7TM putative membrane transporter proteins. The family is similar to the SBF family of bile-acid symporters, pfam01758.	3.40283e-118
NZ_AP014628.1\|WP_060840075.1\|4315993_4318321_+\|CHASE3-domain-containing-protein	gnl\|CDD\|274362	TIGR02956, sensor_protein_TorS, TMAO reductase sytem sensor TorS. This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072). [Signal transduction, Two-component systems].	1.30627e-60
NZ_AP014628.1\|WP_060844076.1\|4327543_4327792_+\|Arc-family-DNA-binding-protein	gnl\|CDD\|367702	pfam03869, Arc, Arc-like DNA binding domain. Arc repressor act by he cooperative binding of two Arc repressor dimers to a 21-base-pair operator site. Each Arc dimer uses an antiparallel beta-sheet to recognize bases in the major groove.	2.12691e-05

>NZ_AP014628.1|WP_060840076.1|4318317_4318770_+|response-regulator
MTADMRILIVDDQRPNLDLMEQLLAREGLHNVLSSTQPLRTLELFNSFEPDLVILDLHMPEFDGFAVLEQLNRRIPAHDYLPILVLTADATRDTRLRALALGARDFISKPLDALETLLRIWNLLETRALYKTLRTLVPPEQIALLRPSKA
>NZ_AP014628.1|WP_060840075.1|4315993_4318321_+|CHASE3-domain-containing-protein
MNLRSARRWADLPLRGKALVVISLPLVILLLSLVLIYSAERQTARAEEDVRRVLLVQGDIQTVHTLLAEAAASVRGYLLTRSEDFLPAYLQARPQIEAALQRLDRNVRDTRMREYLHTITPLIQTKLEGLVALRNGSRDDSATVTAILIDNKQVLDVLREQISAMRIHEDALLAERTAAAAATRMRLLFATLLAAGCGLFGAIVAVLLLSRGIVTRVQQVQGNAQRLALGQPLLPQAPELDEIGQLGTRLVEAGQLLAERERALRDNEERLRLIIDGVKDYGIFALDTAGMVTTWNFGAERIKGYRDQEIIGRHFSLFYLPEECPQHPDMALREATAHGHYMEEGWRCRKDGSRFWASVVITAQYDASGALRGFSKITRDITDRRAAEIALGTAREEAESASRAKSEFLSRMSHELRTPLNAILGFAQLLDMDSSAGQRPQVGHILRAGQHLLGLINEVLDIARIEAGRLPLNVEPMPLAAVLHEALTLVSPMATDAGIQLSALPELPADSGVIADRQRLIQVLLNLLSNAIKYNRAQGRVSIEVTLEEARLRIAVIDTGAGIAADQLQRLFKPFERLDADPKVEGTGLGLALSKSLLEMMDGSLEVHSTMGSGSRFILELPCVRLPDAPLATPLATPALKPPTLPTPSPYRGKILCIEDNLQSLALIETLLQRRPGIQLLSSMQGQLGLDLARQHSPQMILLDVNLPDLQGLEVLQRLRASGSTASTPILMITADASELTQRSLLEAGATAILTKPIHIPAFFAHLDACLAEPL
>NZ_AP014628.1|WP_060844069.1|4315328_4315997_+|response-regulator-transcription-factor
MSSLIRLVLADDHEVTRTGFVALLAGNPEFEVVGQARDGEEALALCEQLRPDIAILDIRMPRLNGLGAARLLQQRQPEVKVVIFTMDDSPDHLEAAMTAGAVGYLLKDASRDEVIGALQRVAQGEEALNSAVSARLLRRMTERGSGQIPQAQALTARERQVLGLVAGGFSNREIGEKLGITTGTAKAHVERVIGKLGASDRTQAAVRGIALGLVAQPSGQWP
>NZ_AP014628.1|WP_060840073.1|4314168_4315332_+|sensor-histidine-kinase
MSTPSFDPASALALRSQYRQSQSRAARLRLLVDTGQELLQLPPEQMRQRVVQRACAFAAMDHGLLLEWAEDGVIHTRAALGHEERLQGLRALADHPQWPEPPPTPDSAVLRVLLHRADGRAFGALLLANSVPISPPDSEDLESLQLLATLLAAHLENHRLLRDLQARERSMSELVQRLFSAQEDERKRVAYDLHDGLAQTLAGLHQRLQGFAGRCPPLPAELHQDLQTILQLAQGCVGEGRQLIGGLRPHVLDDFGLLRAIDREADRLRDAGLLVYWGQRAPQRLPDAVEIALFRIAQEAINNILKHARASQVHLSLALEDGLALLGVNDDGCGFVSSPAPVAEQLGQVAMHERAHLLGGHFSCDSRPGSGTRLLASVPVQPLEQAP
>NZ_AP014628.1|WP_016967798.1|4313477_4313996_-|SgcJ/EcaC-family-oxidoreductase
MKLKTTALALFFAFTAPLAVAAEVKPYVYSAVAEQPQAAQDREIAGLFDRWNSALQTGNPQSVVSLYAPNAVLQPTVSNQVRSTHAQIQDYFEHFLASKPVGQINYREIRHLGPDAALDSGVYTFTLTDASGKSEKVQARYTFLYERIDGQWKILNHHSSAMPEVQPQLAAH
>NZ_AP014628.1|WP_060840071.1|4312418_4313420_+|AraC-family-transcriptional-regulator
MHRMTSASFRVLADVMNEGGAHVETLLKQLGSSLRDVYENPKGVRLELVYQVIQEAVRRTGKPDLGLLAYSKAHPANLEALGYAVMSCATLGIALQRLVDYHALISNGFCMCLERKPQMLTLIGFDVASEPSMMPRAFIDAGAAQTLGLLHWLLPQHKVRPLTATFTYPEPLDTGSLRQLLGDNLQFCAPYNSLSFSSQDCAIALPTADPALDVLHLEYARNRLNLLHNGSMTARVRRALSERLAQGAPSDLPNIAQIVGVSTRSLQRRLGHEDVHFSALLDEARLMLAHSFLRNSMRSVKYIGALLGFRDQSSFHKACLRWFGMTPGRYREQ
>NZ_AP014628.1|WP_060844068.1|4311396_4312170_-|EAL-domain-containing-protein
MQSVRDFYRELAQGRLMLAFQPVVWLPDSSRVLYHESLLRHIDAQGGEVYPLALLEKHQLMRELDQSVVRCVIDALHRDERLRLGCNISAQSAIIDGFWLPILQVLRDSPSVAARLVIEITESATPPSIEAASEFVLCLRELGCRVAIDDFGAGLGTLEFIRQTRPDIVKIDKGYIQRARGELNSAQTLSHLVQLCKTLAPCVIIEGIETSTDQNLATACGGEWGQGYLFGRPQVDRLGRRCCLEQQMAPRCALDQA
>NZ_AP014628.1|WP_082729339.1|4311006_4311354_+|YceK/YidQ-family-lipoprotein
MTRGNALDFRDDRYYRSVKTNAQVLTGYDMGYARMITGGCWVTVVCPILMIASLPLDAALDTVLLPYDAFQPERPKRNRHVDMKEIPEEELPALPISAEVQDPTAHTPPITPQAD
>NZ_AP014628.1|WP_060840068.1|4310601_4310901_+|YceK/YidQ-family-lipoprotein
MLRNGAIKALNALFVVSMLSLAGCGTLIARTPNAHSGYDYYKGTQANIELLTMRGASGYDGYATLFCWMSIVCPVVAIVSLPVDAVADTALLPYDAMNH
>NZ_AP014628.1|WP_060844066.1|4310197_4310509_-|hypothetical-protein
MRGERSVARLFAEEPLSWGLRGDPYLWRAMAAHLAHTPWPATAQQLEALIVEAFEQLTGSAWSSAGHFFVEAFAHGGMSSGGISMVFWHEHGLPLLRARWAQA
