CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_AP014868	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK4, complete sequence	0 crisprs	NA	0	0	0
NZ_AP014870	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK6	0 crisprs	NA	0	0	1
NZ_AP014867	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK3, complete sequence	0 crisprs	RT	0	0	1
NZ_AP014872	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK8, complete sequence	0 crisprs	NA	0	0	0
NZ_AP014865	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence	1 crisprs	csa3,cas14j,cas3,RT	1	1	2
NZ_AP014871	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK7, complete sequence	0 crisprs	NA	0	0	0
NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	2 crisprs	cas7,cas8c,cas5,cas3,RT,csa3,cas14j	0	22	2
NZ_AP014864	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain	3 crisprs	cas14k,DEDDh,csa3,cas3,RT,WYL,DinG,c2c9_V-U4	1	0	22
NZ_AP014869	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK5, complete sequence	0 crisprs	NA	0	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

352 : 14119

Bacillus_phage(100.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060852795.1\|352_3049_+	hypothetical protein	S5Z7F3	Bacillus_phage	0.0e+00	94.7
WP_016124063.1\|3413_4211_-	N-acetylmuramoyl-L-alanine amidase	A0A160LKP9	Bacillus_phage	5.6e-137	99.6
WP_060852796.1\|4212_5100_-	hypothetical protein	Q5ILA2	Bacillus_phage	7.2e-85	51.7
WP_060852797.1\|5103_6012_-	hypothetical protein	Q5ILA3	Bacillus_phage	6.9e-115	79.1
WP_021729042.1\|6024_6537_-	hypothetical protein	Q5ILA4	Bacillus_phage	8.7e-91	99.4
WP_060852798.1\|6484_7237_-	glucosaminidase domain-containing protein	Q5ILA5	Bacillus_phage	2.3e-132	97.6
WP_060852799.1\|7236_7851_-	hypothetical protein	A0A160LKP5	Bacillus_phage	9.8e-73	95.1
WP_021729040.1\|7854_8130_-	hypothetical protein	Q5ILA7	Bacillus_phage	1.1e-47	97.8
WP_023901799.1\|8143_8290_-	hypothetical protein	Q5ILA8	Bacillus_phage	6.1e-18	97.9
WP_023901798.1\|8286_8463_-	hypothetical protein	Q5ILA9	Bacillus_phage	5.0e-22	98.3
WP_060852800.1\|8459_8927_-	hypothetical protein	Q5ILB0	Bacillus_phage	2.3e-18	97.9
WP_000339993.1\|9000_9207_-	hypothetical protein	A0A160LKQ4	Bacillus_phage	2.5e-12	100.0
WP_021729037.1\|9210_9441_-	hypothetical protein	Q5ILB3	Bacillus_phage	1.0e-35	97.4
WP_060852801.1\|9482_10553_-	hypothetical protein	A0A160LKS4	Bacillus_phage	2.7e-187	90.4
WP_060852802.1\|10552_10855_-	hypothetical protein	Q5ILB5	Bacillus_phage	2.2e-33	77.0
WP_171840974.1\|10856_10997_-	hypothetical protein	Q5ILB6	Bacillus_phage	1.9e-16	91.3
WP_023901797.1\|11013_11154_-	hypothetical protein	Q5ILB8	Bacillus_phage	4.2e-16	95.7
WP_060852808.1\|11168_11807_-	hypothetical protein	A0A161J814	Bacillus_phage	2.5e-119	96.2
WP_060852803.1\|11872_12457_-	hypothetical protein	A0A160LKS6	Bacillus_phage	5.1e-55	79.3
WP_060852804.1\|12444_12813_-	hypothetical protein	Q5ILC3	Bacillus_phage	9.2e-10	91.0
WP_060852805.1\|12787_13054_-	hypothetical protein	S5YPF7	Bacillus_phage	6.8e-23	62.8
WP_060852806.1\|13186_13525_-	helix-turn-helix domain-containing protein	S5Y6I2	Bacillus_phage	4.4e-43	79.5
WP_060852809.1\|13555_14119_-	hypothetical protein	S5Z7C9	Bacillus_phage	5.2e-81	80.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_AP014867

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

24773 : 91097

Bacillus_phage(29.41%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060852562.1\|24773_26348_-\|transposase	IS21 family transposase	U5N3F9	Enterobacteria_phage	1.5e-21	27.7
WP_171840967.1\|27625_28549_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_000169374.1\|29053_30361_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	8.6e-26	29.7
WP_060852728.1\|32621_32972_-	lipocalin-like domain-containing protein	NA	NA	NA	NA
WP_060852729.1\|35461_36820_-	hypothetical protein	A0A1V0E017	Clostridioides_phage	1.1e-07	25.4
WP_060852730.1\|36974_39695_-	RICIN domain-containing protein	A0A1V0E026	Clostridioides_phage	5.3e-86	31.5
WP_060852731.1\|39732_41913_-	hypothetical protein	NA	NA	NA	NA
WP_060852732.1\|43401_44691_-	VanW family protein	NA	NA	NA	NA
WP_060852733.1\|44859_45708_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_060852734.1\|46021_47473_+	spore germination protein	NA	NA	NA	NA
WP_060852735.1\|47469_48546_+	endospore germination permease	NA	NA	NA	NA
WP_060852736.1\|48545_49646_+	Ger(x)C family spore germination protein	NA	NA	NA	NA
WP_081097662.1\|50537_51290_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_000275580.1\|52349_53645_+\|transposase	IS21-like element IS232 family transposase	A0A059NT83	Lactococcus_phage	1.0e-42	31.0
WP_000798699.1\|53634_54387_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	7.0e-57	47.3
WP_171840968.1\|54707_55916_+	hypothetical protein	NA	NA	NA	NA
WP_081097657.1\|57114_58545_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_060852738.1\|60495_62139_-	hypothetical protein	NA	NA	NA	NA
WP_153598656.1\|62887_63034_+	hypothetical protein	NA	NA	NA	NA
WP_171840969.1\|63505_63670_-	hypothetical protein	NA	NA	NA	NA
WP_060852739.1\|64225_64738_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_145977436.1\|64759_65116_-	zinc-finger domain-containing protein	NA	NA	NA	NA
WP_060852741.1\|66592_66919_+	helix-turn-helix transcriptional regulator	A0A0A7AQV8	Bacillus_phage	1.1e-22	52.1
WP_171840970.1\|67251_67407_-	hypothetical protein	NA	NA	NA	NA
WP_060852742.1\|67403_68627_-	hypothetical protein	A0A1B1P895	Bacillus_phage	1.8e-150	66.1
WP_060852743.1\|68826_70470_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000843047.1\|71114_71393_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	3.0e-13	59.0
WP_003308768.1\|71729_71924_+	hypothetical protein	NA	NA	NA	NA
WP_060852744.1\|72169_72442_+	HU family DNA-binding protein	A7KV42	Bacillus_phage	4.1e-23	65.6
WP_060852745.1\|73492_74551_-	DUF4065 domain-containing protein	A0A0N9SGM1	Paenibacillus_phage	6.7e-21	41.5
WP_060852746.1\|74580_74991_-	type II toxin-antitoxin system MqsR family toxin	NA	NA	NA	NA
WP_060852562.1\|75313_76888_+\|transposase	IS21 family transposase	U5N3F9	Enterobacteria_phage	1.5e-21	27.7
WP_060852563.1\|76899_77679_+	ATP-binding protein	U5N3V8	Enterobacteria_phage	3.3e-33	32.2
WP_060852747.1\|78084_79350_+	Y-family DNA polymerase	O64031	Bacillus_phage	1.2e-101	46.0
WP_060852748.1\|79346_79688_+	YolD-like family protein	NA	NA	NA	NA
WP_060852749.1\|79736_80111_+	hypothetical protein	D2XQ01	Bacillus_virus	8.1e-30	50.8
WP_033699747.1\|80331_80583_-	hypothetical protein	NA	NA	NA	NA
WP_060852750.1\|80902_82018_-	RapH N-terminal domain-containing protein	A0A2H4J8G3	uncultured_Caudovirales_phage	4.3e-95	49.3
WP_060852751.1\|82322_83015_+	hypothetical protein	NA	NA	NA	NA
WP_060852752.1\|83283_83718_+	disulfide bond formation protein B	NA	NA	NA	NA
WP_060852753.1\|83714_84137_+	thioredoxin family protein	NA	NA	NA	NA
WP_060852754.1\|84403_85039_-	DUF3967 domain-containing protein	A0A1Z1LZN4	Bacillus_phage	2.7e-09	36.6
WP_060852755.1\|85303_86215_-	bacteriophage abortive infection AbiH family protein	NA	NA	NA	NA
WP_060852756.1\|86419_87193_-	DUF2971 domain-containing protein	NA	NA	NA	NA
WP_171840971.1\|87313_87472_-	hypothetical protein	NA	NA	NA	NA
WP_060852757.1\|88133_88616_+	thioredoxin family protein	NA	NA	NA	NA
WP_060852758.1\|89660_91097_+\|transposase	IS4 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_AP014866

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_AP014866_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_AP014866_1

6398-7021

TypeI

NA:I-C

Consensus_repeat	Method
ATTTCAATCCACGCACCTATATGAGGTGCGAC	CRISPRCasFinder
ATTTCAATCCACGCACCTATAT	CRT
ATTTCAATCCACGCACCTATATGAGGTGCGAC	PILER-CR

9 spacers

cas3,cas5,cas8c,cas7

The CRISPR arrays of NZ_AP014866_1

>merge|NZ_AP014866|1|6398-7021|CRISPRCasFinder,CRT,PILER-CR
ATTTCAATCCAAGCACCTATATGAGGTGCAATCATGACTGAATTTTGTCAAAATTGTGATATTATATTTCAATCCACACACCTATTTAAGGTGCGACTATGAGCGTTCCAGATAAATATAAACCCGAGGTAATTTCAATCCATGCACCTATATGAGGTGCGACTGAAAACGGAAAAACAATTGAGCTAGTTGCAAAATTTCAATCCACGCACCTATATAGGGTGCGACTATGGGCATTCCAGATAAATATAAACCCGAGGTAATTTCAATCCTCACACCTATATAAGGTGCGACTGGTCTAACATCTAAAGCCATTAATAACTCCTAATTTCAATCCACGCACCTATATGAGGTGCGACTTTAAAACGTGCATAACCTAACACTTTCCCATTGTATTTCAATCCACGCACCTATATGAGGTGCGACCACTCGGAACTAATAACGCAAACATTGCCACCCAATTTCAATCCACGCACCTATATGAGGTGCGACTTTTTTACTCGGATACTCTAAAGGTGTAACAATAATTTCAATCCACGCACCTATATGAGGTGCGACATGTGGGTGACGTCATTAAATTCTCGTATCTTGTATTTCAATCCACGCACCTATATGAGGTGCGAC

>NZ_AP014866|1|1|6398-7021|CRISPRCasFinder
ATTTCAATCCAAGCACCTATATGAGGTGCAAT	CATGACTGAATTTTGTCAAAATTGTGATATTAT
ATTTCAATCCACACACCTATTTAAGGTGCGAC	TATGAGCGTTCCAGATAAATATAAACCCGAGGTA
ATTTCAATCCATGCACCTATATGAGGTGCGAC	TGAAAACGGAAAAACAATTGAGCTAGTTGCAAA
ATTTCAATCCACGCACCTATATAGGGTGCGAC	TATGGGCATTCCAGATAAATATAAACCCGAGGTA
ATTTCAATCCTCACACCTATATAAGGTGCGAC	TGGTCTAACATCTAAAGCCATTAATAACTCCTA
ATTTCAATCCACGCACCTATATGAGGTGCGAC	TTTAAAACGTGCATAACCTAACACTTTCCCATTGT
ATTTCAATCCACGCACCTATATGAGGTGCGAC	CACTCGGAACTAATAACGCAAACATTGCCACCCA
ATTTCAATCCACGCACCTATATGAGGTGCGAC	TTTTTTACTCGGATACTCTAAAGGTGTAACAATA
ATTTCAATCCACGCACCTATATGAGGTGCGAC	ATGTGGGTGACGTCATTAAATTCTCGTATCTTGT
ATTTCAATCCACGCACCTATATGAGGTGCGAC

>NZ_AP014866|1|1|6398-7011|CRT
ATTTCAATCCAAGCACCTATAT	GAGGTGCAATCATGACTGAATTTTGTCAAAATTGTGATATTAT
ATTTCAATCCACACACCTATTT	AAGGTGCGACTATGAGCGTTCCAGATAAATATAAACCCGAGGTA
ATTTCAATCCATGCACCTATAT	GAGGTGCGACTGAAAACGGAAAAACAATTGAGCTAGTTGCAAA
ATTTCAATCCACGCACCTATAT	AGGGTGCGACTATGGGCATTCCAGATAAATATAAACCCGAGGTA
ATTTCAATCCTCACACCTATAT	AAGGTGCGACTGGTCTAACATCTAAAGCCATTAATAACTCCTA
ATTTCAATCCACGCACCTATAT	GAGGTGCGACTTTAAAACGTGCATAACCTAACACTTTCCCATTGT
ATTTCAATCCACGCACCTATAT	GAGGTGCGACCACTCGGAACTAATAACGCAAACATTGCCACCCA
ATTTCAATCCACGCACCTATAT	GAGGTGCGACTTTTTTACTCGGATACTCTAAAGGTGTAACAATA
ATTTCAATCCACGCACCTATAT	GAGGTGCGACATGTGGGTGACGTCATTAAATTCTCGTATCTTGT
ATTTCAATCCACGCACCTATAT

>NZ_AP014866|1|1|6725-7021|PILER-CR
ATTTCAATCCACGCACCTATATGAGGTGCGAC	TTTAAAACGTGCATAACCTAACACTTTCCCATTGT
ATTTCAATCCACGCACCTATATGAGGTGCGAC	CACTCGGAACTAATAACGCAAACATTGCCACCCA
ATTTCAATCCACGCACCTATATGAGGTGCGAC	TTTTTTACTCGGATACTCTAAAGGTGTAACAATA
ATTTCAATCCACGCACCTATATGAGGTGCGAC	ATGTGGGTGACGTCATTAAATTCTCGTATCTTGT
ATTTCAATCCACGCACCTATATGAGGTGCGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_AP014866.1\|WP_000217299.1\|21312_21456_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014866.1\|WP_000610947.1\|10488_11271_-\|ImmA/IrrE-family-metallo-endopeptidase	unknown	unknown	gnl\|CDD\|368753
NZ_AP014866.1\|WP_060852692.1\|3884_6314_-\|CRISPR-associated-helicase/endonuclease-Cas3	cas3	COG1203_cas3_CAS-I	gnl\|CDD\|224124
NZ_AP014866.1\|WP_000853368.1\|207_1068_-\|type-I-C-CRISPR-associated-protein-Cas7/Csd2	cas7	COG3649_cas7_CAS-I-C	gnl\|CDD\|226175
NZ_AP014866.1\|WP_000724860.1\|11363_11756_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014866.1\|WP_000459233.1\|13553_14363_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014866.1\|WP_000373088.1\|9556_10474_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014866.1\|WP_000372481.1\|14744_16469_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014866.1\|WP_000372779.1\|16504_17974_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014866.1\|WP_000520262.1\|18660_20370_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014866.1\|WP_000118651.1\|1070_2990_-\|type-I-C-CRISPR-associated-protein-Cas8c/Csd1	cas8c	pfam09709_cas8c_CAS-I-C	gnl\|CDD\|187887
NZ_AP014866.1\|WP_003319726.1\|2990_3710_-\|type-I-C-CRISPR-associated-protein-Cas5	cas5	cd09752_cas5_CAS-I-C	gnl\|CDD\|273847
NZ_AP014866.1\|WP_000335059.1\|7344_9147_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|276809
NZ_AP014866.1\|WP_000041871.1\|21596_22544_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271175