>NZ_AP014628.1|WP_060844070.1|4319080_4319878_-|helix-turn-helix-transcriptional-regulator
MPPKGHEKIVRRSIPGLPSLPRPVYGRTESLPNRALTRRHSHPWVQLSYAIQGVLEIQTLGGRFVAPPQRAVWIPAGVPHRVFSSPRTEMRSLYLDCSVTAWAATDSCQVLAVSSLLRELIRAFSELPVEYVEDSADGRLAQVLLDQLAAAPQLDLMLPLPLDARLRTIYRSLQAHPEQPTTLGQWSQKLGVTEKTLSRLFLKDTGLTFRAWRQRLRLLGALTPLEQGERVTDVALACGYDSTSAFIAAFRQQFDATPGEFFRDL
>NZ_AP014628.1|WP_060840078.1|4319963_4320962_+|bile-acid:sodium-symporter
MTRSRLLPDNFTLTLIGVVLLASFLPASGQVAVGFGWLTNLAIGLLFFLHGAKLSREAIIAGAGHWRLHLLVFSLTFILFPVLGLALKPLLSPLVGNDLYLGMLYLCALPATVQSAIAFTSLARGNIPAAICSAAASSLFGIFLTPLLVTLLLNVHGDGGSTLDAIIKISVQLLLPFIAGQIARRWIGAWVGRNKHWLRFVDQGSILLVVYGAFSEAVNEGIWHQIPLWELGGLVVACCILLALVLLASSFLGKLFGFDQEDRITILFCGSKKSLATGVPMAQVLFAGSTMGVLILPLMLFHQIQLMVCAVLAQRYAKRPESVAELMGQVDP
>NZ_AP014628.1|WP_060844071.1|4321058_4322087_+|hypothetical-protein
MFPHRIQAPSQADLEQQVSARLEADDQAQVIVQFAKAEQYNGELLSQLDTLCARFGERLKVRFYSHYPGSAFDARVLLALPHVQSLSLDCLDSLEHFEAIGSLHRVKDFALQVISAELPGLLALPNLRRLQTLRLSLDKGPAIDLAPLAAMPELHTLSLSVQTHHLDVLSQCPGISHLDLHRMPAKAPLGMVAGMSGLRSLSVTFGSREQMPELRNPQVKELEIMRVRGLNRLDLDGFPQLEALKIEDQAQLGQLDLSGAPQLRKLSLINLKNLGLINHLHTSTIADLRLIKIPQVDLLALIEQQLPPSLQHLKLHSGKRAVDQQIEARQQQLGIPEPRGPY
>NZ_AP014628.1|WP_060844072.1|4322239_4322923_+|hypothetical-protein
MSFVPGFTELLLNHLKKDERQRILKSIMVSAAPELWLSLESAALLDINREHFGLGGQLDQRDDYRPSNINVARSNVPRWLIAAERRKVDIWVEDSYGEEAATAIEFKVVHNNKNAYYKIWEIRKDLVKQIPRTSPDERIERWGIVLLSYSRFYSDQQGNYSYGKFDSCPAFLAAFENGLNDNNEWYAGAPELELVMKPTRIADLDDAHYIEPGKGSGVYLALVRCKA
>NZ_AP014628.1|WP_060845156.1|4323055_4324084_+|hypothetical-protein
MFPHRIKAPTQADLRLQVGARLEADPRARVIVQWHSVEQYDCQLLEQLDALCARYGERLTVRFYNHYSSRGFDGRTLLALPNVHSLSLDGLETLEHFQAIGSLHLLRELALEVFRAELPGLLALPNLERLHSLRLSLDQGPAIDLAPIARMPELQSLHISPQSHDLEILSQCPSISTLSLHRLPAETTLGMVAGMSGLRSLSVAFGSREQMPELHNPYVRELEIMRVHGLNRLDLDGFPQLEALKIEDQAQLSRLDLGGAPQLRKLSLSNLKTLGEISGLKTSNIADLRLIKVPQVDVLTLIDSQLPPSVQHLKLLSGKHSLDKQIAARQQQLGIPEPRCPY
>NZ_AP014628.1|WP_060844073.1|4324273_4324894_+|LysE-family-translocator
MSITENLLAFTLAATLLTLTPGLDTALVLRTATVEGKQQALRAALGINAGCLLWGAAVAFGLGAVIAVSELAFNLLKYCGAAYLAWLGLNMLLRPRRSFAPANPDGNPGTHWFLKGLLGNVLNPKVGIFYVSFLPQFIPQGQPLVLWTFGLVSIHVVLGLIWSLLLIGATRSLSGVLQREKVIQWMDHTTGMIFVLFAARLALSRR
>NZ_AP014628.1|WP_173664441.1|4324906_4325797_-|LysR-family-transcriptional-regulator
MENAVDLVQLEIFKAVAEQGSISAAAQLIHRVPSNLTTRIKQLEQDLGVELFIREKSRLRLSPAGWNFLDYARRILDLVAEARLTVAGEEPQGPFALGSLESTAAVRIPALLAAYNQQYAKVELDLSTGPSGTMIDGVLSGRLVAAFVDGPVRHPALEGLPVFEEEMVLIAPLGHAPITRAREVNGESIYAFRANCSYRHHFESWFTQDAAVPGKIHEMESYHGMLACVSAGAGLALMPRSMLESMPGCATVSVWPLSPRFRFLRTWLVWRRGTVSQSLSSFVKLLEERGVVLAEV
>NZ_AP014628.1|WP_060844075.1|4325885_4327277_+|aldehyde-dehydrogenase-family-protein
MNLVSSNTHALSINPASGEQIGAYPYQSEAESDATLERAARGFALWKRQSVATRAAHLTALAQALRDNSEAMARMISQEMGKPLPQARGEIEKCAQLCLWYAEHGPAMLAPEATLVENNKAHIEYRPLGPLLAVMPWNFPVWQVLRGAVPALLAGNTYVLKHAPNVMGSAYLLLDVMQRAGFPEGVFELLNVTPDGVSRAIADRRIAAVTLTGSVRAGIAIGAQAGAALKKCVLELGGSDPFIVLNDADLDEAVKAAVIGRYQNTGQVCAAAKRLIIEQGVVAEFTRKFVEATRALVMGDPLASDTYLGPMARFDLRDELHQQVQATLAEGATLLLGGDKVEGAGNYYQPTVLADVTEQMTAFRQELFGPVAAIISARDAQHALALANDSEFGLTATIFTQDLERARQMTDELETGGVFINGYSASDPRVTFGGVKKSGFGRELSHFGVREFCNAQTVWLDRR
>NZ_AP014628.1|WP_060844076.1|4327543_4327792_+|Arc-family-DNA-binding-protein
MCAPAQKFIVRLPGELHTQVKRIAKQENRSMNNEIVDRLEKSLVATEARSHDKKLINILLGKIATLEQQIESLQMNPPESNP
>NZ_AP014628.1|WP_060844077.1|4328035_4330216_+|TonB-dependent-siderophore-receptor
MNPAHSMSRSPAPSAGLPRHRLTLGLLLAGSHAVANAATELPSQTVSAQAPSGYQADSASVGGFSETPLLDTPAAISVINEDMILDQQARLLSDVLKNDASVGQSYAPVGYYENFEVRGFSLNAASSYKINNRTITGEQNVALENKQRVELLKGLSGLQSGVSEPGGLVNYVTKRPTDIRSVTVSTDDRGSGYLATDVGGWFGSEQQFGLRANLAHEDLHSYVEHTNGQRDFASLAFDWNISPDALLQLDIEYQNKQQRSAPGYQLLGGSSLPHHASPKKLLGHQSGSKPVTNESLNIDGNFEYRFNDDWTGSLSASRSKVVIDDYSSFAWGGCTTGCINANGNYFSPEGNYDIYDFRSPDDTRRNDEVQAVLNGRFDTEGLGHELSVGTSAFRRVVDRRESINQWIGTGNIQSEPENFERYNGALNDSHKRLDSRQYGLFLSDRISFNEQWQTVLGGREVRLDEESFDKDGVRDRHTQRYVFLPQAALIYKPISELSLYTQYSKGLSLGGQAPWFASNSGDTLAPTVSRQIEAGVKYDWQRMSFSAALFQMRQAYQYSRPDASGGFTYVQQGQQKNTGLELSANGWATQRLQIAASVAAIRSRVEDTGTSAYEGHQTLNVPRLRASLQGDYALPWLDGLALMGGMQYSGSKYADRQGNVATGAYAIFNIGSRYSTRIDGYETVFRLTVDNLFDKRYWRDAGEYMGDDYLFQGAPLTARLSASVNF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_AP014628_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_AP014628_4