Protein	Function_ID	Function_description	E-value
NZ_AP014866.1\|WP_000118651.1\|1070_2990_-\|type-I-C-CRISPR-associated-protein-Cas8c/Csd1	gnl\|CDD\|187887	cd09757, Cas8c_I-C, CRISPR/Cas system-associated protein Cas8c. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Zn-finger domain containing protein, distant homologs of Cas8 proteins; signature gene for I-C subtype; also known as Csd1 family.	4.95792e-169
NZ_AP014866.1\|WP_003319726.1\|2990_3710_-\|type-I-C-CRISPR-associated-protein-Cas5	gnl\|CDD\|273847	TIGR01876, cas_Cas5d, CRISPR-associated protein Cas5, subtype I-C/DVULG. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This small Cas family is represented by CT1134 of Chlorobium tepidum. This family belongs to a set of several Cas protein families, one each for a number of different CRISPR/Cas subtypes, that share a region of N-terminal sequence similarity modeled by TIGR02593. This family represents the Dvulg subtype of CRISPR/Cas locus.	1.61876e-96
NZ_AP014866.1\|WP_000610947.1\|10488_11271_-\|ImmA/IrrE-family-metallo-endopeptidase	gnl\|CDD\|368753	pfam06114, Peptidase_M78, IrrE N-terminal-like domain. This entry includes the catalytic domain of the protein ImmA, which is a metallopeptidase containing an HEXXH zinc-binding motif from peptidase family M78. ImmA is encoded on a conjugative transposon. Conjugating bacteria are able to transfer conjugative transposons that can, for example, confer resistance to antibiotics. The transposon is integrated into the chromosome, but during conjugation excises itself and then moves to the recipient bacterium and re-integrate into its chromosome. Typically a conjugative tranposon encodes only the proteins required for this activity and the proteins that regulate it. During exponential growth, the ICEBs1 transposon of Bacillus subtilis is inactivated by the immunity repressor protein ImmR, which is encoded by the transposon and represses the genes for excision and transfer. Cleavage of ImmR relaxes repression and allows transfer of the transposon. ImmA has been shown to be essential for the cleavage of ImmR. This domain is also found in in metalloprotease IrrE, a central regulator of DNA damage repair in Deinococcaceae, HTH-type transcriptional regulators RamB and PrpC.	6.33521e-07
NZ_AP014866.1\|WP_060852692.1\|3884_6314_-\|CRISPR-associated-helicase/endonuclease-Cas3	gnl\|CDD\|224124	COG1203, COG1203, CRISPR-associated helicase Cas3 [Defense mechanisms].	1.01541e-77
NZ_AP014866.1\|WP_000853368.1\|207_1068_-\|type-I-C-CRISPR-associated-protein-Cas7/Csd2	gnl\|CDD\|226175	COG3649, COG3649, CRISPR system related protein [Defense mechanisms].	1.09266e-135
NZ_AP014866.1\|WP_000335059.1\|7344_9147_-\|hypothetical-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	7.64325e-11
NZ_AP014866.1\|WP_000041871.1\|21596_22544_+\|site-specific-integrase	gnl\|CDD\|271175	cd00397, DNA_BRE_C, DNA breaking-rejoining enzymes, C-terminal catalytic domain. The DNA breaking-rejoining enzyme superfamily includes type IB topoisomerases and tyrosine based site-specific recombinases (integrases) that share the same fold in their catalytic domain containing conserved active site residues. The best-studied members of this diverse superfamily include Human topoisomerase I, the bacteriophage lambda integrase, the bacteriophage P1 Cre recombinase, the yeast Flp recombinase, and the bacterial XerD/C recombinases. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. The enzymes differ in that topoisomerases cleave and then rejoin the same 5' and 3' termini, whereas a site-specific recombinase transfers a 5' hydroxyl generated by recombinase cleavage to a new 3' phosphate partner located in a different duplex region. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	1.04048e-15

>NZ_AP014866.1|WP_060852692.1|3884_6314_-|CRISPR-associated-helicase/endonuclease-Cas3
MTYIAHIRESDSQVQTVEEHLLRVKELAETYGEKIGIKHLAGLAGMLHDMGKYTNEFKEYILEAVNNPNSPPKKGSVDHSTAGGKLLYQLFHTENMIPYKGIISEIVGNAIISHHGYLQDFLNPDLESPYLNRVRDKQLRGFDVTQQFFFKHVMKEKDFHEYVDKATVELESFLLKESPENAEKQLMFLTKFIFSTLIDADRTNTRLFEEEKSVESVINVDELFEKYYERLMTKINSFKKQQNANTPINMLRADMSDQCDQFAERPSGIYTLSIPTGGGKTLASLRYALKHANTHNKKRIIYVVPFTTIIEQNAEEVRRILEDEENILEHHSNIVEEVNEHDENEDGVVSIQQKLKLAKDNWDSPIIFTTMVQFLNVFYAKGNRNTRRLHNLSEAIIIFDEVQKVPVSCVSLFNQALNFLKIYTRSSIVLCTATQPALDFVEQKLDINTDAEMINNLDHVIEAFKRVKIIDQATNEIFNKDKLKTFIHTKIEEVQSILIVLNTKSVVRDLYTQLQSQGLNIPIYHLSTTMCAAHRHKILEEVRECLKEGRKIICISTQLIEAGVDVSFECVVRSLSGLDSIAQAAGRCNRHGEKGIQNVYVIDYEEENLSHLKEIKIGKKITKKILMDLKHNDKIHGGHILSREAMKRYFKEYYREFESDLDYFIPKLKKNMTELLSVPRIENSYRRAYIHKHDKQDIPLFIINSYQTAAKHFNVIDDITTSVIVPYEEGKDIIAELNSNNSIEDLTRLLRKAQQYTVNVFNYEKEKLIINDGLVYYLDGKILALKESAYNDEYGLNVLNESDFKTAIF
>NZ_AP014866.1|WP_003319726.1|2990_3710_-|type-I-C-CRISPR-associated-protein-Cas5
MRNSIEFEVFGDYALFTDPLMKMGGEKLTYQVPTYQAIKGIVESIYWKPTLLMIVDKIRIMNAIKMESKGIRPIEYGGGNTLANYTYLKNVRYQVQAHFIFNHHRPDLAFDRNEYKHHNILKRSLKVGGRRDIFLGTRECQGYVEPCVFGEGEGFYDNYGGDIHLGTMVHGLNYPDETGRNELEVRLWNPVMRDGIIQFIRPEECTKIRKISKMDPKIFDSSNVESVDELIKQLEEGGE
>NZ_AP014866.1|WP_000118651.1|1070_2990_-|type-I-C-CRISPR-associated-protein-Cas8c/Csd1
MSWLLNLYETYQSNLDRVGKIEKKYNGQEYTLLPISHTTQSANIEVLITEEGEFHSATVIDKSDANTLIPCTEDSASRSGTGAYKVPHPLHDKLTYVAGDFGEYGGSKKEEESFGYYIEHLRNWVESPYSTDKLKSIYKYLRKKQLVKDLVETKILWLDENQKLIGKWDKKVEVFLGNKPEIFTVLPAGQEAAFVRFTVYSPNKMLSKVWQDKEIHNSFINFYDGLLDNEDYCYVTGEIKPSTDKHAKKIRNASDQAKLISSNDLRGFTFRGRFTTSNEVANISYDVSQKAHNALKWLINKQGKIIDQRVFLVWGNDAEDVPDIVEDSYSIFSMDIRGTKKREIKSYTHEQFANEVAKAIDGYKNNLSSSENVNILLLDSATTGRLAVLYYRNMDKNLYLNRLKNWHSTCVWEHGYRKNADNEFVKFYGTPSTRDIAFAAYGPKANEKVVKSLMERMLPCIIDERKIPFDIVRSAFQRASNPLSMEKWEWEKTLSITCALINKMEGYQLVLDKENNNRDYLFGRLLAVADVLERKALNNGDQRATNARRYMNSFSQHPERTWRTIQGALQPYQARLGEKVWYYNKLIDEIGSMIKIEDFNNKPLSGKYLLGFYSQRHELYQKKEKNVSLNDVVNIGEEN
>NZ_AP014866.1|WP_000853368.1|207_1068_-|type-I-C-CRISPR-associated-protein-Cas7/Csd2
MKTLDHKIDFAVVLSVTKANPNGDPLNGNRPRQNYDGHGEISDVAIKRKIRNRLQDMEESIFVQSNDRKVDQFNSLRERAETNVDLVKALKSKDNPHEQFAAIACKEWIDVRSFGQVFAFKGGAGKGVSVGVRGPVSIHTATSVDPIDITSMQITKSVNSEPGKDKGSDTMGMKHRVDFGVYVFYGSINTQLAEKTGFTNEDAEKIKNALVTLFENDASAARPEGSIEVHKVCWWDHNSKLGQYSSAKVHRLLEVKRNIDEPKTIDDYTVLVHELDDLKVEIINGM
>NZ_AP014866.1|WP_000335059.1|7344_9147_-|hypothetical-protein
MCKCRVCETNNNDFHCNIAGDNICRNCCNDFQLRNFKDSWSGLVKLVKDEMEIYNISECCLKCKGLMRNQRVELTGDGSIINYGYNGKYVFNDMVDSYSYKFFNKKKIVLLESMNSLDITGVYDLAEGYYLLEEYEKAIDLLENLEGKDTDSKVLLLLGKVYFHANNLQAAIDCLLNSIKIHGDNSETYRILGEVYQADNNLINSAYYFNQAIKYFKIDAYDRPNDYFPQYSYLGLAVVYSKLNQHNEVIKSAEKFLESQYSWDTLVEMLYEQRSGEKNYIGFGGFFACATIYELMALSYLEKENLMLAEKYIDRAQELNPENTNIATTKGIIIGRKHNDGKISEYREQISSLRQNIELRASSINKLKTLRPEEQVKLFTGNEEESVWGFLVGKIFDNLKTIENLSPIVTPSQNKAAEEDRYTDLFKSHMDSNLVDTFGWITHTQSRGGYTRKEMGDRGGIGERDIVIRSHQNKDLLMGEALILKGKDTASIKTHTKKIFGYDIGNCNFHIIINWGFSEKPDSVWKDYRKLVISRQEGIYAVIENGETENLYPGINKQGIRTFYTKHSTDVENEVATAIHVYVDVLKQMKREGAELARKK
>NZ_AP014866.1|WP_000373088.1|9556_10474_-|hypothetical-protein
MDQVTNTPETNQDSKCNGIEPYLQDGRKNDRVTHYYILDNNVLSDLAKLAREEQSSFKELMTCYKGTVFIVPEMVMEEAIRNLPGQQWVDEKYLNFYQVMSELHIPIYLESVEHNYQIFAEGYGSKEEAFLQYKEIALNSISNIAIQGELREAKSCKDIEKAYSQSLKDAGERFIFLYAHAMLQDKVNKISILSNEIKGVYNVWKANMRKGELLELVRVTSHEEYCEKLRPVSYNCILVNSLKKNPTLTSEQKKSLLQIMRDSKIIGRNVYYSQKSCNLVDTRADMNNEEFINFIEKHDDYKLAF
>NZ_AP014866.1|WP_000610947.1|10488_11271_-|ImmA/IrrE-family-metallo-endopeptidase
MINSTNIREVIEQNQKILPSILVNVESTIEKGIHFKYKTIESIRNYLMQKTEVLLFPSKSLSYGGMVLYRNGSFYININTLQPKTYENFVWAHEYYHFEFEKDRIKNADDVTFVNNPVLNENERRANLFAAELLINDDVLKTLFQEIKLNYVNDSLEKNVIRLIPAFELPYKTMVIKLAQENLISMEDAERIIDHDYRHNLPQDFDLSILEPTKAIKIDGLNKLLESESVQENMLESDFESIQNLANQHFKQLEAIRMEI
>NZ_AP014866.1|WP_000724860.1|11363_11756_-|hypothetical-protein
MKKIVGENIRIYLEATGRTHQWVMDKGGIPKATFYKLLKGEGDLTKGIEKINELFGIKDDFYFYNSEFKPPLKLEDKLKRSDIRNFAAANYVAVEGEETEFKNTLDTLDDFIRMIELLKPYNNLNRNDFI
>NZ_AP014866.1|WP_000459233.1|13553_14363_+|hypothetical-protein
MFDFELELFNFYSKKLSKWNLVYKYVLKNIIFLVATFISIAALVIISLNIFVEHDIEFDSFYIYMIFFFVYMILFLVCMHYVVVKPAILISVNKYNISFKSKQWQVFICLIVQSYLFKKELLNNDPKFNEESLQFLIQVLKEKKEETEKLNVLKLLSSYGSLFFLFTIPVWSAFNSWVYNHEIKTSAEAIQYLLMLGFLIFMSVFLIWMPFKKNFLEELFSKESSKISDLIKALENINFSLKNFCHLKSEKSGVIKQSTIDSIIKENTN
>NZ_AP014866.1|WP_000372481.1|14744_16469_-|hypothetical-protein
MDQLKQLFQSTLLVAYPLFQNIENNERIFNKWRGLCTLINSDVSYLEDPMYTSVSFKKFANWISYKESQGVGIMEIVAQIEGYRPEVFELLANDIEKEFEILLVKQKQEKKHTEEQQSFIEHSSAGFMYHLTDTIAKNNFTEDKELNAHIAELPDKSNSLVVVSSRFNDGDMKLRGAGELNRWNTLVDSTFVDRVMDDLTADCLDIVTEIWVKSASTESSPVHIGYEEILEMCSMKQVRNGKSYYRKEDRLKIMERLAALASIFIYVNEDNEIVILNDDENPNESLAYKKQRVRRLFVMDEIVFAKDIDTDEMLGIESMNVAPGTFLSKYLYGSEKLTGLLSKKALEYNSKQQRYHKRLTRYLSWRWRIQQAYQHLVHPYSIGGPKGLISVMGVSMNQNPARIRSVFEKTLDDLMRDEVIKEWQYQTPIDEGKCSGRNWLENYWLNLKVTVTPTDELVSLQQELLQKKKITPKNKLMETVVKDPVIEVQDMEIEEIQTSQLEQQQVNRDINWYQQKILQYKEENKCSLRDMAKEIEISPSNLSKLLIGKRKRLSEETHNKLDKWIERQEVVNLL
>NZ_AP014866.1|WP_000372779.1|16504_17974_-|hypothetical-protein
MDQRIEEVNYKLIDNGIFFSVNKTQLARHFLNNVLEIDVCNLNKEEVTKIICEKYGYKLKQLPDEEEIYLFVAHNIMGIKEDKEPYECFNHEVFLVMKDLRKINFMIQEYESKQQVKDIDRYEKKKYQYLAEKLYKAKDVICEYMTGEINSCIYKEVKDWSKPNGFPSSGSFNQMLPSRYAFRGREEEYEMSVFDGLNYKFEFITLQERNELKLLHSNNKDEFNERVDRYIITHEIDNKILSLIEENHVLNKRGMLKQAIEIYKEDMMELFCQIIPLQIEGIIYDYCIELGVSSANIERTSLDRKIEEIVKKDRRFKCHEYFKYDFIELRNTAAHGRLHENVNFKDTANMLILDLMYLCDALNNSNALVVNRMRSLIKRFEENFNNDYVPIDGIVYSFIAKYRDKSLPSIYEKENVIQEIKKYAMSDNFLRYIHIHIMHPSLVSELSPEQKQEIKKIIVYLMRSKEIKERCVNLLKLLADNSKEELVHK
>NZ_AP014866.1|WP_000520262.1|18660_20370_+|hypothetical-protein
MGKSFVIRNQRSLNGETTNAVLVTLKSWQKFVETFEEKYYSYKDTYLEDILQHMTYEERIADVEGFVEKAKPSFSRRAMSAIAEKTGRKHKLYGITNADLEVFLYLHKKCYTNGVIPNVTIHMMWEDYKQYKEELAYIQHSQFYIALKKLSLHNIISIENGLDGRYTIKLTHFINEETEKANPYVYISPVVFTKAFFKLSVAAKKLFLDIAMQQHTETTLKRSLDKQDERGNKTHFGGMYCFLHKKYPHQIRAVIEELTTALPCTGNPLFKICKMQKGVKHTKRYTTLYLSIHSDFLCSKEAGEEQHRDPFTPKATYARKAKFIEAVLQEMNIGELSADMNKFIHVLKHTCHRQIRSVIRGLRDMVDRKEGYPTKIVYTLKKLLHQTSQYQILDTAAKEGIYPLIAQHIPKERNSDREQAVFNFGLHYSMYSLHNIKKMFKNVHALLKQKFAVPVTEESYHRNYLKYQEETLFRKYAYDQGVNLHAYIALEIEMREKLKVRGHKERTIPSDVREWFIEAIDKLPQEKLRVIELPKQFNLLEFMRTFERLVRADVTITAPDQVLHAMETK
>NZ_AP014866.1|WP_000217299.1|21312_21456_+|hypothetical-protein
MTVLKDTTYLDIDTYNEIRFFKGIFWGLVFVVPFWSIMITLFILLYR
>NZ_AP014866.1|WP_000041871.1|21596_22544_+|site-specific-integrase
MSKNINLEETLAAFSAYLTEKGRKQSTIKRYAYDIKDFYKWLRENEKLLHIKSWRELSEADYQTYFSELEDKRKYSQKTRHRIWVVLKKVHMFLGIVSPLDGINFSLIPDQSLNDNDFITEMEEKLLKQTVLSTKGLTERQAKYRPLIMDRNVCIINLVVNYGLSLHELVSLNMSHIKFARNILMVPGENGATRSVFLTMEDTQQLYKYYKTIPEPVRPRQHTDNPLFVAFDFNRGTYRWVYEKDMPKALSEVAIQKMIRLEVKRAGLKRRISAQQMRNTFILRLIKQGVTEKDLVSRMGFKTKISLKRYYQYLQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_AP014866_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_AP014866_2

292316-292614

Orphan

I-C

Consensus_repeat	Method
ATATTTCAATCCACGCACCTATATAAGGTGCGACTT	CRT

4 spacers

The CRISPR arrays of NZ_AP014866_2

>merge|NZ_AP014866|2|292316-292614|CRT
TAATTTCAATCCATGCACCTATATAAGGTGCGACTTGTTTTTCACAAAGCATTAATACCAGCTACATATTTCAATCCACGCACCCATATAAGGTGCGACTTCTTTTGATCCGTAAGAACGTTCCATTTCCATATTTCAATCTACACACCTATATAAGGTGCGACGTCCCTTCCATCGGCGGCAGCTCATATTCAATTATATTTCAATCCACGCACCTATATAAGGTGCGACTCGATTCCACTTGTTCAGGCTCTTTGAATATCATATTTCAATCCACGTACCTACAAGAGGTACGACTT

>NZ_AP014866|2|2|292316-292614|CRT
TAATTTCAATCCATGCACCTATATAAGGTGCGACTT	GTTTTTCACAAAGCATTAATACCAGCTAC
ATATTTCAATCCACGCACCCATATAAGGTGCGACTT	CTTTTGATCCGTAAGAACGTTCCATTTCC
ATATTTCAATCTACACACCTATATAAGGTGCGACGT	CCCTTCCATCGGCGGCAGCTCATATTCAATT
ATATTTCAATCCACGCACCTATATAAGGTGCGACTC	GATTCCACTTGTTCAGGCTCTTTGAATATC
ATATTTCAATCCACGTACCTACAAGAGGTACGACTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_AP014866.1\|WP_000710813.1\|289707_289845_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014866.1\|WP_001024816.1\|280348_280978_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014866.1\|WP_053513495.1\|279713_280349_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014866.1\|WP_001219637.1\|288511_289603_-\|methyltransferase	unknown	unknown	gnl\|CDD\|274377
NZ_AP014866.1\|WP_000494364.1\|281314_282028_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014866.1\|WP_000710696.1\|289866_290292_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014866.1\|WP_060852715.1\|284724_286590_-\|group-II-intron-reverse-transcriptase/maturase	RT	pfam00078_RT_CAS-I:CAS-III	gnl\|CDD\|275209
NZ_AP014866.1\|WP_078405438.1\|279084_279663_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014866.1\|WP_023901368.1\|282044_284450_-\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|223627
NZ_AP014866.1\|WP_053512806.1\|288316_288496_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_AP014866.1\|WP_060852715.1\|284724_286590_-\|group-II-intron-reverse-transcriptase/maturase	gnl\|CDD\|275209	TIGR04416, hypothetical_protein, group II intron reverse transcriptase/maturase. Members of this protein family are multifunctional proteins encoded in most examples of bacterial group II introns. These group II introns are mobile selfish genetic elements, often with multiple highly identical copies per genome. Member proteins have an N-terminal reverse transcriptase (RNA-directed DNA polymerase) domain (pfam00078) followed by an RNA-binding maturase domain (pfam08388). Some members of this family may have an additional C-terminal DNA endonuclease domain that this model does not cover. A region of the group II intron ribozyme structure should be detectable nearby on the genome by Rfam model RF00029. [Mobile and extrachromosomal element functions, Other].	8.89778e-121
NZ_AP014866.1\|WP_001219637.1\|288511_289603_-\|methyltransferase	gnl\|CDD\|274377	TIGR02987, m6_adenine_and_m5_cytosine_DNA_methyltransferase, type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family. Members of this family are the m6-adenine DNA methyltransferase protein, or domain of a fusion protein that also carries m5 cytosine methyltransferase activity, of type II restriction systems of the Alw26I/Eco31I/Esp3I family. A methyltransferase of this family is alway accompanied by a type II restriction endonuclease from the Alw26I/Eco31I/Esp3I family (TIGR02986) and by an adenine-specific modification methyltransferase. Members of this family are unusual in that regions of similarity to homologs outside this family are circularly permuted. [DNA metabolism, Restriction/modification].	0.00066001
NZ_AP014866.1\|WP_023901368.1\|282044_284450_-\|DEAD/DEAH-box-helicase	gnl\|CDD\|223627	COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair].	1.76891e-07