5453365-5453465

Orphan

Consensus_repeat	Method
GCCATTAGTAATACGCACGGACT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_AP014628_4

>merge|NZ_AP014628|4|5453365-5453465|CRISPRCasFinder
GCCATTAGTAATACGCACGGACTCTGAACACCTTGACCATCAGCTCGGACAGGACACCGTCTAATGCGCGGGGGCTTCGCCATTAGTAATACGCACGGACT

>NZ_AP014628|4|4|5453365-5453465|CRISPRCasFinder
GCCATTAGTAATACGCACGGACT	CTGAACACCTTGACCATCAGCTCGGACAGGACACCGTCTAATGCGCGGGGGCTTC
GCCATTAGTAATACGCACGGACT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_AP014628.1\|WP_060844521.1\|5465168_5466116_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176106
NZ_AP014628.1\|WP_060844510.1\|5447815_5448916_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014628.1\|WP_060840866.1\|5462030_5463500_-\|IMP-dehydrogenase	unknown	unknown	gnl\|CDD\|235507
NZ_AP014628.1\|WP_082729293.1\|5456239_5457049_+\|restriction-endonuclease	unknown	unknown	gnl\|CDD\|377369
NZ_AP014628.1\|WP_060844512.1\|5451105_5451294_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014628.1\|WP_060845174.1\|5450314_5451103_+\|P-type-conjugative-transfer-protein-TrbJ	unknown	unknown	gnl\|CDD\|131827
NZ_AP014628.1\|WP_060844520.1\|5464295_5465066_-\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
NZ_AP014628.1\|WP_060844511.1\|5449004_5449376_-\|CopG-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|184361
NZ_AP014628.1\|WP_060844508.1\|5444125_5445010_-\|M24-family-metallopeptidase	unknown	unknown	gnl\|CDD\|235576
NZ_AP014628.1\|WP_060844516.1\|5455207_5456158_+\|LuxR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|129804
NZ_AP014628.1\|WP_148659674.1\|5457699_5458578_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014628.1\|WP_060844519.1\|5463616_5464165_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014628.1\|WP_060844513.1\|5451296_5452877_+\|P-type-conjugative-transfer-protein-TrbL	unknown	unknown	gnl\|CDD\|131830
NZ_AP014628.1\|WP_060844518.1\|5460348_5461926_-\|glutamine-hydrolyzing-GMP-synthase	unknown	unknown	gnl\|CDD\|234614
NZ_AP014628.1\|WP_082729291.1\|5449677_5450043_+\|TraK-oriT-binding-protein	unknown	unknown	gnl\|CDD\|379959
NZ_AP014628.1\|WP_060844509.1\|5445787_5447263_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014628.1\|WP_148659673.1\|5447343_5447586_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014628.1\|WP_082729292.1\|5454906_5455125_-\|AlpA-family-phage-regulatory-protein	unknown	unknown	gnl\|CDD\|283558
NZ_AP014628.1\|WP_060844514.1\|5452879_5453200_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014628.1\|WP_060845175.1\|5458829_5460041_-\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271182

Protein	Function_ID	Function_description	E-value
NZ_AP014628.1\|WP_060844521.1\|5465168_5466116_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176106	cd08414, PBP2_LTTR_aromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LTTRs involved in degradation of aromatic compounds, such as CbnR, BenM, CatM, ClcR and TfdR, as well as that of other transcriptional regulators clustered together in phylogenetic trees, including XapR, HcaR, MprR, IlvR, BudR, AlsR, LysR, and OccR. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the substrate-binding domains from ionotropic glutamate receptors, LysR-like transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	2.4121e-48
NZ_AP014628.1\|WP_082729293.1\|5456239_5457049_+\|restriction-endonuclease	gnl\|CDD\|377369	pfam04471, Mrr_cat, Restriction endonuclease. Prokaryotic family found in type II restriction enzymes containing the hallmark (D/E)-(D/E)XK active site. Presence of catalytic residues implicates this region in the enzymatic cleavage of DNA.	7.05022e-14
NZ_AP014628.1\|WP_060844508.1\|5444125_5445010_-\|M24-family-metallopeptidase	gnl\|CDD\|235576	PRK05716, PRK05716, methionine aminopeptidase; Validated.	1.65462e-43
NZ_AP014628.1\|WP_060844511.1\|5449004_5449376_-\|CopG-family-transcriptional-regulator	gnl\|CDD\|184361	PRK13877, PRK13877, conjugal transfer transcriptional regulator TraJ.	1.71479e-24
NZ_AP014628.1\|WP_060845174.1\|5450314_5451103_+\|P-type-conjugative-transfer-protein-TrbJ	gnl\|CDD\|131827	TIGR02780, TrbJ_protein, P-type conjugative transfer protein TrbJ. The TrbJ protein is found in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer. TrbJ is a homolog of the F-type TraE protein (which is believed to be an inner membrane pore-forming protein, TIGR02761) as well as the vir system VirB5 protein.	1.43715e-51
NZ_AP014628.1\|WP_060840866.1\|5462030_5463500_-\|IMP-dehydrogenase	gnl\|CDD\|235507	PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed.	0
NZ_AP014628.1\|WP_060844516.1\|5455207_5456158_+\|LuxR-family-transcriptional-regulator	gnl\|CDD\|129804	TIGR00721, Tfx_protein, DNA-binding protein, Tfx family. PSI-BLAST starting with one member of this family converges with significant hits only to other members of the family, which is restricted to the Archaea. Homology is strongest in the helix-turn-helix-containing N-terminal region. Tfx from Methanobacterium thermoautotrophicum is associated with the operon for molybdenum formyl-methanofuran dehydrogenase and binds a DNA sequence near its promoter. [Regulatory functions, DNA interactions].	0.00130011
NZ_AP014628.1\|WP_060844513.1\|5451296_5452877_+\|P-type-conjugative-transfer-protein-TrbL	gnl\|CDD\|131830	TIGR02783, probable_conjugal_transfer_protein_TrbL, P-type conjugative transfer protein TrbL. The TrbL protein is found in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer. TrbL is a homolog of the F-type TraG protein (which is believed to be a mating pair stabilization pore-forming protein, pfam07916) as well as the vir system VirB6 protein. [Cellular processes, Conjugation].	1.78484e-66
NZ_AP014628.1\|WP_060844518.1\|5460348_5461926_-\|glutamine-hydrolyzing-GMP-synthase	gnl\|CDD\|234614	PRK00074, guaA, GMP synthase; Reviewed.	0
NZ_AP014628.1\|WP_082729291.1\|5449677_5450043_+\|TraK-oriT-binding-protein	gnl\|CDD\|379959	pfam17273, DUF5338, Family of unknown function (DUF5338). This is a family of unknown function which can be found mostly in Proteobacteria.	1.057e-05
NZ_AP014628.1\|WP_060844520.1\|5464295_5465066_-\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	9.1841e-13
NZ_AP014628.1\|WP_082729292.1\|5454906_5455125_-\|AlpA-family-phage-regulatory-protein	gnl\|CDD\|283558	pfam05930, Phage_AlpA, Prophage CP4-57 regulatory protein (AlpA). This family consists of several short bacterial and phage proteins which are related to the E. coli protein AlpA. AlpA suppress two phenotypes of a delta lon protease mutant, overproduction of capsular polysaccharide and sensitivity to UV light. Several of the sequences in this family are thought to be DNA-binding proteins.	3.86543e-10
NZ_AP014628.1\|WP_060845175.1\|5458829_5460041_-\|site-specific-integrase	gnl\|CDD\|271182	cd00801, INT_P4_C, Bacteriophage P4 integrase, C-terminal catalytic domain. P4-like integrases are found in temperate bacteriophages, integrative plasmids, pathogenicity and symbiosis islands, and other mobile genetic elements. The P4 integrase mediates integrative and excisive site-specific recombination between two sites, called attachment sites, located on the phage genome and the bacterial chromosome. The phage attachment site is often found adjacent to the integrase gene, while the host attachment sites are typically situated near tRNA genes. This family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	3.55614e-60