>NZ_AP014866.1|WP_000710696.1|289866_290292_-|hypothetical-protein
MKKDCRHLRLVPTVEEHKTRIEANETYQQKSYATSTMSSETRGRLNQMRGCFEAEIILPVGKFQYFKPHAMNEKEAIQEIALFIEGIQEMNIGYVILWRFVGQQSFYSGTKIVAEPKFRKIMRKLKDYLFDYEELIYETEK
>NZ_AP014866.1|WP_000710813.1|289707_289845_-|hypothetical-protein
MKKDKIWTVLDDPKEQETKEQSQEPDDIFAGMEELSEITDDELPF
>NZ_AP014866.1|WP_001219637.1|288511_289603_-|methyltransferase
MRIGNDLAAGYYPTPLLEGKHLIQLLQMEPERVYACFDPCCGEGTILRSFADEVRQVSIQIDTYGVEVDANRYGKAKEQLDEVVCSDFESMMISHDYFPLIFLNPPYNTELRTENTKSEKMEFNFLKRAHLYLQDGGIMVYVIPYDKFARDDISYFIAKHYEEIGLMRFGDENEEFEQFKQCVFIGRKRAATKNDTYFNDRFANFCENMSDLSFVKKHVNTLAEMVNRKDWAIPELRHQNKLIFTSRVDYKSAYEGVGKSEGISSFKKRLNRGNGYSLQGEKTAAERAKMPIASGQLGLLLITGVADGLLGEGDTLHAVRGSENVYYETSFEPLQKTTKEVVLQKRRAKFIIATPTGEVKELV
>NZ_AP014866.1|WP_053512806.1|288316_288496_-|hypothetical-protein
MSVLLGIGALFIVWEFSNRMFRIAIVLTVICLCASQLGAGNMLHAAEQSLPEWKQFIDF
>NZ_AP014866.1|WP_060852715.1|284724_286590_-|group-II-intron-reverse-transcriptase/maturase
MKDNKQFPQNEKELKLALDSMYRIAKESSKPFYNLIELMKNEQTILTAIHNIKGNKGSKTAGTDGKTMDYYLQMGRDKLMSLIRRNINDYQPSPVRRKYIPKSNGKQRPLGIPNMIDRIIQEIAKIVIEPIAEAKFYHYSFGFRPMRSAEQAIAETLERIRRSKTYWVIEGDIKGYFDNINHNKLIEIMWKIGIRDKRVLMMIKKMLKAGIMEEGKVRDNVSGSPQGGIISPLLANIYLNYFDWEIARMFQEHPARYKVKDVSRNGLQRVRQRHEDTFLIRYADDWVILCKSEGNAKRILKKVEKYFNHQLKLELSKEKTLITDVRTNRVNFLGFWIFAEEHRLRKGNIQGKAIPNMDKAKLKIKEINKNIKTLYDHRGNKSKQVAIIESINSKIVGIANYYKIANVSTIFQGFDKRIHYAQWRTWLFMNNRRGRYYQLTTPADTLLNRRDRHKEQKSKVFFIEEHGAKVGITKFAFTPKRNAMKVNLLMSPYTDNGRSIYKRTTGKREALERPNFFQEEIPFYQLNNRYPIYNFEFYLNREYAFNRDRGKCNCCKVQLNEWNLNTHHKNPKLPLNKVNKVINLVSLCKTCHKLVHNENPVTNTKGGKKIEQLRKLLKEVK
>NZ_AP014866.1|WP_023901368.1|282044_284450_-|DEAD/DEAH-box-helicase
MMTAAVDGYFHLKGKKGYRTCVFVPPTLTEKWAKEEIRHLLPDAEIHLIKRTEDLIRIHQAWIQAGRPKPQKPTFFVISFTTMRGDSIKMMPLSYKQTPLSKKSEEEVQRYYKNGYYCSDCGAKLRKKTSSIMVQQANGEQKEVCQYKDFTASDLDTKTNKNSVCADCNSNIWSPKVKTKYASFKEWTKYEEQLVQAIKEGNKPLQKQLELENRVKPYDAKHSGRAYRKVAAVEYIRRKMKHFFDVLIADEIHELKSESAQGTALGSLAKVCKKVVAGTGTLFGGRASDVFYTLWRLFPQKMVKSGFEYSSFMEWNETYGNIERTYYHDGEVTSNIASRGAQGTLDKTKVVPGISPYVFTQFLMDTTINVRLKDVWPNPVELVNVPTILVDMSEEQKQAYEHMKESFEKAIEAAKGTPDAGKLWLSYIRTGNAYPDNMIHYPNYYLDDAGKELVWSNDKFKFDEDCIQPKERELQSILRTEISEGRPTIVYVCDTGSTVKERDVQPRLQKVVEQISGAKVAILRTNTVTPPKRSEWLKDQVNSGVNVIICSLELVKVGLDLLATPTLIFYQLPFSLFALNQAARRHCRIGQTKQCRTFYLGYRETFQQQMAQLIAQKNKAAEAMNGEATSDGLNAMLGDTGDLQTLLIQNIKSGNQLKGSTEEWTKAASDESKRVLANIGNVITPVFESIEIQFTNWVGKLPGTMDVAFMKEVQFVQRAVECIKKEQVPGVRVKKNVLEIAGEIEDVIRALTTLNTDKRMLVQKQDITFWDSVIVEVDSSKKKGKRKNKVIDGQFEFDLFG
>NZ_AP014866.1|WP_000494364.1|281314_282028_-|hypothetical-protein
MFTKIFIGLFCYVFLVVRNSKKKFLMEEAKKKEMENKPVERPVYWCPRENKPIGREQERVTVPTKEITLEKDVASIYDLVATSVHKNLGEEESDRLKHEDIEEVEYAEDFHHTPTPEAVYDIPFPSDEDIPVELLEYEDMYPQQEYVSIPPETEHVFSVQQGVADVEDMDFVRWTAKVIEQEQGLTRVINMSNKKRYWIHTEGEILPKNQLLYMKLEVNSPYSYTLVEWSNRQLGNI
>NZ_AP014866.1|WP_001024816.1|280348_280978_-|hypothetical-protein
MNINSISNNVVEKLEQTVRYEKKQVQVLRVSKSSSNIHAYMIFPEFSEVKISNTELDEYIENLSTSVKYVIDRKLSQQEIEKQNHSFIMTCEVEEDGVIDDETIHFNTTYVKPPTIANKVFKLVCGLGNRLDSLKELHITVLNNNINRIEIEFYNENETYVAVEKEEIANAIMGAYTKANIYYAADLYYAAEGNEIKLKSIKPKLAGDV
>NZ_AP014866.1|WP_053513495.1|279713_280349_-|hypothetical-protein
MKREKGMIGVLCTLVLMILLLVPLEAAQASVKVDFNELKGNDVSSSFKDGLNNRMKTTEKEDSFGSSIIQKIEGLYAPAFKVGVNIFSISFVLGVIVMVMALITKNGQWMKWATGSMIFSFISMMSIRLSVYFLFSSDVFSFMNIFTDFLDLFKATALIFTPFMLIAGIRLRRIHESTKQPEYYRWANRVITGSCLLCMLAVLAPWLFANM
>NZ_AP014866.1|WP_078405438.1|279084_279663_+|hypothetical-protein
MLEHTILFSLVQLVPLIVSTGIIYILLELTDTEWKTWFSYEGIFVIIFLITRFQVFQNKKSIISLNQHEKWFSKLNIFLISIFLVLFASIPTLLKIAFILQMTVILFLLEYLCLYINRLPTHNLYRVKEIICDKKQLKIERIIPNNEEHGTHTIKTNDGQYFLYTAVYLSGILSPISEEVFEEYERKNLMGR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_AP014866_1	1.1\|6430\|33\|NZ_AP014866\|CRISPRCasFinder	6430-6462	33	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143859-143891	0	1.0
NZ_AP014866_1	1.1\|6430\|33\|NZ_AP014866\|CRISPRCasFinder	6430-6462	33	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	176025-176057	0	1.0
NZ_AP014866_1	1.1\|6430\|33\|NZ_AP014866\|CRISPRCasFinder	6430-6462	33	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180250-180282	0	1.0
NZ_AP014866_1	1.1\|6430\|33\|NZ_AP014866\|CRISPRCasFinder	6430-6462	33	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7325-7357	0	1.0
NZ_AP014866_1	1.1\|6430\|33\|NZ_AP014866\|CRISPRCasFinder	6430-6462	33	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	141190-141222	0	1.0
NZ_AP014866_1	1.1\|6430\|33\|NZ_AP014866\|CRISPRCasFinder	6430-6462	33	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135922-135954	0	1.0
NZ_AP014866_1	1.1\|6430\|33\|NZ_AP014866\|CRISPRCasFinder	6430-6462	33	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704537-704569	0	1.0
NZ_AP014866_1	1.1\|6430\|33\|NZ_AP014866\|CRISPRCasFinder	6430-6462	33	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24075-24107	0	1.0
NZ_AP014866_1	1.1\|6430\|33\|NZ_AP014866\|CRISPRCasFinder	6430-6462	33	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6430-6462	0	1.0
NZ_AP014866_1	1.2\|6495\|34\|NZ_AP014866\|CRISPRCasFinder	6495-6528	34	NZ_KX258624	Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence	50231-50264	0	1.0
NZ_AP014866_1	1.2\|6495\|34\|NZ_AP014866\|CRISPRCasFinder	6495-6528	34	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704602-704635	0	1.0
NZ_AP014866_1	1.2\|6495\|34\|NZ_AP014866\|CRISPRCasFinder	6495-6528	34	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24140-24173	0	1.0
NZ_AP014866_1	1.2\|6495\|34\|NZ_AP014866\|CRISPRCasFinder	6495-6528	34	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6495-6528	0	1.0
NZ_AP014866_1	1.2\|6495\|34\|NZ_AP014866\|CRISPRCasFinder	6495-6528	34	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143793-143826	0	1.0
NZ_AP014866_1	1.2\|6495\|34\|NZ_AP014866\|CRISPRCasFinder	6495-6528	34	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175959-175992	0	1.0
NZ_AP014866_1	1.2\|6495\|34\|NZ_AP014866\|CRISPRCasFinder	6495-6528	34	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180184-180217	0	1.0
NZ_AP014866_1	1.2\|6495\|34\|NZ_AP014866\|CRISPRCasFinder	6495-6528	34	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7258-7291	0	1.0
NZ_AP014866_1	1.2\|6495\|34\|NZ_AP014866\|CRISPRCasFinder	6495-6528	34	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	141124-141157	0	1.0
NZ_AP014866_1	1.2\|6495\|34\|NZ_AP014866\|CRISPRCasFinder	6495-6528	34	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135856-135889	0	1.0
NZ_AP014866_1	1.3\|6561\|33\|NZ_AP014866\|CRISPRCasFinder	6561-6593	33	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143728-143760	0	1.0
NZ_AP014866_1	1.3\|6561\|33\|NZ_AP014866\|CRISPRCasFinder	6561-6593	33	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175894-175926	0	1.0
NZ_AP014866_1	1.3\|6561\|33\|NZ_AP014866\|CRISPRCasFinder	6561-6593	33	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180119-180151	0	1.0
NZ_AP014866_1	1.3\|6561\|33\|NZ_AP014866\|CRISPRCasFinder	6561-6593	33	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	141059-141091	0	1.0
NZ_AP014866_1	1.3\|6561\|33\|NZ_AP014866\|CRISPRCasFinder	6561-6593	33	CP041751	Bacillus paranthracis strain NCCP 14796 plasmid unnamed1, complete sequence	10913-10945	0	1.0
NZ_AP014866_1	1.3\|6561\|33\|NZ_AP014866\|CRISPRCasFinder	6561-6593	33	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135791-135823	0	1.0
NZ_AP014866_1	1.3\|6561\|33\|NZ_AP014866\|CRISPRCasFinder	6561-6593	33	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704668-704700	0	1.0
NZ_AP014866_1	1.3\|6561\|33\|NZ_AP014866\|CRISPRCasFinder	6561-6593	33	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24206-24238	0	1.0
NZ_AP014866_1	1.3\|6561\|33\|NZ_AP014866\|CRISPRCasFinder	6561-6593	33	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6561-6593	0	1.0
NZ_AP014866_1	1.3\|6561\|33\|NZ_AP014866\|CRISPRCasFinder	6561-6593	33	CP024689	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-5-125K, complete sequence	6571-6603	0	1.0
NZ_AP014866_1	1.3\|6561\|33\|NZ_AP014866\|CRISPRCasFinder	6561-6593	33	NC_018685	Bacillus thuringiensis MC28 plasmid pMC95, complete sequence	23122-23154	0	1.0
NZ_AP014866_1	1.3\|6561\|33\|NZ_AP014866\|CRISPRCasFinder	6561-6593	33	NZ_CP033793	Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence	2200-2232	0	1.0
NZ_AP014866_1	1.4\|6626\|34\|NZ_AP014866\|CRISPRCasFinder	6626-6659	34	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704733-704766	0	1.0
NZ_AP014866_1	1.4\|6626\|34\|NZ_AP014866\|CRISPRCasFinder	6626-6659	34	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24271-24304	0	1.0
NZ_AP014866_1	1.4\|6626\|34\|NZ_AP014866\|CRISPRCasFinder	6626-6659	34	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6626-6659	0	1.0
NZ_AP014866_1	1.4\|6626\|34\|NZ_AP014866\|CRISPRCasFinder	6626-6659	34	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143662-143695	0	1.0
NZ_AP014866_1	1.4\|6626\|34\|NZ_AP014866\|CRISPRCasFinder	6626-6659	34	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175828-175861	0	1.0
NZ_AP014866_1	1.4\|6626\|34\|NZ_AP014866\|CRISPRCasFinder	6626-6659	34	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180053-180086	0	1.0
NZ_AP014866_1	1.4\|6626\|34\|NZ_AP014866\|CRISPRCasFinder	6626-6659	34	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7126-7159	0	1.0
NZ_AP014866_1	1.4\|6626\|34\|NZ_AP014866\|CRISPRCasFinder	6626-6659	34	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140993-141026	0	1.0
NZ_AP014866_1	1.4\|6626\|34\|NZ_AP014866\|CRISPRCasFinder	6626-6659	34	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135725-135758	0	1.0
NZ_AP014866_1	1.5\|6692\|33\|NZ_AP014866\|CRISPRCasFinder	6692-6724	33	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	151946-151978	0	1.0
NZ_AP014866_1	1.5\|6692\|33\|NZ_AP014866\|CRISPRCasFinder	6692-6724	33	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704799-704831	0	1.0
NZ_AP014866_1	1.5\|6692\|33\|NZ_AP014866\|CRISPRCasFinder	6692-6724	33	NZ_CP053974	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed5, complete sequence	2157-2189	0	1.0
NZ_AP014866_1	1.5\|6692\|33\|NZ_AP014866\|CRISPRCasFinder	6692-6724	33	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24337-24369	0	1.0
NZ_AP014866_1	1.5\|6692\|33\|NZ_AP014866\|CRISPRCasFinder	6692-6724	33	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	243847-243879	0	1.0
NZ_AP014866_1	1.5\|6692\|33\|NZ_AP014866\|CRISPRCasFinder	6692-6724	33	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6692-6724	0	1.0
NZ_AP014866_1	1.5\|6692\|33\|NZ_AP014866\|CRISPRCasFinder	6692-6724	33	NZ_CP009346	Bacillus thuringiensis HD1002 plasmid 5, complete sequence	3933-3965	0	1.0
NZ_AP014866_1	1.5\|6692\|33\|NZ_AP014866\|CRISPRCasFinder	6692-6724	33	NZ_CP045027	Bacillus thuringiensis strain JW-1 plasmid p5, complete sequence	3931-3963	0	1.0
NZ_AP014866_1	1.5\|6692\|33\|NZ_AP014866\|CRISPRCasFinder	6692-6724	33	CP013282	Bacillus phage pGIL02, complete sequence	3933-3965	0	1.0
NZ_AP014866_1	1.5\|6692\|33\|NZ_AP014866\|CRISPRCasFinder	6692-6724	33	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143597-143629	0	1.0
NZ_AP014866_1	1.5\|6692\|33\|NZ_AP014866\|CRISPRCasFinder	6692-6724	33	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175763-175795	0	1.0
NZ_AP014866_1	1.5\|6692\|33\|NZ_AP014866\|CRISPRCasFinder	6692-6724	33	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	179988-180020	0	1.0
NZ_AP014866_1	1.5\|6692\|33\|NZ_AP014866\|CRISPRCasFinder	6692-6724	33	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7062-7094	0	1.0
NZ_AP014866_1	1.5\|6692\|33\|NZ_AP014866\|CRISPRCasFinder	6692-6724	33	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140928-140960	0	1.0
NZ_AP014866_1	1.5\|6692\|33\|NZ_AP014866\|CRISPRCasFinder	6692-6724	33	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135660-135692	0	1.0
NZ_AP014866_1	1.5\|6692\|33\|NZ_AP014866\|CRISPRCasFinder	6692-6724	33	NC_005258	Bacillus phage Bam35c, complete genome	10971-11003	0	1.0
NZ_AP014866_1	1.5\|6692\|33\|NZ_AP014866\|CRISPRCasFinder	6692-6724	33	AY257527	Bacillus thuringiensis bacteriophage Bam35c, complete genome	10971-11003	0	1.0
NZ_AP014866_1	1.5\|6692\|33\|NZ_AP014866\|CRISPRCasFinder	6692-6724	33	AJ536073	Bacillus phage pGIL01, complete genome	10969-11001	0	1.0
NZ_AP014866_1	1.6\|6757\|35\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6757-6791	35	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704993-705027	0	1.0
NZ_AP014866_1	1.6\|6757\|35\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6757-6791	35	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24531-24565	0	1.0
NZ_AP014866_1	1.6\|6757\|35\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6757-6791	35	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6757-6791	0	1.0
NZ_AP014866_1	1.6\|6757\|35\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6757-6791	35	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143401-143435	0	1.0
NZ_AP014866_1	1.6\|6757\|35\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6757-6791	35	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175567-175601	0	1.0
NZ_AP014866_1	1.6\|6757\|35\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6757-6791	35	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	179792-179826	0	1.0
NZ_AP014866_1	1.6\|6757\|35\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6757-6791	35	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140732-140766	0	1.0
NZ_AP014866_1	1.6\|6757\|35\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6757-6791	35	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135464-135498	0	1.0
NZ_AP014866_1	1.7\|6824\|34\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6824-6857	34	NZ_CP024774	Bacillus thuringiensis LM1212 plasmid pLM3, complete sequence	48458-48491	0	1.0
NZ_AP014866_1	1.7\|6824\|34\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6824-6857	34	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6824-6857	0	1.0
NZ_AP014866_1	1.7\|6824\|34\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6824-6857	34	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135398-135431	0	1.0
NZ_AP014866_1	1.7\|6824\|34\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6824-6857	34	NZ_CP041074	Bacillus tropicus strain LM1212-W3 plasmid p1, complete sequence	21258-21291	0	1.0
NZ_AP014866_1	1.7\|6824\|34\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6824-6857	34	NZ_CP015253	Bacillus thuringiensis Bt18247 plasmid p113275, complete sequence	6193-6226	0	1.0
NZ_AP014866_1	1.8\|6890\|34\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6890-6923	34	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143335-143368	0	1.0
NZ_AP014866_1	1.8\|6890\|34\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6890-6923	34	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175501-175534	0	1.0
NZ_AP014866_1	1.8\|6890\|34\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6890-6923	34	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	179726-179759	0	1.0
NZ_AP014866_1	1.8\|6890\|34\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6890-6923	34	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140666-140699	0	1.0
NZ_AP014866_1	1.8\|6890\|34\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6890-6923	34	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135332-135365	0	1.0
NZ_AP014866_1	1.8\|6890\|34\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6890-6923	34	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	705060-705093	0	1.0
NZ_AP014866_1	1.8\|6890\|34\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6890-6923	34	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24598-24631	0	1.0
NZ_AP014866_1	1.8\|6890\|34\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6890-6923	34	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6890-6923	0	1.0
NZ_AP014866_1	1.9\|6956\|34\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6956-6989	34	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143269-143302	0	1.0
NZ_AP014866_1	1.9\|6956\|34\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6956-6989	34	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175435-175468	0	1.0
NZ_AP014866_1	1.9\|6956\|34\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6956-6989	34	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	179660-179693	0	1.0
NZ_AP014866_1	1.9\|6956\|34\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6956-6989	34	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	705126-705159	0	1.0
NZ_AP014866_1	1.9\|6956\|34\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6956-6989	34	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	6735-6768	0	1.0
NZ_AP014866_1	1.9\|6956\|34\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6956-6989	34	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24664-24697	0	1.0
NZ_AP014866_1	1.9\|6956\|34\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6956-6989	34	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140600-140633	0	1.0
NZ_AP014866_1	1.9\|6956\|34\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6956-6989	34	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6956-6989	0	1.0
NZ_AP014866_1	1.10\|6420\|43\|NZ_AP014866\|CRT	6420-6462	43	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143859-143901	0	1.0
NZ_AP014866_1	1.10\|6420\|43\|NZ_AP014866\|CRT	6420-6462	43	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	176025-176067	0	1.0
NZ_AP014866_1	1.10\|6420\|43\|NZ_AP014866\|CRT	6420-6462	43	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180250-180292	0	1.0
NZ_AP014866_1	1.10\|6420\|43\|NZ_AP014866\|CRT	6420-6462	43	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7325-7367	0	1.0
NZ_AP014866_1	1.10\|6420\|43\|NZ_AP014866\|CRT	6420-6462	43	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	141190-141232	0	1.0
NZ_AP014866_1	1.10\|6420\|43\|NZ_AP014866\|CRT	6420-6462	43	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135922-135964	0	1.0
NZ_AP014866_1	1.10\|6420\|43\|NZ_AP014866\|CRT	6420-6462	43	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704527-704569	0	1.0
NZ_AP014866_1	1.10\|6420\|43\|NZ_AP014866\|CRT	6420-6462	43	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24065-24107	0	1.0
NZ_AP014866_1	1.10\|6420\|43\|NZ_AP014866\|CRT	6420-6462	43	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6420-6462	0	1.0
NZ_AP014866_1	1.11\|6485\|44\|NZ_AP014866\|CRT	6485-6528	44	NZ_KX258624	Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence	50221-50264	0	1.0
NZ_AP014866_1	1.11\|6485\|44\|NZ_AP014866\|CRT	6485-6528	44	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143793-143836	0	1.0
NZ_AP014866_1	1.11\|6485\|44\|NZ_AP014866\|CRT	6485-6528	44	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175959-176002	0	1.0
NZ_AP014866_1	1.11\|6485\|44\|NZ_AP014866\|CRT	6485-6528	44	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180184-180227	0	1.0
NZ_AP014866_1	1.11\|6485\|44\|NZ_AP014866\|CRT	6485-6528	44	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704592-704635	0	1.0
NZ_AP014866_1	1.11\|6485\|44\|NZ_AP014866\|CRT	6485-6528	44	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24130-24173	0	1.0
NZ_AP014866_1	1.11\|6485\|44\|NZ_AP014866\|CRT	6485-6528	44	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	141124-141167	0	1.0
NZ_AP014866_1	1.11\|6485\|44\|NZ_AP014866\|CRT	6485-6528	44	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6485-6528	0	1.0
NZ_AP014866_1	1.11\|6485\|44\|NZ_AP014866\|CRT	6485-6528	44	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135856-135899	0	1.0
NZ_AP014866_1	1.12\|6551\|43\|NZ_AP014866\|CRT	6551-6593	43	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143728-143770	0	1.0
NZ_AP014866_1	1.12\|6551\|43\|NZ_AP014866\|CRT	6551-6593	43	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175894-175936	0	1.0
NZ_AP014866_1	1.12\|6551\|43\|NZ_AP014866\|CRT	6551-6593	43	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180119-180161	0	1.0
NZ_AP014866_1	1.12\|6551\|43\|NZ_AP014866\|CRT	6551-6593	43	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	141059-141101	0	1.0
NZ_AP014866_1	1.12\|6551\|43\|NZ_AP014866\|CRT	6551-6593	43	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135791-135833	0	1.0
NZ_AP014866_1	1.12\|6551\|43\|NZ_AP014866\|CRT	6551-6593	43	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704658-704700	0	1.0
NZ_AP014866_1	1.12\|6551\|43\|NZ_AP014866\|CRT	6551-6593	43	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24196-24238	0	1.0
NZ_AP014866_1	1.12\|6551\|43\|NZ_AP014866\|CRT	6551-6593	43	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6551-6593	0	1.0
NZ_AP014866_1	1.13\|6616\|44\|NZ_AP014866\|CRT	6616-6659	44	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704723-704766	0	1.0
NZ_AP014866_1	1.13\|6616\|44\|NZ_AP014866\|CRT	6616-6659	44	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24261-24304	0	1.0
NZ_AP014866_1	1.13\|6616\|44\|NZ_AP014866\|CRT	6616-6659	44	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6616-6659	0	1.0
NZ_AP014866_1	1.13\|6616\|44\|NZ_AP014866\|CRT	6616-6659	44	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143662-143705	0	1.0
NZ_AP014866_1	1.13\|6616\|44\|NZ_AP014866\|CRT	6616-6659	44	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175828-175871	0	1.0
NZ_AP014866_1	1.13\|6616\|44\|NZ_AP014866\|CRT	6616-6659	44	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180053-180096	0	1.0
NZ_AP014866_1	1.13\|6616\|44\|NZ_AP014866\|CRT	6616-6659	44	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7126-7169	0	1.0
NZ_AP014866_1	1.13\|6616\|44\|NZ_AP014866\|CRT	6616-6659	44	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140993-141036	0	1.0
NZ_AP014866_1	1.13\|6616\|44\|NZ_AP014866\|CRT	6616-6659	44	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135725-135768	0	1.0
NZ_AP014866_1	1.14\|6682\|43\|NZ_AP014866\|CRT	6682-6724	43	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143597-143639	0	1.0
NZ_AP014866_1	1.14\|6682\|43\|NZ_AP014866\|CRT	6682-6724	43	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175763-175805	0	1.0
NZ_AP014866_1	1.14\|6682\|43\|NZ_AP014866\|CRT	6682-6724	43	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	179988-180030	0	1.0
NZ_AP014866_1	1.14\|6682\|43\|NZ_AP014866\|CRT	6682-6724	43	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7062-7104	0	1.0
NZ_AP014866_1	1.14\|6682\|43\|NZ_AP014866\|CRT	6682-6724	43	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140928-140970	0	1.0
NZ_AP014866_1	1.14\|6682\|43\|NZ_AP014866\|CRT	6682-6724	43	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135660-135702	0	1.0
NZ_AP014866_1	1.14\|6682\|43\|NZ_AP014866\|CRT	6682-6724	43	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704789-704831	0	1.0
NZ_AP014866_1	1.14\|6682\|43\|NZ_AP014866\|CRT	6682-6724	43	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24327-24369	0	1.0
NZ_AP014866_1	1.14\|6682\|43\|NZ_AP014866\|CRT	6682-6724	43	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6682-6724	0	1.0
NZ_AP014866_1	1.15\|6747\|45\|NZ_AP014866\|CRT	6747-6791	45	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143401-143445	0	1.0
NZ_AP014866_1	1.15\|6747\|45\|NZ_AP014866\|CRT	6747-6791	45	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175567-175611	0	1.0
NZ_AP014866_1	1.15\|6747\|45\|NZ_AP014866\|CRT	6747-6791	45	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	179792-179836	0	1.0
NZ_AP014866_1	1.15\|6747\|45\|NZ_AP014866\|CRT	6747-6791	45	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704983-705027	0	1.0
NZ_AP014866_1	1.15\|6747\|45\|NZ_AP014866\|CRT	6747-6791	45	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24521-24565	0	1.0
NZ_AP014866_1	1.15\|6747\|45\|NZ_AP014866\|CRT	6747-6791	45	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140732-140776	0	1.0
NZ_AP014866_1	1.15\|6747\|45\|NZ_AP014866\|CRT	6747-6791	45	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6747-6791	0	1.0
NZ_AP014866_1	1.15\|6747\|45\|NZ_AP014866\|CRT	6747-6791	45	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135464-135508	0	1.0
NZ_AP014866_1	1.16\|6814\|44\|NZ_AP014866\|CRT	6814-6857	44	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6814-6857	0	1.0
NZ_AP014866_1	1.16\|6814\|44\|NZ_AP014866\|CRT	6814-6857	44	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135398-135441	0	1.0
NZ_AP014866_1	1.17\|6880\|44\|NZ_AP014866\|CRT	6880-6923	44	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	705050-705093	0	1.0
NZ_AP014866_1	1.17\|6880\|44\|NZ_AP014866\|CRT	6880-6923	44	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24588-24631	0	1.0
NZ_AP014866_1	1.17\|6880\|44\|NZ_AP014866\|CRT	6880-6923	44	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6880-6923	0	1.0
NZ_AP014866_1	1.17\|6880\|44\|NZ_AP014866\|CRT	6880-6923	44	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143335-143378	0	1.0
NZ_AP014866_1	1.17\|6880\|44\|NZ_AP014866\|CRT	6880-6923	44	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175501-175544	0	1.0
NZ_AP014866_1	1.17\|6880\|44\|NZ_AP014866\|CRT	6880-6923	44	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	179726-179769	0	1.0
NZ_AP014866_1	1.17\|6880\|44\|NZ_AP014866\|CRT	6880-6923	44	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140666-140709	0	1.0
NZ_AP014866_1	1.17\|6880\|44\|NZ_AP014866\|CRT	6880-6923	44	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135332-135375	0	1.0
NZ_AP014866_1	1.18\|6946\|44\|NZ_AP014866\|CRT	6946-6989	44	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143269-143312	0	1.0
NZ_AP014866_1	1.18\|6946\|44\|NZ_AP014866\|CRT	6946-6989	44	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175435-175478	0	1.0
NZ_AP014866_1	1.18\|6946\|44\|NZ_AP014866\|CRT	6946-6989	44	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	179660-179703	0	1.0
NZ_AP014866_1	1.18\|6946\|44\|NZ_AP014866\|CRT	6946-6989	44	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	6735-6778	0	1.0
NZ_AP014866_1	1.18\|6946\|44\|NZ_AP014866\|CRT	6946-6989	44	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140600-140643	0	1.0
NZ_AP014866_1	1.18\|6946\|44\|NZ_AP014866\|CRT	6946-6989	44	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	705116-705159	0	1.0
NZ_AP014866_1	1.18\|6946\|44\|NZ_AP014866\|CRT	6946-6989	44	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24654-24697	0	1.0
NZ_AP014866_1	1.18\|6946\|44\|NZ_AP014866\|CRT	6946-6989	44	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6946-6989	0	1.0
NZ_AP014866_2	2.1\|292352\|29\|NZ_AP014866\|CRT	292352-292380	29	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	151836-151864	0	1.0
NZ_AP014866_2	2.1\|292352\|29\|NZ_AP014866\|CRT	292352-292380	29	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	183362-183390	0	1.0
NZ_AP014866_2	2.1\|292352\|29\|NZ_AP014866\|CRT	292352-292380	29	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	187587-187615	0	1.0
NZ_AP014866_2	2.1\|292352\|29\|NZ_AP014866\|CRT	292352-292380	29	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	14653-14681	0	1.0
NZ_AP014866_2	2.1\|292352\|29\|NZ_AP014866\|CRT	292352-292380	29	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	148527-148555	0	1.0
NZ_AP014866_2	2.1\|292352\|29\|NZ_AP014866\|CRT	292352-292380	29	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	143288-143316	0	1.0
NZ_AP014866_2	2.1\|292352\|29\|NZ_AP014866\|CRT	292352-292380	29	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	697204-697232	0	1.0
NZ_AP014866_2	2.1\|292352\|29\|NZ_AP014866\|CRT	292352-292380	29	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	16742-16770	0	1.0
NZ_AP014866_2	2.1\|292352\|29\|NZ_AP014866\|CRT	292352-292380	29	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	292352-292380	0	1.0
NZ_AP014866_2	2.2\|292417\|29\|NZ_AP014866\|CRT	292417-292445	29	NZ_CP017573	Bacillus thuringiensis strain SCG04-02 plasmid PSCG61, complete sequence	10724-10752	0	1.0
NZ_AP014866_2	2.2\|292417\|29\|NZ_AP014866\|CRT	292417-292445	29	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	151771-151799	0	1.0
NZ_AP014866_2	2.2\|292417\|29\|NZ_AP014866\|CRT	292417-292445	29	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	183297-183325	0	1.0
NZ_AP014866_2	2.2\|292417\|29\|NZ_AP014866\|CRT	292417-292445	29	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	187522-187550	0	1.0
NZ_AP014866_2	2.2\|292417\|29\|NZ_AP014866\|CRT	292417-292445	29	NZ_CP047087	Bacillus paranthracis strain BC307 plasmid pCE2, complete sequence	65792-65820	0	1.0
NZ_AP014866_2	2.2\|292417\|29\|NZ_AP014866\|CRT	292417-292445	29	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	697269-697297	0	1.0
NZ_AP014866_2	2.2\|292417\|29\|NZ_AP014866\|CRT	292417-292445	29	NC_018510	Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence	186510-186538	0	1.0
NZ_AP014866_2	2.2\|292417\|29\|NZ_AP014866\|CRT	292417-292445	29	NZ_CP029456	Bacillus cereus strain FORC087 plasmid pFORC087.2, complete sequence	42956-42984	0	1.0
NZ_AP014866_2	2.2\|292417\|29\|NZ_AP014866\|CRT	292417-292445	29	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	14588-14616	0	1.0
NZ_AP014866_2	2.2\|292417\|29\|NZ_AP014866\|CRT	292417-292445	29	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	16807-16835	0	1.0
NZ_AP014866_2	2.2\|292417\|29\|NZ_AP014866\|CRT	292417-292445	29	NZ_CP013280	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence	80321-80349	0	1.0
NZ_AP014866_2	2.2\|292417\|29\|NZ_AP014866\|CRT	292417-292445	29	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	148462-148490	0	1.0
NZ_AP014866_2	2.2\|292417\|29\|NZ_AP014866\|CRT	292417-292445	29	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	57724-57752	0	1.0
NZ_AP014866_2	2.2\|292417\|29\|NZ_AP014866\|CRT	292417-292445	29	NC_011656	Bacillus cereus AH187 plasmid pAH187_45, complete sequence	9680-9708	0	1.0
NZ_AP014866_2	2.2\|292417\|29\|NZ_AP014866\|CRT	292417-292445	29	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	292417-292445	0	1.0
NZ_AP014866_2	2.2\|292417\|29\|NZ_AP014866\|CRT	292417-292445	29	NZ_CP039726	Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence	89367-89395	0	1.0
NZ_AP014866_2	2.2\|292417\|29\|NZ_AP014866\|CRT	292417-292445	29	NC_018685	Bacillus thuringiensis MC28 plasmid pMC95, complete sequence	28741-28769	0	1.0
NZ_AP014866_2	2.2\|292417\|29\|NZ_AP014866\|CRT	292417-292445	29	CP041751	Bacillus paranthracis strain NCCP 14796 plasmid unnamed1, complete sequence	5829-5857	0	1.0
NZ_AP014866_2	2.2\|292417\|29\|NZ_AP014866\|CRT	292417-292445	29	NZ_CP009350	Bacillus thuringiensis HD1002 plasmid 4, complete sequence	1708-1736	0	1.0
NZ_AP014866_2	2.2\|292417\|29\|NZ_AP014866\|CRT	292417-292445	29	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	143223-143251	0	1.0
NZ_AP014866_2	2.2\|292417\|29\|NZ_AP014866\|CRT	292417-292445	29	NZ_CP033793	Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence	7584-7612	0	1.0
NZ_AP014866_2	2.3\|292482\|31\|NZ_AP014866\|CRT	292482-292512	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	697334-697364	0	1.0
NZ_AP014866_2	2.3\|292482\|31\|NZ_AP014866\|CRT	292482-292512	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	16872-16902	0	1.0
NZ_AP014866_2	2.3\|292482\|31\|NZ_AP014866\|CRT	292482-292512	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	292482-292512	0	1.0
NZ_AP014866_2	2.3\|292482\|31\|NZ_AP014866\|CRT	292482-292512	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	151704-151734	0	1.0
NZ_AP014866_2	2.3\|292482\|31\|NZ_AP014866\|CRT	292482-292512	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	183230-183260	0	1.0
NZ_AP014866_2	2.3\|292482\|31\|NZ_AP014866\|CRT	292482-292512	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	187455-187485	0	1.0
NZ_AP014866_2	2.3\|292482\|31\|NZ_AP014866\|CRT	292482-292512	31	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	14521-14551	0	1.0
NZ_AP014866_2	2.3\|292482\|31\|NZ_AP014866\|CRT	292482-292512	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	148395-148425	0	1.0
NZ_AP014866_2	2.3\|292482\|31\|NZ_AP014866\|CRT	292482-292512	31	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	143156-143186	0	1.0
NZ_AP014866_2	2.4\|292549\|30\|NZ_AP014866\|CRT	292549-292578	30	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	151638-151667	0	1.0
NZ_AP014866_2	2.4\|292549\|30\|NZ_AP014866\|CRT	292549-292578	30	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	183164-183193	0	1.0
NZ_AP014866_2	2.4\|292549\|30\|NZ_AP014866\|CRT	292549-292578	30	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	187389-187418	0	1.0
NZ_AP014866_2	2.4\|292549\|30\|NZ_AP014866\|CRT	292549-292578	30	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	14455-14484	0	1.0
NZ_AP014866_2	2.4\|292549\|30\|NZ_AP014866\|CRT	292549-292578	30	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	148329-148358	0	1.0
NZ_AP014866_2	2.4\|292549\|30\|NZ_AP014866\|CRT	292549-292578	30	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	143090-143119	0	1.0
NZ_AP014866_2	2.4\|292549\|30\|NZ_AP014866\|CRT	292549-292578	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	697401-697430	0	1.0
NZ_AP014866_2	2.4\|292549\|30\|NZ_AP014866\|CRT	292549-292578	30	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	16939-16968	0	1.0
NZ_AP014866_2	2.4\|292549\|30\|NZ_AP014866\|CRT	292549-292578	30	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	292549-292578	0	1.0
NZ_AP014866_1	1.2\|6495\|34\|NZ_AP014866\|CRISPRCasFinder	6495-6528	34	NZ_CP020748	Bacillus mycoides strain Gnyt1 plasmid unnamed5, complete sequence	17567-17600	1	0.971
NZ_AP014866_1	1.2\|6495\|34\|NZ_AP014866\|CRISPRCasFinder	6495-6528	34	NZ_CP011157	Bacillus cereus strain HN001 plasmid pRML02, complete sequence	11311-11344	1	0.971
NZ_AP014866_1	1.3\|6561\|33\|NZ_AP014866\|CRISPRCasFinder	6561-6593	33	NC_017206	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence	81662-81694	1	0.97
NZ_AP014866_1	1.3\|6561\|33\|NZ_AP014866\|CRISPRCasFinder	6561-6593	33	NZ_CP047087	Bacillus paranthracis strain BC307 plasmid pCE2, complete sequence	70876-70908	1	0.97
NZ_AP014866_1	1.3\|6561\|33\|NZ_AP014866\|CRISPRCasFinder	6561-6593	33	NC_018510	Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence	191924-191956	1	0.97
NZ_AP014866_1	1.3\|6561\|33\|NZ_AP014866\|CRISPRCasFinder	6561-6593	33	NC_022882	Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence	142461-142493	1	0.97
NZ_AP014866_1	1.3\|6561\|33\|NZ_AP014866\|CRISPRCasFinder	6561-6593	33	NC_020383	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence	62525-62557	1	0.97
NZ_AP014866_1	1.3\|6561\|33\|NZ_AP014866\|CRISPRCasFinder	6561-6593	33	NZ_CP013280	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence	74903-74935	1	0.97
NZ_AP014866_1	1.3\|6561\|33\|NZ_AP014866\|CRISPRCasFinder	6561-6593	33	NZ_CP039726	Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence	83949-83981	1	0.97
NZ_AP014866_1	1.3\|6561\|33\|NZ_AP014866\|CRISPRCasFinder	6561-6593	33	NZ_CP009350	Bacillus thuringiensis HD1002 plasmid 4, complete sequence	103733-103765	1	0.97
NZ_AP014866_1	1.3\|6561\|33\|NZ_AP014866\|CRISPRCasFinder	6561-6593	33	NC_022877	Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence	89648-89680	1	0.97
NZ_AP014866_1	1.3\|6561\|33\|NZ_AP014866\|CRISPRCasFinder	6561-6593	33	CP016198	Bacillus thuringiensis serovar coreanensis strain ST7 plasmid pST7-4, complete sequence	32033-32065	1	0.97
NZ_AP014866_1	1.5\|6692\|33\|NZ_AP014866\|CRISPRCasFinder	6692-6724	33	NZ_CP010096	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMBLin15, complete sequence	10984-11016	1	0.97
NZ_AP014866_1	1.6\|6757\|35\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6757-6791	35	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	6865-6899	1	0.971
NZ_AP014866_1	1.9\|6956\|34\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6956-6989	34	NZ_CP010096	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMBLin15, complete sequence	12891-12924	1	0.971
NZ_AP014866_1	1.11\|6485\|44\|NZ_AP014866\|CRT	6485-6528	44	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7258-7301	1	0.977
NZ_AP014866_1	1.14\|6682\|43\|NZ_AP014866\|CRT	6682-6724	43	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	151936-151978	1	0.977
NZ_AP014866_1	1.14\|6682\|43\|NZ_AP014866\|CRT	6682-6724	43	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	243837-243879	1	0.977
NZ_AP014866_1	1.15\|6747\|45\|NZ_AP014866\|CRT	6747-6791	45	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	6865-6909	1	0.978
NZ_AP014866_1	1.17\|6880\|44\|NZ_AP014866\|CRT	6880-6923	44	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	6800-6843	1	0.977
NZ_AP014866_2	2.2\|292417\|29\|NZ_AP014866\|CRT	292417-292445	29	NC_017206	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence	76595-76623	1	0.966
NZ_AP014866_2	2.2\|292417\|29\|NZ_AP014866\|CRT	292417-292445	29	CP024689	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-5-125K, complete sequence	14981-15009	1	0.966
NZ_AP014866_2	2.2\|292417\|29\|NZ_AP014866\|CRT	292417-292445	29	NC_020383	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence	57458-57486	1	0.966
NZ_AP014866_1	1.2\|6495\|34\|NZ_AP014866\|CRISPRCasFinder	6495-6528	34	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704733-704766	2	0.941
NZ_AP014866_1	1.2\|6495\|34\|NZ_AP014866\|CRISPRCasFinder	6495-6528	34	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24271-24304	2	0.941
NZ_AP014866_1	1.2\|6495\|34\|NZ_AP014866\|CRISPRCasFinder	6495-6528	34	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6626-6659	2	0.941
NZ_AP014866_1	1.2\|6495\|34\|NZ_AP014866\|CRISPRCasFinder	6495-6528	34	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143662-143695	2	0.941
NZ_AP014866_1	1.2\|6495\|34\|NZ_AP014866\|CRISPRCasFinder	6495-6528	34	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175828-175861	2	0.941
NZ_AP014866_1	1.2\|6495\|34\|NZ_AP014866\|CRISPRCasFinder	6495-6528	34	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180053-180086	2	0.941
NZ_AP014866_1	1.2\|6495\|34\|NZ_AP014866\|CRISPRCasFinder	6495-6528	34	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7126-7159	2	0.941
NZ_AP014866_1	1.2\|6495\|34\|NZ_AP014866\|CRISPRCasFinder	6495-6528	34	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140993-141026	2	0.941
NZ_AP014866_1	1.2\|6495\|34\|NZ_AP014866\|CRISPRCasFinder	6495-6528	34	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135725-135758	2	0.941
NZ_AP014866_1	1.3\|6561\|33\|NZ_AP014866\|CRISPRCasFinder	6561-6593	33	NC_022782	Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence	48450-48482	2	0.939
NZ_AP014866_1	1.3\|6561\|33\|NZ_AP014866\|CRISPRCasFinder	6561-6593	33	NZ_CP017573	Bacillus thuringiensis strain SCG04-02 plasmid PSCG61, complete sequence	5936-5968	2	0.939
NZ_AP014866_1	1.3\|6561\|33\|NZ_AP014866\|CRISPRCasFinder	6561-6593	33	NZ_CP029456	Bacillus cereus strain FORC087 plasmid pFORC087.2, complete sequence	37904-37936	2	0.939
NZ_AP014866_1	1.3\|6561\|33\|NZ_AP014866\|CRISPRCasFinder	6561-6593	33	NC_011656	Bacillus cereus AH187 plasmid pAH187_45, complete sequence	4616-4648	2	0.939
NZ_AP014866_1	1.4\|6626\|34\|NZ_AP014866\|CRISPRCasFinder	6626-6659	34	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704602-704635	2	0.941
NZ_AP014866_1	1.4\|6626\|34\|NZ_AP014866\|CRISPRCasFinder	6626-6659	34	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24140-24173	2	0.941
NZ_AP014866_1	1.4\|6626\|34\|NZ_AP014866\|CRISPRCasFinder	6626-6659	34	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6495-6528	2	0.941
NZ_AP014866_1	1.4\|6626\|34\|NZ_AP014866\|CRISPRCasFinder	6626-6659	34	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143793-143826	2	0.941
NZ_AP014866_1	1.4\|6626\|34\|NZ_AP014866\|CRISPRCasFinder	6626-6659	34	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175959-175992	2	0.941
NZ_AP014866_1	1.4\|6626\|34\|NZ_AP014866\|CRISPRCasFinder	6626-6659	34	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180184-180217	2	0.941
NZ_AP014866_1	1.4\|6626\|34\|NZ_AP014866\|CRISPRCasFinder	6626-6659	34	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7258-7291	2	0.941
NZ_AP014866_1	1.4\|6626\|34\|NZ_AP014866\|CRISPRCasFinder	6626-6659	34	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	141124-141157	2	0.941
NZ_AP014866_1	1.4\|6626\|34\|NZ_AP014866\|CRISPRCasFinder	6626-6659	34	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135856-135889	2	0.941
NZ_AP014866_1	1.4\|6626\|34\|NZ_AP014866\|CRISPRCasFinder	6626-6659	34	NZ_KX258624	Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence	50231-50264	2	0.941
NZ_AP014866_2	2.2\|292417\|29\|NZ_AP014866\|CRT	292417-292445	29	NC_022882	Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence	134344-134372	2	0.931
NZ_AP014866_2	2.2\|292417\|29\|NZ_AP014866\|CRT	292417-292445	29	NC_022877	Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence	97769-97797	2	0.931
NZ_AP014866_2	2.2\|292417\|29\|NZ_AP014866\|CRT	292417-292445	29	NC_022782	Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence	43137-43165	2	0.931
NZ_AP014866_2	2.4\|292549\|30\|NZ_AP014866\|CRT	292549-292578	30	MH598512	Bacillus phage Wes44, complete genome	12678-12707	2	0.933
NZ_AP014866_1	1.5\|6692\|33\|NZ_AP014866\|CRISPRCasFinder	6692-6724	33	NZ_AP014870	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK6	7217-7249	3	0.909
NZ_AP014866_1	1.11\|6485\|44\|NZ_AP014866\|CRT	6485-6528	44	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143662-143705	3	0.932
NZ_AP014866_1	1.11\|6485\|44\|NZ_AP014866\|CRT	6485-6528	44	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175828-175871	3	0.932
NZ_AP014866_1	1.11\|6485\|44\|NZ_AP014866\|CRT	6485-6528	44	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180053-180096	3	0.932
NZ_AP014866_1	1.11\|6485\|44\|NZ_AP014866\|CRT	6485-6528	44	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704723-704766	3	0.932
NZ_AP014866_1	1.11\|6485\|44\|NZ_AP014866\|CRT	6485-6528	44	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24261-24304	3	0.932
NZ_AP014866_1	1.11\|6485\|44\|NZ_AP014866\|CRT	6485-6528	44	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	140993-141036	3	0.932
NZ_AP014866_1	1.11\|6485\|44\|NZ_AP014866\|CRT	6485-6528	44	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6616-6659	3	0.932
NZ_AP014866_1	1.11\|6485\|44\|NZ_AP014866\|CRT	6485-6528	44	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135725-135768	3	0.932
NZ_AP014866_1	1.11\|6485\|44\|NZ_AP014866\|CRT	6485-6528	44	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7126-7169	3	0.932
NZ_AP014866_1	1.11\|6485\|44\|NZ_AP014866\|CRT	6485-6528	44	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	151409-151452	3	0.932
NZ_AP014866_1	1.11\|6485\|44\|NZ_AP014866\|CRT	6485-6528	44	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	243310-243353	3	0.932
NZ_AP014866_1	1.13\|6616\|44\|NZ_AP014866\|CRT	6616-6659	44	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	704592-704635	3	0.932
NZ_AP014866_1	1.13\|6616\|44\|NZ_AP014866\|CRT	6616-6659	44	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	24130-24173	3	0.932
NZ_AP014866_1	1.13\|6616\|44\|NZ_AP014866\|CRT	6616-6659	44	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	6485-6528	3	0.932
NZ_AP014866_1	1.13\|6616\|44\|NZ_AP014866\|CRT	6616-6659	44	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	143793-143836	3	0.932
NZ_AP014866_1	1.13\|6616\|44\|NZ_AP014866\|CRT	6616-6659	44	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	175959-176002	3	0.932
NZ_AP014866_1	1.13\|6616\|44\|NZ_AP014866\|CRT	6616-6659	44	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	180184-180227	3	0.932
NZ_AP014866_1	1.13\|6616\|44\|NZ_AP014866\|CRT	6616-6659	44	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	141124-141167	3	0.932
NZ_AP014866_1	1.13\|6616\|44\|NZ_AP014866\|CRT	6616-6659	44	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	135856-135899	3	0.932
NZ_AP014866_1	1.13\|6616\|44\|NZ_AP014866\|CRT	6616-6659	44	NZ_KX258624	Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence	50221-50264	3	0.932
NZ_AP014866_2	2.1\|292352\|29\|NZ_AP014866\|CRT	292352-292380	29	NZ_CP014851	Bacillus thuringiensis strain HD12 plasmid pHD120112, complete sequence	21454-21482	3	0.897
NZ_AP014866_2	2.1\|292352\|29\|NZ_AP014866\|CRT	292352-292380	29	NZ_CP011157	Bacillus cereus strain HN001 plasmid pRML02, complete sequence	123667-123695	3	0.897
NZ_AP014866_1	1.9\|6956\|34\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6956-6989	34	NZ_CP004882	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMBLin15, complete sequence	12814-12847	4	0.882
NZ_AP014866_1	1.9\|6956\|34\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6956-6989	34	NZ_CP011355	Bacillus thuringiensis strain YC-10 plasmid pYC10, complete sequence	9710-9743	4	0.882
NZ_AP014866_1	1.9\|6956\|34\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6956-6989	34	NC_006945	Bacillus phage GIL16c, complete genome	12805-12838	4	0.882
NZ_AP014866_1	1.9\|6956\|34\|NZ_AP014866\|CRISPRCasFinder,PILER-CR	6956-6989	34	AY701338	Bacillus thuringiensis phage GIL16c, complete genome	12805-12838	4	0.882
NZ_AP014866_1	1.2\|6495\|34\|NZ_AP014866\|CRISPRCasFinder	6495-6528	34	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	151419-151452	5	0.853
NZ_AP014866_1	1.2\|6495\|34\|NZ_AP014866\|CRISPRCasFinder	6495-6528	34	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	243320-243353	5	0.853
NZ_AP014866_1	1.5\|6692\|33\|NZ_AP014866\|CRISPRCasFinder	6692-6724	33	NZ_CP004882	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMBLin15, complete sequence	10906-10938	5	0.848
NZ_AP014866_1	1.5\|6692\|33\|NZ_AP014866\|CRISPRCasFinder	6692-6724	33	NZ_CP011355	Bacillus thuringiensis strain YC-10 plasmid pYC10, complete sequence	7802-7834	5	0.848
NZ_AP014866_1	1.5\|6692\|33\|NZ_AP014866\|CRISPRCasFinder	6692-6724	33	NC_006945	Bacillus phage GIL16c, complete genome	10897-10929	5	0.848
NZ_AP014866_1	1.5\|6692\|33\|NZ_AP014866\|CRISPRCasFinder	6692-6724	33	AY701338	Bacillus thuringiensis phage GIL16c, complete genome	10897-10929	5	0.848
NZ_AP014866_1	1.13\|6616\|44\|NZ_AP014866\|CRT	6616-6659	44	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	7258-7301	5	0.886
NZ_AP014866_1	1.12\|6551\|43\|NZ_AP014866\|CRT	6551-6593	43	CP024689	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-5-125K, complete sequence	6561-6603	6	0.86
NZ_AP014866_1	1.12\|6551\|43\|NZ_AP014866\|CRT	6551-6593	43	NC_018685	Bacillus thuringiensis MC28 plasmid pMC95, complete sequence	23112-23154	6	0.86
NZ_AP014866_1	1.16\|6814\|44\|NZ_AP014866\|CRT	6814-6857	44	NZ_CP024774	Bacillus thuringiensis LM1212 plasmid pLM3, complete sequence	48448-48491	6	0.864
NZ_AP014866_1	1.16\|6814\|44\|NZ_AP014866\|CRT	6814-6857	44	NZ_CP041074	Bacillus tropicus strain LM1212-W3 plasmid p1, complete sequence	21258-21301	6	0.864
NZ_AP014866_1	1.16\|6814\|44\|NZ_AP014866\|CRT	6814-6857	44	NZ_CP015253	Bacillus thuringiensis Bt18247 plasmid p113275, complete sequence	6183-6226	6	0.864
NZ_AP014866_1	1.12\|6551\|43\|NZ_AP014866\|CRT	6551-6593	43	CP041751	Bacillus paranthracis strain NCCP 14796 plasmid unnamed1, complete sequence	10913-10955	7	0.837
NZ_AP014866_1	1.12\|6551\|43\|NZ_AP014866\|CRT	6551-6593	43	NZ_CP033793	Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence	2190-2232	7	0.837
NZ_AP014866_1	1.14\|6682\|43\|NZ_AP014866\|CRT	6682-6724	43	NC_005258	Bacillus phage Bam35c, complete genome	10971-11013	7	0.837
NZ_AP014866_1	1.14\|6682\|43\|NZ_AP014866\|CRT	6682-6724	43	AY257527	Bacillus thuringiensis bacteriophage Bam35c, complete genome	10971-11013	7	0.837
NZ_AP014866_1	1.14\|6682\|43\|NZ_AP014866\|CRT	6682-6724	43	AJ536073	Bacillus phage pGIL01, complete genome	10969-11011	7	0.837
NZ_AP014866_1	1.14\|6682\|43\|NZ_AP014866\|CRT	6682-6724	43	NZ_CP053974	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed5, complete sequence	2147-2189	7	0.837
NZ_AP014866_1	1.14\|6682\|43\|NZ_AP014866\|CRT	6682-6724	43	NZ_CP009346	Bacillus thuringiensis HD1002 plasmid 5, complete sequence	3923-3965	7	0.837
NZ_AP014866_1	1.14\|6682\|43\|NZ_AP014866\|CRT	6682-6724	43	NZ_CP045027	Bacillus thuringiensis strain JW-1 plasmid p5, complete sequence	3921-3963	7	0.837
NZ_AP014866_1	1.14\|6682\|43\|NZ_AP014866\|CRT	6682-6724	43	CP013282	Bacillus phage pGIL02, complete sequence	3923-3965	7	0.837
NZ_AP014866_2	2.1\|292352\|29\|NZ_AP014866\|CRT	292352-292380	29	MN694586	Marine virus AFVG_250M370, complete genome	30060-30088	7	0.759
NZ_AP014866_1	1.11\|6485\|44\|NZ_AP014866\|CRT	6485-6528	44	NZ_CP011157	Bacillus cereus strain HN001 plasmid pRML02, complete sequence	11301-11344	8	0.818
NZ_AP014866_1	1.12\|6551\|43\|NZ_AP014866\|CRT	6551-6593	43	NC_017206	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence	81662-81704	8	0.814
NZ_AP014866_1	1.12\|6551\|43\|NZ_AP014866\|CRT	6551-6593	43	NZ_CP047087	Bacillus paranthracis strain BC307 plasmid pCE2, complete sequence	70876-70918	8	0.814
NZ_AP014866_1	1.12\|6551\|43\|NZ_AP014866\|CRT	6551-6593	43	NC_018510	Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence	191924-191966	8	0.814
NZ_AP014866_1	1.12\|6551\|43\|NZ_AP014866\|CRT	6551-6593	43	NC_022882	Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence	142461-142503	8	0.814
NZ_AP014866_1	1.12\|6551\|43\|NZ_AP014866\|CRT	6551-6593	43	NC_020383	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence	62525-62567	8	0.814
NZ_AP014866_1	1.12\|6551\|43\|NZ_AP014866\|CRT	6551-6593	43	NZ_CP013280	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence	74893-74935	8	0.814
NZ_AP014866_1	1.12\|6551\|43\|NZ_AP014866\|CRT	6551-6593	43	NZ_CP039726	Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence	83939-83981	8	0.814
NZ_AP014866_1	1.12\|6551\|43\|NZ_AP014866\|CRT	6551-6593	43	NZ_CP009350	Bacillus thuringiensis HD1002 plasmid 4, complete sequence	103723-103765	8	0.814
NZ_AP014866_1	1.12\|6551\|43\|NZ_AP014866\|CRT	6551-6593	43	NC_022877	Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence	89638-89680	8	0.814
NZ_AP014866_1	1.12\|6551\|43\|NZ_AP014866\|CRT	6551-6593	43	CP016198	Bacillus thuringiensis serovar coreanensis strain ST7 plasmid pST7-4, complete sequence	32023-32065	8	0.814
NZ_AP014866_1	1.12\|6551\|43\|NZ_AP014866\|CRT	6551-6593	43	NC_022782	Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence	48450-48492	8	0.814
NZ_AP014866_1	1.14\|6682\|43\|NZ_AP014866\|CRT	6682-6724	43	NZ_CP010096	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMBLin15, complete sequence	10984-11026	8	0.814
NZ_AP014866_1	1.18\|6946\|44\|NZ_AP014866\|CRT	6946-6989	44	NZ_CP010096	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMBLin15, complete sequence	12881-12924	8	0.818
NZ_AP014866_2	2.4\|292549\|30\|NZ_AP014866\|CRT	292549-292578	30	X97918	Bacteriophage SPP1 complete nucleotide sequence	16331-16360	8	0.733
NZ_AP014866_1	1.11\|6485\|44\|NZ_AP014866\|CRT	6485-6528	44	NZ_CP020748	Bacillus mycoides strain Gnyt1 plasmid unnamed5, complete sequence	17557-17600	9	0.795
NZ_AP014866_1	1.12\|6551\|43\|NZ_AP014866\|CRT	6551-6593	43	NZ_CP017573	Bacillus thuringiensis strain SCG04-02 plasmid PSCG61, complete sequence	5926-5968	9	0.791
NZ_AP014866_1	1.12\|6551\|43\|NZ_AP014866\|CRT	6551-6593	43	NZ_CP029456	Bacillus cereus strain FORC087 plasmid pFORC087.2, complete sequence	37894-37936	9	0.791
NZ_AP014866_1	1.12\|6551\|43\|NZ_AP014866\|CRT	6551-6593	43	NC_011656	Bacillus cereus AH187 plasmid pAH187_45, complete sequence	4606-4648	9	0.791