>NZ_AP014628.1|WP_060844514.1|5452879_5453200_+|hypothetical-protein
MNSILMFAVFVVFASILAIAMWAFGRWLRSKGYGPLLDRLDRQCTALQLRVSPLALSASFHMFSGVQHLNRLPLLGSKSNAAQAQQILMAIRAAQEAQRLDSPGNR
>NZ_AP014628.1|WP_060844513.1|5451296_5452877_+|P-type-conjugative-transfer-protein-TrbL
MDTRLLLFLALASAFVSGDAMAATDLSHADTSVQGLLDLVLQQSHQWSGKLYDHAIRLFWLLASIQFIWTFMPLVMKQADFGEIVGELLRFVLVVGFFLAVMKYSVEWSSAIVDSFRDAAASASGLERALEPGDMLAVALDFGRTMVKGISVFSPAKGLLIAVCAILVLACFAFIAAFMFVTLVESYVIINASVLFFGFGGSQWTRDFAIAPMRFTVAIGAKLFVLTLIVGLIVQSAKQWLAAYTNDEASLMTMVGLALVCCYLTKTIPDLIGGMISGTSMGGGSAIGGMAAAGAAGAAAAIATIATAGAAAPAAAGALGAAGSSGAAGAGAAGAGGGLAGAINSSFAGASSAGGAAPSVGGGTPIGVGANTGGGAVAKTASSAGVKTGGGAATQSATPSSGTQQAAKQAGKAAQSGDDNDQKATPKGETVSSGNALSHAANGGAKALGVIASMTVPGMENAHSASLCAGLPQPAHGDSSSLKSAAPAAEAPGMESNVIRPDTNTSSNSGRTDVSSITSSNDQPEK
>NZ_AP014628.1|WP_060844512.1|5451105_5451294_+|hypothetical-protein
MTISKWLIALICSGSALTGFMVTMAVQSNSECNSLAEHQQQQRDADTSFEARPNTRGGVKGY
>NZ_AP014628.1|WP_060845174.1|5450314_5451103_+|P-type-conjugative-transfer-protein-TrbJ
MSNETPASPLQKFLRQAAYSTKIVGAAFIAMAVYIAPAPAYAIYCSNCSTFYQQIFEYAEAVNTALNTAEQLQTQVQQYQSMITQGTGLPDSMFGSIAADLKNVMNIYDRSQALGRQIQDMDSQFNTAFPGFNSYLNQAANSAESPAQDRYQTWSEQGRDNVKAALEAANLNTSTFESEGEQLDRMMTRSQSAVGRMQALQAGNEIASQNVQQLQKLRDLVATQINMQGNYLAQQGDRTAASEATEHQFEARKNTRGGVKGY
>NZ_AP014628.1|WP_082729291.1|5449677_5450043_+|TraK-oriT-binding-protein
MKNTPKEGLSGAGRVAFLARLEEFRVLIQAGWPVTVVYENHGGHKTSLSYSQFARYVGKYIRTPTKRGAQRTRATDGTQPPTTPLLEQRQSAHPTQPSTMSKRQPGFQHDPSSGNNRDDLI
>NZ_AP014628.1|WP_060844511.1|5449004_5449376_-|CopG-family-transcriptional-regulator
MTGGTKEKAPARRRGKPIEVWVTDEEKAVITERAEEVGMSRSGYLRALGLNTPIRSVVDLTAVADLAKVNGDLGRVAGLLKLWLAEKHGQGAEPVDVENLMVSFRDLQAQVRDLMSRVVYERK
>NZ_AP014628.1|WP_060844510.1|5447815_5448916_-|hypothetical-protein
MDLQEIIKQSKMLKPKSQKKMGENLLHLIDQIESSVILEGPYRLVIDSNIIMRLESYRQGVISEGLLSILLAFMLIRRLPYRFDMVVRPTVFYEYLRQKNLTSSHEHWRKFKELKDLVEEELGAKLFFDGIETYQGTEHYLKLIQSDSEKIAKALRLYQEKNWRFNFVQQAGRGFAGMPLSDPRFILVPPAFAAEALYSPLGLEYFDEQKASRFFIEYIEKNLIECEHNDKEVIEKYSDKKDFLFTKVLRLTPKGNLVGLADLDIYTTCNVQNQFSDQSHSRYAPASAGLTIDKNLALALRGATSHHITSGEINCGPDNENDIDAKMDAFQEEHKRMRESEKRHRLAWETSKAFMVDILAEGAFRS
>NZ_AP014628.1|WP_148659673.1|5447343_5447586_-|hypothetical-protein
MKEKSVKDQCHDESMAQKFCSDPNYLASLVEAVLLDGSEGEVDILRRQVEIALGECDTKGGESESVKKKLIQSSFLLWKR
>NZ_AP014628.1|WP_060844509.1|5445787_5447263_+|hypothetical-protein
MDATKRKIRIYFSDFFDVSREKIESYGAFNISLINDLPLFVDPFLLFNSDDTTYQELHKRIIQYMLFLKGKSSLALPSGLIKSWYLFPEVKQNWFGFSKSGNSGRGLGPSFAKSLQVNFKGVFSDFGNETNGATHIGKLTLVKHGVGKDQISDFTCNLIHGFLAEYTEKFAKKYIDPTKLQKFTIKKAEFNYATESWKSKQYLLPKFGGEHVLLTPVDILTKDEAWISHKGFIEDFSQVVGSVPNDQLRDQINLYLTKVMPADPTKDERAIAFEKTILQYPQLMDVYVSLQEANKDAASSSSFEKVSLAQKLFEENLLRLVALLDKTKFYDAEPNSYEAGMQRVQFLKHVIEKQDGYRLFYIKGVPISRESDLQIMFKLTWFASKFSADAEVNNGRGPADFLVSYGSQDKSIIEFKLAKNSHMEKNLRNQAKIYSDAARASNPPIMAILYFNFSERDKVHRIMTKNGLSDTKHIVLINAMPKESASKADID
>NZ_AP014628.1|WP_060844508.1|5444125_5445010_-|M24-family-metallopeptidase
MSVFGKLLRTLGLAAEAPELPSAMAQPLSRFDRFAADNREAFALIGALPEQEIVAEERRLAAEVTDILLSLKPFMVEGVSRLEIQEHMLQQLDSRQLLPALVGYKGYPAAVPVSVNAELIGCLPSEKCLPASALVKVEVVVSSRKGYGAQSWTFATPGASTEQLRLLSAAKDALEQGLRQVRGGESLGAIGSAIQEVLDAQGFSAVFEYCGYGMGRQRIQAPQVLGYRVAGRSEPMVAGQVLNVQVLAKAGTSRVRVMPNGWNVVAHDRCDGVVVSAMVRVTEVGAERLSRFVD
>NZ_AP014628.1|WP_082729292.1|5454906_5455125_-|AlpA-family-phage-regulatory-protein
MHPSSKKLIDKKTLLAMIPLCERTIYNFEMKGKFPRRIAVSSRKVVWDLAEVEEWIDTCRESGPAPRPGMAV
>NZ_AP014628.1|WP_060844516.1|5455207_5456158_+|LuxR-family-transcriptional-regulator
MVDMKKPSTIAIWEGCDTSLTEALHQFLDRWEPYSTASKRYPIVRLVEELIDPAVAAYAETLPSRYQGHIPGAGTNVAFSAIMQLVGVAAMVRLQRQLLRAFVLTHDKQSGDDRCFIATLETLIELVLACKRKQPSNKDMGGLNGQRLKGFCRFCGTRAELASFAEGEGQRDLDEHLRLSNLYCTTHRPKTLDGRWNPAYRQAMRSIAQFDLELARLSRQCAIRAEPKAKSGDELVDAYIFRYMLSQTLHLADEAELRNLARLMVDMKLTDRRKQILVLQKFGFNQSEIARRLEIERQAVSKAIHSIPDCFRLSTA
>NZ_AP014628.1|WP_082729293.1|5456239_5457049_+|restriction-endonuclease
MNSRSSAINGRYQNPDSDPRGPYLFSDVTSPFERPSLQYEWFGHYPPQGRSWRYSRERAAILEAEGRIALSSSGRPLLKRYLSEVESNTNVIENTTTSSQLDVIVRTAMKAIASEIAKNPRCLRDIEWRDLERVMREVFELLGFTTELTRSGKDGGFDIRLESKEHGETHVFLVEIKHWLASGKKPGSNVLSSLVDVVAKVGGKTKGILLSSSGFTRDILNGRTEIEQHTVRIAGRNKIVSLCQNYLESVEGVWTPTTSLSEMLLEGSD
>NZ_AP014628.1|WP_148659674.1|5457699_5458578_+|hypothetical-protein
MSAQIFGPDKNSNKRIYNLLILKGECLIKGHFSELRKGAANGDSYSNFYTAMSDQVDSILTYFINEEISASLPNRGPLTSILDQAIEDNYEKRHFKRLEFAKADLPDLFSNKTDFIIGSAFLDFKVGTYSVFEKYIGLLYDKIAPKDRLERKEKELVKYICLYSSCTDESKRSSILKKIKNINFYLSGAEKIEYVLSKCRDCDLDIVETRNFLNFYRKQRNTVHNLGVNEGEADSTTIKGIEISLGAQSASFTSDRNALIYAAKKLLRIYEKVERCIEGRLEGEINATKPTG
>NZ_AP014628.1|WP_060845175.1|5458829_5460041_-|site-specific-integrase
MLTDTKLRNLKSQDKLYKVIDRDGLYVAVTPAGSISFRYNYSINGRQETITFGRYGLGGITLAEARERLGEAKKMVAAGKSPAKEKARAKARTKGAETFDAWAEKWLRGYQMADSTRDMRRSVYERELKPKFGNQKLVEITHEDLRALTDAIVERGAPATAVHSREIVLQVFRWAIERGQKVENPADLVRPASIAKFEPRDRALTPDEIALMYQYMDRIGTATSVRAAAKLLLLTMVRKSELTNATWSEINFSEALWTIPKERMKRRNPHLVFLSQQALDFFIALKTLAGGSDYVLPSRYDSDLPMSAATINQVLTLTYRLAEKEGVPLGKFGPHDLRRTASTLLHEAGYNSDWIEKCLAHEQKGVRAVYNKAEYRDQRRAMLQDWADMIDEWTHKKPRKTNG
>NZ_AP014628.1|WP_060844518.1|5460348_5461926_-|glutamine-hydrolyzing-GMP-synthase
MALDIHAHRILILDFGSQYTQLIARRVREIGVYCELHPFDMDDEAIREFAPKGVILAGGPESVHEANSPRCPQAVFDLGVPVFGICYGMQTMAEQMGGKVEGSELREFGYARVDVVGKSRLLDGIEDHVDADGLFGLDVWMSHGDKVTKMPKDFHILASTPSCPIAGMFNDDLRYYGVQFHPEVTHTKQGGRILSRFILDICGCEALWTPSKIAEDAIAQIRAQVGTDNVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRLHEGEQVMAMFAENMGVKVIRANAEEQFLSNLAGESDPEKKRKIIGRTFIDVFDAESCKLENIKYLAQGTIYPDVIESAGAKSGKAHVIKSHHNVGGLPEEMNLKLVEPLRELFKDEVRRLGLELGLPYDMVYRHPFPGPGLGVRILGEVKKEYADLLRRADHIFIEELRKADWYHKVSQAFVVFQPVKSVGVVGDGRRYAWVVALRAVETIDFMTARWAHLPYELLETVSGRIINEIEGISRVTYDVSSKPPATIEWE
>NZ_AP014628.1|WP_060840866.1|5462030_5463500_-|IMP-dehydrogenase
MLRISQEALTFDDILLVPGYSEVLPNEVSLKTRLTRGIELNIPLVSAAMDTVTEARLAIAMAQEGGIGIIHKNMTIEQQAAEVRKVKRFEAGVVKDPITIEADATVRDLLELTNMHNISGVPVLHNGDLVGIVTSRDVRFESRLDVSVREVMTPKERLVTVKEGADKTAVRELLHKHRIERVLIVDDAFALKGMMTVNDIEKAKAYPLASKDDQGRLRVGAAVGTGKDTGDRVAALVNAGVDVVVVDTAHGHSKGVIDRVRWVKENFPEVQVIGGNIATGAAAKALAEAGADAVKVGIGPGSICTTRIVAGVGVPQISAIANVAAALVGTGVPLIADGGIRFSGDLSKAIVAGASCVMMGSMFAGTEEAPGEIELFQGRSYKAYRGMGSLGAMSQAQGSSDRYFQDSSAGAEKLVPEGIEGRVPYKGTLTAIIHQLMGGLRSSMGYTGSANIEEMRTKPEFVRITGAGMAESHVHDVQITKEAPNYRVG
>NZ_AP014628.1|WP_060844519.1|5463616_5464165_-|hypothetical-protein
MNSQSILVPKISTLPVHEPRARAIVRWLVRKNIVEETLSTCGRTGNRMGHAIASGARDVVLRPEALPFGEPINGLEIITKRCIYTPAKGFLEEAGCAECRQEIGEALFESLEDWMPGRTDNFTCPECGHEDDINGFLFLQECGFSNLGFIFNNWAEAGFKQSFIDEFADWLDQPISWVKVEL
>NZ_AP014628.1|WP_060844520.1|5464295_5465066_-|sulfite-exporter-TauE/SafE-family-protein
MSVIIEGLSQWSFGPGAWLAIGLGIALAYIVFGIAGFGTALVAGPVLILFMPLSKIVPLLVLLDFVAAFGNLLPSRKDVARPELLRLLPCMALGCTLGVIFLLNLKSDLLLLLMGLFISAYAIYSLWVKVRPAQLAAGWAVPMGIVGGMFGALFGSGGFLYAIYLNSRLPKDPARATQSALISCSTVVRLSLFALAGVYAEWPLLLLAGCLLPAMALGLWVGRRLTMKLSREAFVRLVTWLVLASGFALIGRYLST
>NZ_AP014628.1|WP_060844521.1|5465168_5466116_+|LysR-family-transcriptional-regulator
MISTRQLRYFVEIAESGSFSAAAERLFVAQSALSRQIKELEGQLQTPLFQRTARQPRLTAAGEAFLPKARNLLSELHKAAELATQVGQGQLGTLRLSHSSTVPMSGRLLRGISEYLQACPGASMDIVKLSSEAQLQELAEGRLDAGLLRMPVLRQREGVQIVPLFSEPLLLALPPQHPLALDPPARGVELAQLRNEAFISIPHPQRGGLSYLSAQLCMRQGFFPKAARVMSRKTTQLQLIQAGFGIALLPESMQDIAPTSVRFLPLADSDCQSTVALAYRQDPTPLVAQFVEQLRNHWQSNCVVPWTDSPLNCAP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1327764 : 1432573