1. spacer 1.1|6430|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

catgactgaattttgtcaaaattgtgatattat	CRISPR spacer
catgactgaattttgtcaaaattgtgatattat	Protospacer
*********************************

2. spacer 1.1|6430|33|NZ_AP014866|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

catgactgaattttgtcaaaattgtgatattat	CRISPR spacer
catgactgaattttgtcaaaattgtgatattat	Protospacer
*********************************

3. spacer 1.1|6430|33|NZ_AP014866|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

catgactgaattttgtcaaaattgtgatattat	CRISPR spacer
catgactgaattttgtcaaaattgtgatattat	Protospacer
*********************************

4. spacer 1.1|6430|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

catgactgaattttgtcaaaattgtgatattat	CRISPR spacer
catgactgaattttgtcaaaattgtgatattat	Protospacer
*********************************

5. spacer 1.1|6430|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

catgactgaattttgtcaaaattgtgatattat	CRISPR spacer
catgactgaattttgtcaaaattgtgatattat	Protospacer
*********************************

6. spacer 1.1|6430|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

catgactgaattttgtcaaaattgtgatattat	CRISPR spacer
catgactgaattttgtcaaaattgtgatattat	Protospacer
*********************************

7. spacer 1.1|6430|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

catgactgaattttgtcaaaattgtgatattat	CRISPR spacer
catgactgaattttgtcaaaattgtgatattat	Protospacer
*********************************

8. spacer 1.1|6430|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

catgactgaattttgtcaaaattgtgatattat	CRISPR spacer
catgactgaattttgtcaaaattgtgatattat	Protospacer
*********************************

9. spacer 1.1|6430|33|NZ_AP014866|CRISPRCasFinder matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

catgactgaattttgtcaaaattgtgatattat	CRISPR spacer
catgactgaattttgtcaaaattgtgatattat	Protospacer
*********************************

10. spacer 1.2|6495|34|NZ_AP014866|CRISPRCasFinder matches to NZ_KX258624 (Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence) position: , mismatch: 0, identity: 1.0

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
**********************************

11. spacer 1.2|6495|34|NZ_AP014866|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
**********************************

12. spacer 1.2|6495|34|NZ_AP014866|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
**********************************

13. spacer 1.2|6495|34|NZ_AP014866|CRISPRCasFinder matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
**********************************

14. spacer 1.2|6495|34|NZ_AP014866|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
**********************************

15. spacer 1.2|6495|34|NZ_AP014866|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
**********************************

16. spacer 1.2|6495|34|NZ_AP014866|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
**********************************

17. spacer 1.2|6495|34|NZ_AP014866|CRISPRCasFinder matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
**********************************

18. spacer 1.2|6495|34|NZ_AP014866|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
**********************************

19. spacer 1.2|6495|34|NZ_AP014866|CRISPRCasFinder matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
**********************************

20. spacer 1.3|6561|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*********************************

21. spacer 1.3|6561|33|NZ_AP014866|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*********************************

22. spacer 1.3|6561|33|NZ_AP014866|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*********************************

23. spacer 1.3|6561|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*********************************

24. spacer 1.3|6561|33|NZ_AP014866|CRISPRCasFinder matches to CP041751 (Bacillus paranthracis strain NCCP 14796 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*********************************

25. spacer 1.3|6561|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*********************************

26. spacer 1.3|6561|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*********************************

27. spacer 1.3|6561|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*********************************

28. spacer 1.3|6561|33|NZ_AP014866|CRISPRCasFinder matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*********************************

29. spacer 1.3|6561|33|NZ_AP014866|CRISPRCasFinder matches to CP024689 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-5-125K, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*********************************

30. spacer 1.3|6561|33|NZ_AP014866|CRISPRCasFinder matches to NC_018685 (Bacillus thuringiensis MC28 plasmid pMC95, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*********************************

31. spacer 1.3|6561|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP033793 (Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*********************************

32. spacer 1.4|6626|34|NZ_AP014866|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
**********************************

33. spacer 1.4|6626|34|NZ_AP014866|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
**********************************

34. spacer 1.4|6626|34|NZ_AP014866|CRISPRCasFinder matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
**********************************

35. spacer 1.4|6626|34|NZ_AP014866|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
**********************************

36. spacer 1.4|6626|34|NZ_AP014866|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
**********************************

37. spacer 1.4|6626|34|NZ_AP014866|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
**********************************

38. spacer 1.4|6626|34|NZ_AP014866|CRISPRCasFinder matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
**********************************

39. spacer 1.4|6626|34|NZ_AP014866|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
**********************************

40. spacer 1.4|6626|34|NZ_AP014866|CRISPRCasFinder matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
**********************************

41. spacer 1.5|6692|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

42. spacer 1.5|6692|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

43. spacer 1.5|6692|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP053974 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

44. spacer 1.5|6692|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

45. spacer 1.5|6692|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

46. spacer 1.5|6692|33|NZ_AP014866|CRISPRCasFinder matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

47. spacer 1.5|6692|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP009346 (Bacillus thuringiensis HD1002 plasmid 5, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

48. spacer 1.5|6692|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP045027 (Bacillus thuringiensis strain JW-1 plasmid p5, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

49. spacer 1.5|6692|33|NZ_AP014866|CRISPRCasFinder matches to CP013282 (Bacillus phage pGIL02, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

50. spacer 1.5|6692|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

51. spacer 1.5|6692|33|NZ_AP014866|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

52. spacer 1.5|6692|33|NZ_AP014866|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

53. spacer 1.5|6692|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

54. spacer 1.5|6692|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

55. spacer 1.5|6692|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

56. spacer 1.5|6692|33|NZ_AP014866|CRISPRCasFinder matches to NC_005258 (Bacillus phage Bam35c, complete genome) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

57. spacer 1.5|6692|33|NZ_AP014866|CRISPRCasFinder matches to AY257527 (Bacillus thuringiensis bacteriophage Bam35c, complete genome) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

58. spacer 1.5|6692|33|NZ_AP014866|CRISPRCasFinder matches to AJ536073 (Bacillus phage pGIL01, complete genome) position: , mismatch: 0, identity: 1.0

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactccta	Protospacer
*********************************

59. spacer 1.6|6757|35|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

tttaaaacgtgcataacctaacactttcccattgt	CRISPR spacer
tttaaaacgtgcataacctaacactttcccattgt	Protospacer
***********************************

60. spacer 1.6|6757|35|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

tttaaaacgtgcataacctaacactttcccattgt	CRISPR spacer
tttaaaacgtgcataacctaacactttcccattgt	Protospacer
***********************************

61. spacer 1.6|6757|35|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

tttaaaacgtgcataacctaacactttcccattgt	CRISPR spacer
tttaaaacgtgcataacctaacactttcccattgt	Protospacer
***********************************

62. spacer 1.6|6757|35|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

tttaaaacgtgcataacctaacactttcccattgt	CRISPR spacer
tttaaaacgtgcataacctaacactttcccattgt	Protospacer
***********************************

63. spacer 1.6|6757|35|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

tttaaaacgtgcataacctaacactttcccattgt	CRISPR spacer
tttaaaacgtgcataacctaacactttcccattgt	Protospacer
***********************************

64. spacer 1.6|6757|35|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

tttaaaacgtgcataacctaacactttcccattgt	CRISPR spacer
tttaaaacgtgcataacctaacactttcccattgt	Protospacer
***********************************

65. spacer 1.6|6757|35|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

tttaaaacgtgcataacctaacactttcccattgt	CRISPR spacer
tttaaaacgtgcataacctaacactttcccattgt	Protospacer
***********************************

66. spacer 1.6|6757|35|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

tttaaaacgtgcataacctaacactttcccattgt	CRISPR spacer
tttaaaacgtgcataacctaacactttcccattgt	Protospacer
***********************************