110

Pseudomonas_phage(36.67%)

plate,bacteriocin,tail,protease,tRNA,holin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060842598.1\|1327764_1328574_+\|tRNA	tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA	S4VW33	Pandoravirus	2.2e-08	33.0
WP_060842599.1\|1328701_1329112_-	SufE family protein	NA	NA	NA	NA
WP_060837757.1\|1329108_1330314_-	aminotransferase class V-fold PLP-dependent enzyme	Q2XUY6	environmental_halophage	3.7e-68	35.6
WP_015634328.1\|1330390_1331425_-	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
WP_011059519.1\|1331458_1331821_-	ArsC family reductase	NA	NA	NA	NA
WP_060837758.1\|1332058_1333705_+	Na+/H+ antiporter	NA	NA	NA	NA
WP_060837759.1\|1333777_1334977_-	succinyldiaminopimelate transaminase	NA	NA	NA	NA
WP_060842600.1\|1335015_1337718_-	[protein-PII] uridylyltransferase	NA	NA	NA	NA
WP_047302039.1\|1337766_1338549_-	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_011059524.1\|1338956_1339694_+	30S ribosomal protein S2	NA	NA	NA	NA
WP_060837761.1\|1339897_1340764_+	elongation factor Ts	NA	NA	NA	NA
WP_011059526.1\|1340972_1341716_+	UMP kinase	NA	NA	NA	NA
WP_011059527.1\|1341712_1342270_+	ribosome recycling factor	NA	NA	NA	NA
WP_047302041.1\|1342285_1343041_+	di-trans,poly-cis-decaprenylcistransferase	R9W0U9	Flavobacterium_phage	8.5e-18	38.1
WP_060837762.1\|1343040_1343847_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_060837763.1\|1343843_1345034_+	1-deoxy-D-xylulose-5-phosphate reductoisomerase	NA	NA	NA	NA
WP_060842601.1\|1345082_1346435_+\|protease	sigma E protease regulator RseP	NA	NA	NA	NA
WP_060842602.1\|1346509_1348897_+	outer membrane protein assembly factor BamA	NA	NA	NA	NA
WP_016964695.1\|1348942_1349446_+	OmpH family outer membrane protein	NA	NA	NA	NA
WP_060842603.1\|1349449_1350505_+	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
WP_007924058.1\|1350614_1351055_+	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_060837767.1\|1351051_1351828_+	acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase	NA	NA	NA	NA
WP_173664426.1\|1351827_1352961_+	lipid-A-disaccharide synthase	NA	NA	NA	NA
WP_060837769.1\|1352972_1353605_+	ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	4.4e-28	40.0
WP_060837770.1\|1353674_1357196_+	DNA polymerase III subunit alpha	A0A2L1IZ23	Streptomyces_phage	5.6e-197	38.1
WP_016964689.1\|1357335_1358283_+	acetyl-CoA carboxylase carboxyltransferase subunit alpha	NA	NA	NA	NA
WP_060842605.1\|1358419_1359736_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_016964687.1\|1360010_1361642_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	2.4e-158	53.6
WP_042940934.1\|1361647_1362493_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	7.9e-49	42.4
WP_060837772.1\|1362650_1363940_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	9.0e-137	59.7
WP_011059544.1\|1364112_1364391_+	cell division protein FtsB	NA	NA	NA	NA
WP_060837773.1\|1364387_1365095_+	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	NA	NA	NA	NA
WP_060837774.1\|1365211_1366111_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_060837775.1\|1366215_1367328_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	1.9e-29	27.4
WP_060842606.1\|1367415_1368261_+	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_060837777.1\|1368313_1368787_+	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_060842607.1\|1368783_1369842_+\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
WP_047302063.1\|1369829_1370579_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	3.0e-68	53.0
WP_173655928.1\|1370620_1371256_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	2.1e-41	49.8
WP_082729181.1\|1371467_1372340_+	peptidoglycan DD-metalloendopeptidase family protein	A0A0S2SXL7	Bacillus_phage	6.6e-06	33.3
WP_016964675.1\|1372446_1373454_+	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	6.6e-34	35.8
WP_016964674.1\|1373971_1374295_-	ferredoxin family protein	NA	NA	NA	NA
WP_060842608.1\|1374437_1377017_-	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	1.4e-27	24.0
WP_060837780.1\|1377203_1377950_+	helix-turn-helix transcriptional regulator	B5TK58	Pseudomonas_phage	1.0e-124	89.9
WP_016967167.1\|1378468_1378819_+\|holin	pyocin R2, holin	B5TK61	Pseudomonas_phage	3.7e-53	89.7
WP_060842609.1\|1378899_1379421_+	hypothetical protein	A0A2H4J881	uncultured_Caudovirales_phage	7.6e-18	32.4
WP_060842610.1\|1379417_1380008_+\|plate	phage baseplate assembly protein V	A0A2H4JG06	uncultured_Caudovirales_phage	3.2e-57	77.1
WP_060837783.1\|1380088_1380292_+	hypothetical protein	NA	NA	NA	NA
WP_060842611.1\|1380296_1380623_+	GPW/gp25 family protein	A0A2H4JA09	uncultured_Caudovirales_phage	1.3e-36	68.5
WP_060842612.1\|1380619_1381501_+\|plate	baseplate J/gp47 family protein	A0A2H4JFK9	uncultured_Caudovirales_phage	1.3e-97	64.0
WP_060842613.1\|1381502_1382108_+\|tail	phage tail protein I	A0A2H4JDH5	uncultured_Caudovirales_phage	1.8e-74	67.3
WP_148659596.1\|1382104_1384525_+\|tail	phage tail protein	A0A077K818	Ralstonia_phage	5.9e-105	42.4
WP_173664427.1\|1384592_1384961_+	hypothetical protein	Q9ZXK5	Pseudomonas_virus	4.5e-17	43.2
WP_060842615.1\|1385063_1386230_+\|tail	phage tail sheath family protein	A0A2H4J869	uncultured_Caudovirales_phage	6.0e-180	80.7
WP_016965333.1\|1386242_1386752_+\|tail	phage major tail tube protein	A0A2H4JBU0	uncultured_Caudovirales_phage	8.7e-67	73.7