67. spacer 1.7|6824|34|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NZ_CP024774 (Bacillus thuringiensis LM1212 plasmid pLM3, complete sequence) position: , mismatch: 0, identity: 1.0

cactcggaactaataacgcaaacattgccaccca	CRISPR spacer
cactcggaactaataacgcaaacattgccaccca	Protospacer
**********************************

68. spacer 1.7|6824|34|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

cactcggaactaataacgcaaacattgccaccca	CRISPR spacer
cactcggaactaataacgcaaacattgccaccca	Protospacer
**********************************

69. spacer 1.7|6824|34|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

cactcggaactaataacgcaaacattgccaccca	CRISPR spacer
cactcggaactaataacgcaaacattgccaccca	Protospacer
**********************************

70. spacer 1.7|6824|34|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NZ_CP041074 (Bacillus tropicus strain LM1212-W3 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

cactcggaactaataacgcaaacattgccaccca	CRISPR spacer
cactcggaactaataacgcaaacattgccaccca	Protospacer
**********************************

71. spacer 1.7|6824|34|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NZ_CP015253 (Bacillus thuringiensis Bt18247 plasmid p113275, complete sequence) position: , mismatch: 0, identity: 1.0

cactcggaactaataacgcaaacattgccaccca	CRISPR spacer
cactcggaactaataacgcaaacattgccaccca	Protospacer
**********************************

72. spacer 1.8|6890|34|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

ttttttactcggatactctaaaggtgtaacaata	CRISPR spacer
ttttttactcggatactctaaaggtgtaacaata	Protospacer
**********************************

73. spacer 1.8|6890|34|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

ttttttactcggatactctaaaggtgtaacaata	CRISPR spacer
ttttttactcggatactctaaaggtgtaacaata	Protospacer
**********************************

74. spacer 1.8|6890|34|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

ttttttactcggatactctaaaggtgtaacaata	CRISPR spacer
ttttttactcggatactctaaaggtgtaacaata	Protospacer
**********************************

75. spacer 1.8|6890|34|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

ttttttactcggatactctaaaggtgtaacaata	CRISPR spacer
ttttttactcggatactctaaaggtgtaacaata	Protospacer
**********************************

76. spacer 1.8|6890|34|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

ttttttactcggatactctaaaggtgtaacaata	CRISPR spacer
ttttttactcggatactctaaaggtgtaacaata	Protospacer
**********************************

77. spacer 1.8|6890|34|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

ttttttactcggatactctaaaggtgtaacaata	CRISPR spacer
ttttttactcggatactctaaaggtgtaacaata	Protospacer
**********************************

78. spacer 1.8|6890|34|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

ttttttactcggatactctaaaggtgtaacaata	CRISPR spacer
ttttttactcggatactctaaaggtgtaacaata	Protospacer
**********************************

79. spacer 1.8|6890|34|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

ttttttactcggatactctaaaggtgtaacaata	CRISPR spacer
ttttttactcggatactctaaaggtgtaacaata	Protospacer
**********************************

80. spacer 1.9|6956|34|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

atgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
atgtgggtgacgtcattaaattctcgtatcttgt	Protospacer
**********************************

81. spacer 1.9|6956|34|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

atgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
atgtgggtgacgtcattaaattctcgtatcttgt	Protospacer
**********************************

82. spacer 1.9|6956|34|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

atgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
atgtgggtgacgtcattaaattctcgtatcttgt	Protospacer
**********************************

83. spacer 1.9|6956|34|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

atgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
atgtgggtgacgtcattaaattctcgtatcttgt	Protospacer
**********************************

84. spacer 1.9|6956|34|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

atgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
atgtgggtgacgtcattaaattctcgtatcttgt	Protospacer
**********************************

85. spacer 1.9|6956|34|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

atgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
atgtgggtgacgtcattaaattctcgtatcttgt	Protospacer
**********************************

86. spacer 1.9|6956|34|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

atgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
atgtgggtgacgtcattaaattctcgtatcttgt	Protospacer
**********************************

87. spacer 1.9|6956|34|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

atgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
atgtgggtgacgtcattaaattctcgtatcttgt	Protospacer
**********************************

88. spacer 1.10|6420|43|NZ_AP014866|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcaatcatgactgaattttgtcaaaattgtgatattat	CRISPR spacer
gaggtgcaatcatgactgaattttgtcaaaattgtgatattat	Protospacer
*******************************************

89. spacer 1.10|6420|43|NZ_AP014866|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcaatcatgactgaattttgtcaaaattgtgatattat	CRISPR spacer
gaggtgcaatcatgactgaattttgtcaaaattgtgatattat	Protospacer
*******************************************

90. spacer 1.10|6420|43|NZ_AP014866|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcaatcatgactgaattttgtcaaaattgtgatattat	CRISPR spacer
gaggtgcaatcatgactgaattttgtcaaaattgtgatattat	Protospacer
*******************************************

91. spacer 1.10|6420|43|NZ_AP014866|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcaatcatgactgaattttgtcaaaattgtgatattat	CRISPR spacer
gaggtgcaatcatgactgaattttgtcaaaattgtgatattat	Protospacer
*******************************************

92. spacer 1.10|6420|43|NZ_AP014866|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcaatcatgactgaattttgtcaaaattgtgatattat	CRISPR spacer
gaggtgcaatcatgactgaattttgtcaaaattgtgatattat	Protospacer
*******************************************

93. spacer 1.10|6420|43|NZ_AP014866|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcaatcatgactgaattttgtcaaaattgtgatattat	CRISPR spacer
gaggtgcaatcatgactgaattttgtcaaaattgtgatattat	Protospacer
*******************************************

94. spacer 1.10|6420|43|NZ_AP014866|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcaatcatgactgaattttgtcaaaattgtgatattat	CRISPR spacer
gaggtgcaatcatgactgaattttgtcaaaattgtgatattat	Protospacer
*******************************************

95. spacer 1.10|6420|43|NZ_AP014866|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcaatcatgactgaattttgtcaaaattgtgatattat	CRISPR spacer
gaggtgcaatcatgactgaattttgtcaaaattgtgatattat	Protospacer
*******************************************

96. spacer 1.10|6420|43|NZ_AP014866|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcaatcatgactgaattttgtcaaaattgtgatattat	CRISPR spacer
gaggtgcaatcatgactgaattttgtcaaaattgtgatattat	Protospacer
*******************************************

97. spacer 1.11|6485|44|NZ_AP014866|CRT matches to NZ_KX258624 (Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence) position: , mismatch: 0, identity: 1.0

aaggtgcgactatgagcgttccagataaatataaacccgaggta	CRISPR spacer
aaggtgcgactatgagcgttccagataaatataaacccgaggta	Protospacer
********************************************

98. spacer 1.11|6485|44|NZ_AP014866|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

aaggtgcgactatgagcgttccagataaatataaacccgaggta	CRISPR spacer
aaggtgcgactatgagcgttccagataaatataaacccgaggta	Protospacer
********************************************

99. spacer 1.11|6485|44|NZ_AP014866|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

aaggtgcgactatgagcgttccagataaatataaacccgaggta	CRISPR spacer
aaggtgcgactatgagcgttccagataaatataaacccgaggta	Protospacer
********************************************

100. spacer 1.11|6485|44|NZ_AP014866|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

aaggtgcgactatgagcgttccagataaatataaacccgaggta	CRISPR spacer
aaggtgcgactatgagcgttccagataaatataaacccgaggta	Protospacer
********************************************

101. spacer 1.11|6485|44|NZ_AP014866|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

aaggtgcgactatgagcgttccagataaatataaacccgaggta	CRISPR spacer
aaggtgcgactatgagcgttccagataaatataaacccgaggta	Protospacer
********************************************

102. spacer 1.11|6485|44|NZ_AP014866|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

aaggtgcgactatgagcgttccagataaatataaacccgaggta	CRISPR spacer
aaggtgcgactatgagcgttccagataaatataaacccgaggta	Protospacer
********************************************

103. spacer 1.11|6485|44|NZ_AP014866|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

aaggtgcgactatgagcgttccagataaatataaacccgaggta	CRISPR spacer
aaggtgcgactatgagcgttccagataaatataaacccgaggta	Protospacer
********************************************

104. spacer 1.11|6485|44|NZ_AP014866|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

aaggtgcgactatgagcgttccagataaatataaacccgaggta	CRISPR spacer
aaggtgcgactatgagcgttccagataaatataaacccgaggta	Protospacer
********************************************

105. spacer 1.11|6485|44|NZ_AP014866|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

aaggtgcgactatgagcgttccagataaatataaacccgaggta	CRISPR spacer
aaggtgcgactatgagcgttccagataaatataaacccgaggta	Protospacer
********************************************

106. spacer 1.12|6551|43|NZ_AP014866|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*******************************************

107. spacer 1.12|6551|43|NZ_AP014866|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*******************************************

108. spacer 1.12|6551|43|NZ_AP014866|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*******************************************

109. spacer 1.12|6551|43|NZ_AP014866|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*******************************************

110. spacer 1.12|6551|43|NZ_AP014866|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*******************************************

111. spacer 1.12|6551|43|NZ_AP014866|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*******************************************

112. spacer 1.12|6551|43|NZ_AP014866|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*******************************************

113. spacer 1.12|6551|43|NZ_AP014866|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
*******************************************

114. spacer 1.13|6616|44|NZ_AP014866|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

agggtgcgactatgggcattccagataaatataaacccgaggta	CRISPR spacer
agggtgcgactatgggcattccagataaatataaacccgaggta	Protospacer
********************************************

115. spacer 1.13|6616|44|NZ_AP014866|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

agggtgcgactatgggcattccagataaatataaacccgaggta	CRISPR spacer
agggtgcgactatgggcattccagataaatataaacccgaggta	Protospacer
********************************************

116. spacer 1.13|6616|44|NZ_AP014866|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

agggtgcgactatgggcattccagataaatataaacccgaggta	CRISPR spacer
agggtgcgactatgggcattccagataaatataaacccgaggta	Protospacer
********************************************

117. spacer 1.13|6616|44|NZ_AP014866|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

agggtgcgactatgggcattccagataaatataaacccgaggta	CRISPR spacer
agggtgcgactatgggcattccagataaatataaacccgaggta	Protospacer
********************************************

118. spacer 1.13|6616|44|NZ_AP014866|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

agggtgcgactatgggcattccagataaatataaacccgaggta	CRISPR spacer
agggtgcgactatgggcattccagataaatataaacccgaggta	Protospacer
********************************************

119. spacer 1.13|6616|44|NZ_AP014866|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

agggtgcgactatgggcattccagataaatataaacccgaggta	CRISPR spacer
agggtgcgactatgggcattccagataaatataaacccgaggta	Protospacer
********************************************

120. spacer 1.13|6616|44|NZ_AP014866|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

agggtgcgactatgggcattccagataaatataaacccgaggta	CRISPR spacer
agggtgcgactatgggcattccagataaatataaacccgaggta	Protospacer
********************************************

121. spacer 1.13|6616|44|NZ_AP014866|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

agggtgcgactatgggcattccagataaatataaacccgaggta	CRISPR spacer
agggtgcgactatgggcattccagataaatataaacccgaggta	Protospacer
********************************************

122. spacer 1.13|6616|44|NZ_AP014866|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

agggtgcgactatgggcattccagataaatataaacccgaggta	CRISPR spacer
agggtgcgactatgggcattccagataaatataaacccgaggta	Protospacer
********************************************

123. spacer 1.14|6682|43|NZ_AP014866|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

aaggtgcgactggtctaacatctaaagccattaataactccta	CRISPR spacer
aaggtgcgactggtctaacatctaaagccattaataactccta	Protospacer
*******************************************

124. spacer 1.14|6682|43|NZ_AP014866|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

aaggtgcgactggtctaacatctaaagccattaataactccta	CRISPR spacer
aaggtgcgactggtctaacatctaaagccattaataactccta	Protospacer
*******************************************

125. spacer 1.14|6682|43|NZ_AP014866|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

aaggtgcgactggtctaacatctaaagccattaataactccta	CRISPR spacer
aaggtgcgactggtctaacatctaaagccattaataactccta	Protospacer
*******************************************

126. spacer 1.14|6682|43|NZ_AP014866|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

aaggtgcgactggtctaacatctaaagccattaataactccta	CRISPR spacer
aaggtgcgactggtctaacatctaaagccattaataactccta	Protospacer
*******************************************

127. spacer 1.14|6682|43|NZ_AP014866|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

aaggtgcgactggtctaacatctaaagccattaataactccta	CRISPR spacer
aaggtgcgactggtctaacatctaaagccattaataactccta	Protospacer
*******************************************

128. spacer 1.14|6682|43|NZ_AP014866|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

aaggtgcgactggtctaacatctaaagccattaataactccta	CRISPR spacer
aaggtgcgactggtctaacatctaaagccattaataactccta	Protospacer
*******************************************

129. spacer 1.14|6682|43|NZ_AP014866|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

aaggtgcgactggtctaacatctaaagccattaataactccta	CRISPR spacer
aaggtgcgactggtctaacatctaaagccattaataactccta	Protospacer
*******************************************

130. spacer 1.14|6682|43|NZ_AP014866|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

aaggtgcgactggtctaacatctaaagccattaataactccta	CRISPR spacer
aaggtgcgactggtctaacatctaaagccattaataactccta	Protospacer
*******************************************

131. spacer 1.14|6682|43|NZ_AP014866|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

aaggtgcgactggtctaacatctaaagccattaataactccta	CRISPR spacer
aaggtgcgactggtctaacatctaaagccattaataactccta	Protospacer
*******************************************

132. spacer 1.15|6747|45|NZ_AP014866|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgactttaaaacgtgcataacctaacactttcccattgt	CRISPR spacer
gaggtgcgactttaaaacgtgcataacctaacactttcccattgt	Protospacer
*********************************************

133. spacer 1.15|6747|45|NZ_AP014866|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgactttaaaacgtgcataacctaacactttcccattgt	CRISPR spacer
gaggtgcgactttaaaacgtgcataacctaacactttcccattgt	Protospacer
*********************************************

134. spacer 1.15|6747|45|NZ_AP014866|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgactttaaaacgtgcataacctaacactttcccattgt	CRISPR spacer
gaggtgcgactttaaaacgtgcataacctaacactttcccattgt	Protospacer
*********************************************

135. spacer 1.15|6747|45|NZ_AP014866|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgactttaaaacgtgcataacctaacactttcccattgt	CRISPR spacer
gaggtgcgactttaaaacgtgcataacctaacactttcccattgt	Protospacer
*********************************************

136. spacer 1.15|6747|45|NZ_AP014866|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgactttaaaacgtgcataacctaacactttcccattgt	CRISPR spacer
gaggtgcgactttaaaacgtgcataacctaacactttcccattgt	Protospacer
*********************************************

137. spacer 1.15|6747|45|NZ_AP014866|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgactttaaaacgtgcataacctaacactttcccattgt	CRISPR spacer
gaggtgcgactttaaaacgtgcataacctaacactttcccattgt	Protospacer
*********************************************

138. spacer 1.15|6747|45|NZ_AP014866|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgactttaaaacgtgcataacctaacactttcccattgt	CRISPR spacer
gaggtgcgactttaaaacgtgcataacctaacactttcccattgt	Protospacer
*********************************************

139. spacer 1.15|6747|45|NZ_AP014866|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgactttaaaacgtgcataacctaacactttcccattgt	CRISPR spacer
gaggtgcgactttaaaacgtgcataacctaacactttcccattgt	Protospacer
*********************************************

140. spacer 1.16|6814|44|NZ_AP014866|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgaccactcggaactaataacgcaaacattgccaccca	CRISPR spacer
gaggtgcgaccactcggaactaataacgcaaacattgccaccca	Protospacer
********************************************

141. spacer 1.16|6814|44|NZ_AP014866|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgaccactcggaactaataacgcaaacattgccaccca	CRISPR spacer
gaggtgcgaccactcggaactaataacgcaaacattgccaccca	Protospacer
********************************************

142. spacer 1.17|6880|44|NZ_AP014866|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgacttttttactcggatactctaaaggtgtaacaata	CRISPR spacer
gaggtgcgacttttttactcggatactctaaaggtgtaacaata	Protospacer
********************************************

143. spacer 1.17|6880|44|NZ_AP014866|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgacttttttactcggatactctaaaggtgtaacaata	CRISPR spacer
gaggtgcgacttttttactcggatactctaaaggtgtaacaata	Protospacer
********************************************

144. spacer 1.17|6880|44|NZ_AP014866|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgacttttttactcggatactctaaaggtgtaacaata	CRISPR spacer
gaggtgcgacttttttactcggatactctaaaggtgtaacaata	Protospacer
********************************************

145. spacer 1.17|6880|44|NZ_AP014866|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgacttttttactcggatactctaaaggtgtaacaata	CRISPR spacer
gaggtgcgacttttttactcggatactctaaaggtgtaacaata	Protospacer
********************************************

146. spacer 1.17|6880|44|NZ_AP014866|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgacttttttactcggatactctaaaggtgtaacaata	CRISPR spacer
gaggtgcgacttttttactcggatactctaaaggtgtaacaata	Protospacer
********************************************

147. spacer 1.17|6880|44|NZ_AP014866|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgacttttttactcggatactctaaaggtgtaacaata	CRISPR spacer
gaggtgcgacttttttactcggatactctaaaggtgtaacaata	Protospacer
********************************************

148. spacer 1.17|6880|44|NZ_AP014866|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgacttttttactcggatactctaaaggtgtaacaata	CRISPR spacer
gaggtgcgacttttttactcggatactctaaaggtgtaacaata	Protospacer
********************************************