WP_060842616.1\|1386764_1387070_+\|tail	phage tail assembly protein	A0A2H4J873	uncultured_Caudovirales_phage	4.0e-19	55.1
WP_060842617.1\|1387211_1389767_+\|tail	phage tail tape measure protein	A0A2H4JG00	uncultured_Caudovirales_phage	2.8e-73	34.1
WP_060842618.1\|1389776_1390622_+\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	1.5e-95	63.2
WP_060842619.1\|1390596_1390803_+\|tail	tail protein X	A0A2H4J9Z9	uncultured_Caudovirales_phage	1.9e-20	71.6
WP_060842620.1\|1390864_1391920_+	late control protein	A0A2H4JBF6	uncultured_Caudovirales_phage	1.3e-146	77.4
WP_060842621.1\|1392024_1393176_+	glycosyl hydrolase	A0A2L0HM30	Microbacterium_phage	7.6e-10	29.1
WP_019093183.1\|1393242_1393434_+	hypothetical protein	NA	NA	NA	NA
WP_016964892.1\|1393524_1394016_+\|tail	major tail subunit	H2BDC0	Pseudomonas_virus	4.6e-49	62.2
WP_016964891.1\|1394024_1394375_+\|tail	phage tail assembly chaperone family protein, TAC	NA	NA	NA	NA
WP_060845073.1\|1394404_1394659_+	hypothetical protein	Q9MCA3	Pseudomonas_phage	8.5e-15	50.6
WP_060842622.1\|1394718_1396128_+\|tail	phage tail tape measure protein	A0A2H4J9A1	uncultured_Caudovirales_phage	1.7e-27	31.6
WP_060842623.1\|1396167_1396506_+\|tail	phage tail protein	A0A0S2SYI2	Pseudomonas_phage	1.6e-32	52.7
WP_177342978.1\|1396502_1397747_+	hypothetical protein	A0A2H4J2B7	uncultured_Caudovirales_phage	3.7e-10	34.6
WP_082729182.1\|1397747_1398044_+	hypothetical protein	A0A2H4J9Z7	uncultured_Caudovirales_phage	1.6e-20	50.5
WP_060842624.1\|1398043_1398307_+	hypothetical protein	NA	NA	NA	NA
WP_019093175.1\|1398355_1399039_+\|tail	phage minor tail protein L	A0A2I6PIA7	Pseudomonas_phage	1.7e-86	65.6
WP_060842625.1\|1399041_1399818_+\|tail	phage tail protein	A0A2I6PI52	Pseudomonas_phage	2.0e-86	56.0
WP_060842626.1\|1399873_1400506_+\|tail	tail assembly protein	A0A2I6PI69	Pseudomonas_phage	7.0e-50	52.7
WP_060842627.1\|1400572_1401181_+\|tail	tail assembly protein	A0A1P8DTG7	Proteus_phage	1.4e-42	46.7
WP_060842628.1\|1401241_1404334_+	host specificity protein J	Q3HQU5	Burkholderia_phage	2.2e-298	48.6
WP_148659597.1\|1404342_1404624_+	hypothetical protein	NA	NA	NA	NA
WP_148659598.1\|1404620_1405340_+	hypothetical protein	NA	NA	NA	NA
WP_060842629.1\|1405759_1406344_+	hypothetical protein	B5TK65	Pseudomonas_phage	4.6e-72	66.7
WP_047302105.1\|1406340_1406523_+	DUF2635 domain-containing protein	B5TK66	Pseudomonas_phage	7.7e-18	76.7
WP_060842630.1\|1406522_1408019_+\|tail	phage tail sheath subtilisin-like domain-containing protein	B5TK67	Pseudomonas_phage	2.7e-249	87.6
WP_016965085.1\|1408085_1408433_+\|tail	phage tail tube protein	B5TK68	Pseudomonas_phage	4.4e-54	87.0
WP_060842631.1\|1408429_1408726_+\|tail	phage tail assembly protein	B5TK69	Pseudomonas_phage	9.5e-42	90.8
WP_060842632.1\|1408856_1410578_+\|tail	phage tail protein	B5TK70	Pseudomonas_phage	4.5e-59	58.1
WP_060842633.1\|1410567_1411812_+	DNA circularization N-terminal domain-containing protein	B5TK71	Pseudomonas_phage	5.4e-171	73.2
WP_060842634.1\|1411815_1412856_+\|plate	baseplate protein	B5TK72	Pseudomonas_phage	2.5e-153	79.5
WP_060837800.1\|1412964_1413471_+\|plate	phage baseplate assembly protein	B5TK73	Pseudomonas_phage	6.6e-75	86.9
WP_060837801.1\|1413473_1413872_+	phage GP46 family protein	B5TK74	Pseudomonas_phage	2.5e-61	84.8
WP_060842635.1\|1413861_1414902_+\|plate	baseplate J/gp47 family protein	B5TK75	Pseudomonas_phage	2.3e-159	83.7
WP_060842636.1\|1414889_1415489_+	DUF2313 domain-containing protein	B5TK76	Pseudomonas_phage	4.0e-95	82.9
WP_148659683.1\|1415540_1417292_+\|tail	tail fiber protein	A0A1W6JT73	Escherichia_phage	7.7e-22	36.6
WP_082729183.1\|1417288_1417651_+\|tail	tail fiber assembly protein	NA	NA	NA	NA
WP_082729184.1\|1418991_1419420_+\|tail	tail fiber assembly protein	NA	NA	NA	NA
WP_016966077.1\|1419470_1420034_+	glycoside hydrolase family 19 protein	B5TK83	Pseudomonas_phage	6.6e-84	81.1
WP_060842638.1\|1420190_1420697_+	hypothetical protein	A0A1S5NQ26	Burkholderia_phage	4.0e-24	62.1
WP_082729320.1\|1420767_1420953_+	Com family DNA-binding transcriptional regulator	B5TK59	Pseudomonas_phage	1.3e-12	89.5
WP_060837808.1\|1420961_1421804_+\|bacteriocin	putidacin L1 family lectin-like bacteriocin	NA	NA	NA	NA
WP_020372545.1\|1421981_1422314_+	hypothetical protein	NA	NA	NA	NA
WP_060842639.1\|1422480_1422981_+	CinA family protein	B5TK85	Pseudomonas_phage	8.8e-72	84.9
WP_011059579.1\|1423064_1424117_+	recombinase RecA	A0A0S2MVG1	Bacillus_phage	2.0e-113	61.0
WP_060837811.1\|1424125_1424593_+	recombination regulator RecX	NA	NA	NA	NA
WP_060837812.1\|1424632_1425751_-	TIGR00730 family Rossman fold protein	NA	NA	NA	NA
WP_060837813.1\|1426191_1426386_+	hypothetical protein	NA	NA	NA	NA
WP_060837814.1\|1426386_1426812_-	quorum-sensing-regulated virulence factor family protein	NA	NA	NA	NA
WP_060837815.1\|1427003_1427714_+	DTW domain-containing protein	NA	NA	NA	NA
WP_060842640.1\|1427697_1428606_-	DMT family transporter	NA	NA	NA	NA
WP_060837817.1\|1428844_1429495_+	response regulator transcription factor	NA	NA	NA	NA
WP_173655929.1\|1429564_1429933_+	diacylglycerol kinase	NA	NA	NA	NA
WP_060842641.1\|1429929_1430856_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_016966062.1\|1430975_1431755_+	ferredoxin--NADP reductase	NA	NA	NA	NA
WP_060842642.1\|1431877_1432573_-\|tRNA	tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO	NA	NA	NA	NA