149. spacer 1.17|6880|44|NZ_AP014866|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgacttttttactcggatactctaaaggtgtaacaata	CRISPR spacer
gaggtgcgacttttttactcggatactctaaaggtgtaacaata	Protospacer
********************************************

150. spacer 1.18|6946|44|NZ_AP014866|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgacatgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
gaggtgcgacatgtgggtgacgtcattaaattctcgtatcttgt	Protospacer
********************************************

151. spacer 1.18|6946|44|NZ_AP014866|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgacatgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
gaggtgcgacatgtgggtgacgtcattaaattctcgtatcttgt	Protospacer
********************************************

152. spacer 1.18|6946|44|NZ_AP014866|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgacatgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
gaggtgcgacatgtgggtgacgtcattaaattctcgtatcttgt	Protospacer
********************************************

153. spacer 1.18|6946|44|NZ_AP014866|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgacatgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
gaggtgcgacatgtgggtgacgtcattaaattctcgtatcttgt	Protospacer
********************************************

154. spacer 1.18|6946|44|NZ_AP014866|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgacatgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
gaggtgcgacatgtgggtgacgtcattaaattctcgtatcttgt	Protospacer
********************************************

155. spacer 1.18|6946|44|NZ_AP014866|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgacatgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
gaggtgcgacatgtgggtgacgtcattaaattctcgtatcttgt	Protospacer
********************************************

156. spacer 1.18|6946|44|NZ_AP014866|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgacatgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
gaggtgcgacatgtgggtgacgtcattaaattctcgtatcttgt	Protospacer
********************************************

157. spacer 1.18|6946|44|NZ_AP014866|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

gaggtgcgacatgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
gaggtgcgacatgtgggtgacgtcattaaattctcgtatcttgt	Protospacer
********************************************

158. spacer 2.1|292352|29|NZ_AP014866|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

gtttttcacaaagcattaataccagctac	CRISPR spacer
gtttttcacaaagcattaataccagctac	Protospacer
*****************************

159. spacer 2.1|292352|29|NZ_AP014866|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

gtttttcacaaagcattaataccagctac	CRISPR spacer
gtttttcacaaagcattaataccagctac	Protospacer
*****************************

160. spacer 2.1|292352|29|NZ_AP014866|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

gtttttcacaaagcattaataccagctac	CRISPR spacer
gtttttcacaaagcattaataccagctac	Protospacer
*****************************

161. spacer 2.1|292352|29|NZ_AP014866|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

gtttttcacaaagcattaataccagctac	CRISPR spacer
gtttttcacaaagcattaataccagctac	Protospacer
*****************************

162. spacer 2.1|292352|29|NZ_AP014866|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

gtttttcacaaagcattaataccagctac	CRISPR spacer
gtttttcacaaagcattaataccagctac	Protospacer
*****************************

163. spacer 2.1|292352|29|NZ_AP014866|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

gtttttcacaaagcattaataccagctac	CRISPR spacer
gtttttcacaaagcattaataccagctac	Protospacer
*****************************

164. spacer 2.1|292352|29|NZ_AP014866|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

gtttttcacaaagcattaataccagctac	CRISPR spacer
gtttttcacaaagcattaataccagctac	Protospacer
*****************************

165. spacer 2.1|292352|29|NZ_AP014866|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtttttcacaaagcattaataccagctac	CRISPR spacer
gtttttcacaaagcattaataccagctac	Protospacer
*****************************

166. spacer 2.1|292352|29|NZ_AP014866|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

gtttttcacaaagcattaataccagctac	CRISPR spacer
gtttttcacaaagcattaataccagctac	Protospacer
*****************************

167. spacer 2.2|292417|29|NZ_AP014866|CRT matches to NZ_CP017573 (Bacillus thuringiensis strain SCG04-02 plasmid PSCG61, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttcc	CRISPR spacer
cttttgatccgtaagaacgttccatttcc	Protospacer
*****************************

168. spacer 2.2|292417|29|NZ_AP014866|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttcc	CRISPR spacer
cttttgatccgtaagaacgttccatttcc	Protospacer
*****************************

169. spacer 2.2|292417|29|NZ_AP014866|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttcc	CRISPR spacer
cttttgatccgtaagaacgttccatttcc	Protospacer
*****************************

170. spacer 2.2|292417|29|NZ_AP014866|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttcc	CRISPR spacer
cttttgatccgtaagaacgttccatttcc	Protospacer
*****************************

171. spacer 2.2|292417|29|NZ_AP014866|CRT matches to NZ_CP047087 (Bacillus paranthracis strain BC307 plasmid pCE2, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttcc	CRISPR spacer
cttttgatccgtaagaacgttccatttcc	Protospacer
*****************************

172. spacer 2.2|292417|29|NZ_AP014866|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttcc	CRISPR spacer
cttttgatccgtaagaacgttccatttcc	Protospacer
*****************************

173. spacer 2.2|292417|29|NZ_AP014866|CRT matches to NC_018510 (Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttcc	CRISPR spacer
cttttgatccgtaagaacgttccatttcc	Protospacer
*****************************

174. spacer 2.2|292417|29|NZ_AP014866|CRT matches to NZ_CP029456 (Bacillus cereus strain FORC087 plasmid pFORC087.2, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttcc	CRISPR spacer
cttttgatccgtaagaacgttccatttcc	Protospacer
*****************************

175. spacer 2.2|292417|29|NZ_AP014866|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttcc	CRISPR spacer
cttttgatccgtaagaacgttccatttcc	Protospacer
*****************************

176. spacer 2.2|292417|29|NZ_AP014866|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttcc	CRISPR spacer
cttttgatccgtaagaacgttccatttcc	Protospacer
*****************************

177. spacer 2.2|292417|29|NZ_AP014866|CRT matches to NZ_CP013280 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttcc	CRISPR spacer
cttttgatccgtaagaacgttccatttcc	Protospacer
*****************************

178. spacer 2.2|292417|29|NZ_AP014866|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttcc	CRISPR spacer
cttttgatccgtaagaacgttccatttcc	Protospacer
*****************************

179. spacer 2.2|292417|29|NZ_AP014866|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttcc	CRISPR spacer
cttttgatccgtaagaacgttccatttcc	Protospacer
*****************************

180. spacer 2.2|292417|29|NZ_AP014866|CRT matches to NC_011656 (Bacillus cereus AH187 plasmid pAH187_45, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttcc	CRISPR spacer
cttttgatccgtaagaacgttccatttcc	Protospacer
*****************************

181. spacer 2.2|292417|29|NZ_AP014866|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttcc	CRISPR spacer
cttttgatccgtaagaacgttccatttcc	Protospacer
*****************************

182. spacer 2.2|292417|29|NZ_AP014866|CRT matches to NZ_CP039726 (Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttcc	CRISPR spacer
cttttgatccgtaagaacgttccatttcc	Protospacer
*****************************

183. spacer 2.2|292417|29|NZ_AP014866|CRT matches to NC_018685 (Bacillus thuringiensis MC28 plasmid pMC95, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttcc	CRISPR spacer
cttttgatccgtaagaacgttccatttcc	Protospacer
*****************************

184. spacer 2.2|292417|29|NZ_AP014866|CRT matches to CP041751 (Bacillus paranthracis strain NCCP 14796 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttcc	CRISPR spacer
cttttgatccgtaagaacgttccatttcc	Protospacer
*****************************

185. spacer 2.2|292417|29|NZ_AP014866|CRT matches to NZ_CP009350 (Bacillus thuringiensis HD1002 plasmid 4, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttcc	CRISPR spacer
cttttgatccgtaagaacgttccatttcc	Protospacer
*****************************

186. spacer 2.2|292417|29|NZ_AP014866|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttcc	CRISPR spacer
cttttgatccgtaagaacgttccatttcc	Protospacer
*****************************

187. spacer 2.2|292417|29|NZ_AP014866|CRT matches to NZ_CP033793 (Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence) position: , mismatch: 0, identity: 1.0

cttttgatccgtaagaacgttccatttcc	CRISPR spacer
cttttgatccgtaagaacgttccatttcc	Protospacer
*****************************

188. spacer 2.3|292482|31|NZ_AP014866|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

cccttccatcggcggcagctcatattcaatt	CRISPR spacer
cccttccatcggcggcagctcatattcaatt	Protospacer
*******************************

189. spacer 2.3|292482|31|NZ_AP014866|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

cccttccatcggcggcagctcatattcaatt	CRISPR spacer
cccttccatcggcggcagctcatattcaatt	Protospacer
*******************************

190. spacer 2.3|292482|31|NZ_AP014866|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

cccttccatcggcggcagctcatattcaatt	CRISPR spacer
cccttccatcggcggcagctcatattcaatt	Protospacer
*******************************

191. spacer 2.3|292482|31|NZ_AP014866|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

cccttccatcggcggcagctcatattcaatt	CRISPR spacer
cccttccatcggcggcagctcatattcaatt	Protospacer
*******************************

192. spacer 2.3|292482|31|NZ_AP014866|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

cccttccatcggcggcagctcatattcaatt	CRISPR spacer
cccttccatcggcggcagctcatattcaatt	Protospacer
*******************************

193. spacer 2.3|292482|31|NZ_AP014866|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

cccttccatcggcggcagctcatattcaatt	CRISPR spacer
cccttccatcggcggcagctcatattcaatt	Protospacer
*******************************

194. spacer 2.3|292482|31|NZ_AP014866|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

cccttccatcggcggcagctcatattcaatt	CRISPR spacer
cccttccatcggcggcagctcatattcaatt	Protospacer
*******************************

195. spacer 2.3|292482|31|NZ_AP014866|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

cccttccatcggcggcagctcatattcaatt	CRISPR spacer
cccttccatcggcggcagctcatattcaatt	Protospacer
*******************************

196. spacer 2.3|292482|31|NZ_AP014866|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

cccttccatcggcggcagctcatattcaatt	CRISPR spacer
cccttccatcggcggcagctcatattcaatt	Protospacer
*******************************

197. spacer 2.4|292549|30|NZ_AP014866|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

gattccacttgttcaggctctttgaatatc	CRISPR spacer
gattccacttgttcaggctctttgaatatc	Protospacer
******************************

198. spacer 2.4|292549|30|NZ_AP014866|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

gattccacttgttcaggctctttgaatatc	CRISPR spacer
gattccacttgttcaggctctttgaatatc	Protospacer
******************************

199. spacer 2.4|292549|30|NZ_AP014866|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

gattccacttgttcaggctctttgaatatc	CRISPR spacer
gattccacttgttcaggctctttgaatatc	Protospacer
******************************

200. spacer 2.4|292549|30|NZ_AP014866|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

gattccacttgttcaggctctttgaatatc	CRISPR spacer
gattccacttgttcaggctctttgaatatc	Protospacer
******************************

201. spacer 2.4|292549|30|NZ_AP014866|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

gattccacttgttcaggctctttgaatatc	CRISPR spacer
gattccacttgttcaggctctttgaatatc	Protospacer
******************************

202. spacer 2.4|292549|30|NZ_AP014866|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

gattccacttgttcaggctctttgaatatc	CRISPR spacer
gattccacttgttcaggctctttgaatatc	Protospacer
******************************

203. spacer 2.4|292549|30|NZ_AP014866|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

gattccacttgttcaggctctttgaatatc	CRISPR spacer
gattccacttgttcaggctctttgaatatc	Protospacer
******************************

204. spacer 2.4|292549|30|NZ_AP014866|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

gattccacttgttcaggctctttgaatatc	CRISPR spacer
gattccacttgttcaggctctttgaatatc	Protospacer
******************************

205. spacer 2.4|292549|30|NZ_AP014866|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

gattccacttgttcaggctctttgaatatc	CRISPR spacer
gattccacttgttcaggctctttgaatatc	Protospacer
******************************

206. spacer 1.2|6495|34|NZ_AP014866|CRISPRCasFinder matches to NZ_CP020748 (Bacillus mycoides strain Gnyt1 plasmid unnamed5, complete sequence) position: , mismatch: 1, identity: 0.971

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgagcgtcccagataaatataaacccgaggta	Protospacer
*********.************************

207. spacer 1.2|6495|34|NZ_AP014866|CRISPRCasFinder matches to NZ_CP011157 (Bacillus cereus strain HN001 plasmid pRML02, complete sequence) position: , mismatch: 1, identity: 0.971

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgagcgtcccagataaatataaacccgaggta	Protospacer
*********.************************

208. spacer 1.3|6561|33|NZ_AP014866|CRISPRCasFinder matches to NC_017206 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence) position: , mismatch: 1, identity: 0.97

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacgggaaaacaattgagctagttgcaaa	Protospacer
*********.***********************

209. spacer 1.3|6561|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP047087 (Bacillus paranthracis strain BC307 plasmid pCE2, complete sequence) position: , mismatch: 1, identity: 0.97

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacgggaaaacaattgagctagttgcaaa	Protospacer
*********.***********************

210. spacer 1.3|6561|33|NZ_AP014866|CRISPRCasFinder matches to NC_018510 (Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence) position: , mismatch: 1, identity: 0.97

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacgggaaaacaattgagctagttgcaaa	Protospacer
*********.***********************

211. spacer 1.3|6561|33|NZ_AP014866|CRISPRCasFinder matches to NC_022882 (Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence) position: , mismatch: 1, identity: 0.97

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaatggaaaaacaattgagctagttgcaaa	Protospacer
******.**************************

212. spacer 1.3|6561|33|NZ_AP014866|CRISPRCasFinder matches to NC_020383 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence) position: , mismatch: 1, identity: 0.97

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacgggaaaacaattgagctagttgcaaa	Protospacer
*********.***********************

213. spacer 1.3|6561|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP013280 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence) position: , mismatch: 1, identity: 0.97

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacgggaaaacaattgagctagttgcaaa	Protospacer
*********.***********************

214. spacer 1.3|6561|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP039726 (Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence) position: , mismatch: 1, identity: 0.97

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacgggaaaacaattgagctagttgcaaa	Protospacer
*********.***********************

215. spacer 1.3|6561|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP009350 (Bacillus thuringiensis HD1002 plasmid 4, complete sequence) position: , mismatch: 1, identity: 0.97

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacgggaaaacaattgagctagttgcaaa	Protospacer
*********.***********************

216. spacer 1.3|6561|33|NZ_AP014866|CRISPRCasFinder matches to NC_022877 (Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence) position: , mismatch: 1, identity: 0.97

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaatggaaaaacaattgagctagttgcaaa	Protospacer
******.**************************

217. spacer 1.3|6561|33|NZ_AP014866|CRISPRCasFinder matches to CP016198 (Bacillus thuringiensis serovar coreanensis strain ST7 plasmid pST7-4, complete sequence) position: , mismatch: 1, identity: 0.97

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacgggaaaacaattgagctagttgcaaa	Protospacer
*********.***********************

218. spacer 1.5|6692|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP010096 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMBLin15, complete sequence) position: , mismatch: 1, identity: 0.97

tggtctaacatctaaagccattaataactccta	CRISPR spacer
tggtctaacatctaaagccattaataactcctt	Protospacer
********************************

219. spacer 1.6|6757|35|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 1, identity: 0.971

tttaaaacgtgcataacctaacactttcccattgt-	CRISPR spacer
tttaaaacgtgcataacctaacac-ttcccattgta	Protospacer
************************ **********

220. spacer 1.9|6956|34|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NZ_CP010096 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMBLin15, complete sequence) position: , mismatch: 1, identity: 0.971

atgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
atgtgggtgacgtcattaaattctcgtatctagt	Protospacer
******************************* **

221. spacer 1.11|6485|44|NZ_AP014866|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 1, identity: 0.977

aaggtg-cgactatgagcgttccagataaatataaacccgaggta	CRISPR spacer
-aggtgccgactatgagcgttccagataaatataaacccgaggta	Protospacer
 ***** **************************************

222. spacer 1.14|6682|43|NZ_AP014866|CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 1, identity: 0.977

aaggtgcgactggtctaacatctaaagccattaataactccta	CRISPR spacer
aaggtacgactggtctaacatctaaagccattaataactccta	Protospacer
*****.*************************************

223. spacer 1.14|6682|43|NZ_AP014866|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 1, identity: 0.977

aaggtgcgactggtctaacatctaaagccattaataactccta	CRISPR spacer
aaggtacgactggtctaacatctaaagccattaataactccta	Protospacer
*****.*************************************

224. spacer 1.15|6747|45|NZ_AP014866|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 1, identity: 0.978

gaggtgcgactttaaaacgtgcataacctaacactttcccattgt-	CRISPR spacer
gaggtgcgactttaaaacgtgcataacctaacac-ttcccattgta	Protospacer
********************************** **********

225. spacer 1.17|6880|44|NZ_AP014866|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 1, identity: 0.977

gaggtgcgacttttttactcggatactctaaaggtgtaacaata-	CRISPR spacer
gaggtgcgacttttttactcggatactct-aaggtgtaacaataa	Protospacer
***************************** **************

226. spacer 2.2|292417|29|NZ_AP014866|CRT matches to NC_017206 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence) position: , mismatch: 1, identity: 0.966

cttttgatccgtaagaacgttccatttcc	CRISPR spacer
cttttgatccgtaaaaacgttccatttcc	Protospacer
**************.**************

227. spacer 2.2|292417|29|NZ_AP014866|CRT matches to CP024689 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-5-125K, complete sequence) position: , mismatch: 1, identity: 0.966

cttttgatccgtaagaacgttccatttcc	CRISPR spacer
cttttgatccataagaacgttccatttcc	Protospacer
**********.******************

228. spacer 2.2|292417|29|NZ_AP014866|CRT matches to