DBSCAN-SWA_2

2050303 : 2095453

Pseudomonas_phage(63.64%)

plate,capsid,tail,protease,terminase,portal,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060842879.1\|2050303_2051467_-	DUF3596 domain-containing protein	A0A2H4JGM5	uncultured_Caudovirales_phage	1.3e-134	59.8
WP_060842880.1\|2051736_2051985_-	hypothetical protein	NA	NA	NA	NA
WP_060842881.1\|2052051_2052345_-	hypothetical protein	NA	NA	NA	NA
WP_060842882.1\|2052360_2055159_-	toprim domain-containing protein	A0A2H4J936	uncultured_Caudovirales_phage	0.0e+00	65.3
WP_060842883.1\|2055162_2055396_-	hypothetical protein	NA	NA	NA	NA
WP_060842884.1\|2055470_2055836_-	hypothetical protein	A0A2H4J947	uncultured_Caudovirales_phage	1.1e-07	36.3
WP_060842885.1\|2055832_2056342_-	hypothetical protein	A0A2H4JG61	uncultured_Caudovirales_phage	7.6e-47	60.3
WP_060842886.1\|2056341_2056542_-	DNA-binding protein	A0A2H4JE67	uncultured_Caudovirales_phage	2.2e-10	54.0
WP_060842887.1\|2056626_2056965_+	helix-turn-helix transcriptional regulator	A4JWR8	Burkholderia_virus	6.5e-10	44.8
WP_060842888.1\|2057053_2057236_+	hypothetical protein	NA	NA	NA	NA
WP_060845088.1\|2057276_2057537_-	ogr/Delta-like zinc finger family protein	A5X9H0	Aeromonas_virus	2.5e-14	42.2
WP_060842889.1\|2057610_2058480_-\|portal	phage portal protein	A0A0U4B0L9	Pseudomonas_phage	1.1e-101	77.5
WP_060842890.1\|2058391_2060440_-\|terminase	terminase	A0A0U4JIZ9	Pseudomonas_phage	9.0e-248	65.9
WP_060842891.1\|2060603_2061521_+\|capsid	GPO family capsid scaffolding protein	A0A0U4JVV6	Pseudomonas_phage	2.8e-63	48.4
WP_060842892.1\|2061522_2062545_+\|capsid	phage major capsid protein, P2 family	A0A0U4K5I9	Pseudomonas_phage	1.8e-116	64.2
WP_060842893.1\|2062541_2063261_+\|terminase	terminase	A0A0U4JEJ1	Pseudomonas_phage	4.2e-75	66.7
WP_060842894.1\|2063360_2063822_+\|head	head completion/stabilization protein	A0A0U4J933	Pseudomonas_phage	1.1e-44	61.4
WP_060842895.1\|2063818_2064271_+\|tail	phage tail protein	A0A0U4IBS7	Pseudomonas_phage	3.1e-52	68.9
WP_060842896.1\|2064257_2064941_+	phage virion morphogenesis protein	A0A0U4ISN1	Pseudomonas_phage	3.4e-66	62.9
WP_060842897.1\|2064952_2066062_+	DUF2586 family protein	A0A0U4KLE6	Pseudomonas_phage	1.4e-146	71.3
WP_060842898.1\|2066074_2066524_+	DUF2597 family protein	A0A0U3TH58	Pseudomonas_phage	2.6e-59	73.8
WP_060842899.1\|2066523_2066736_+	TraR/DksA family transcriptional regulator	A0A0U4IIN4	Pseudomonas_phage	2.4e-15	63.1
WP_060842900.1\|2066732_2067125_+	peptidase M15	A0A1D9C9S9	Salinivibrio_phage	6.3e-33	52.3
WP_060842901.1\|2067126_2067342_+	hypothetical protein	NA	NA	NA	NA
WP_060842902.1\|2067331_2067694_+	DUF1353 domain-containing protein	M1PQ58	Synechococcus_phage	3.6e-27	53.2
WP_060842903.1\|2067695_2067947_+	hypothetical protein	NA	NA	NA	NA
WP_060842904.1\|2067943_2068234_+\|tail	putative phage tail assembly chaperone	A0A0U4B0P2	Pseudomonas_phage	6.7e-24	66.3
WP_159426272.1\|2068254_2068398_+	hypothetical protein	A0A0U4B0S4	Pseudomonas_phage	1.4e-14	76.1
WP_060842905.1\|2068404_2070387_+\|tail	phage tail tape measure protein	A0A0U4IJ81	Pseudomonas_phage	5.1e-139	42.8
WP_060842906.1\|2070383_2070701_+	DUF2590 family protein	A0A0U4B0N5	Pseudomonas_phage	5.4e-35	75.5
WP_060842907.1\|2070697_2071873_+\|plate	baseplate J/gp47 family protein	A0A0U4JJ14	Pseudomonas_phage	2.3e-155	71.2
WP_060842908.1\|2071869_2072394_+\|tail	phage tail protein	A0A0U4JVX3	Pseudomonas_phage	6.8e-75	76.4
WP_060842909.1\|2072403_2074077_+\|tail	phage tail protein	A0A0U4K5K2	Pseudomonas_phage	1.7e-127	46.7
WP_060842910.1\|2074085_2074796_+	hypothetical protein	A0A0U4JEJ6	Pseudomonas_phage	4.2e-59	48.7
WP_060842911.1\|2074792_2075716_+	hypothetical protein	NA	NA	NA	NA
WP_060842912.1\|2075712_2076246_+	hypothetical protein	A0A0U4J942	Pseudomonas_phage	1.5e-56	65.7
WP_060842913.1\|2076242_2076947_+	hypothetical protein	A0A1D9CA29	Salinivibrio_phage	9.6e-40	37.4
WP_060842914.1\|2076919_2077891_+	hypothetical protein	A0A0U4IBV2	Pseudomonas_phage	2.6e-96	55.3
WP_148659611.1\|2077887_2078889_-	hypothetical protein	NA	NA	NA	NA
WP_148659612.1\|2078928_2079858_-	hypothetical protein	NA	NA	NA	NA
WP_148659613.1\|2081060_2081366_+	hypothetical protein	NA	NA	NA	NA
WP_016964335.1\|2081455_2081647_+	hypothetical protein	NA	NA	NA	NA
WP_060838270.1\|2082117_2082558_+	hypothetical protein	NA	NA	NA	NA
WP_047302868.1\|2082955_2083321_+	hypothetical protein	NA	NA	NA	NA
WP_164990755.1\|2083429_2083591_+	hypothetical protein	NA	NA	NA	NA
WP_060842916.1\|2083744_2084440_+	HAD-IA family hydrolase	M1IMD4	Acanthocystis_turfacea_Chlorella_virus	1.9e-08	30.6
WP_060842917.1\|2084564_2085311_-	3-oxoacyl-ACP reductase FabG	NA	NA	NA	NA
WP_060842918.1\|2085436_2086360_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_060842919.1\|2086396_2087125_-	Asp/Glu/hydantoin racemase	NA	NA	NA	NA
WP_060842920.1\|2087180_2088728_-	NCS1 family nucleobase:cation symporter-1	NA	NA	NA	NA
WP_016964342.1\|2089243_2089978_-	phosphoadenylyl-sulfate reductase	NA	NA	NA	NA
WP_060842921.1\|2090153_2090771_+	bifunctional phosphoserine phosphatase/homoserine phosphotransferase ThrH	NA	NA	NA	NA
WP_060842922.1\|2090885_2092229_-	aminodeoxychorismate synthase component I	S4VNU7	Pandoravirus	1.2e-46	33.8
WP_060838276.1\|2092392_2093379_-	alpha-L-glutamate ligase-like protein	NA	NA	NA	NA
WP_060838277.1\|2093378_2094911_-	inactive transglutaminase family protein	NA	NA	NA	NA
WP_060838278.1\|2094916_2095453_-\|protease	ATP-dependent zinc protease	NA	NA	NA	NA

DBSCAN-SWA_3

4367984 : 4374204

uncultured_Caudovirales_phage(83.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060840113.1\|4367984_4368377_+	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	9.0e-56	81.4
WP_060840114.1\|4368378_4368741_+	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	4.4e-41	70.0
WP_060844099.1\|4368740_4369037_+	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	7.8e-28	64.6
WP_016966956.1\|4369033_4369369_+	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	8.0e-45	78.4
WP_060844100.1\|4369365_4370367_+	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	1.6e-168	85.9
WP_060844101.1\|4370455_4371457_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_060840118.1\|4371528_4372923_-	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_060840119.1\|4372923_4374204_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.7e-98	53.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_AP014628

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection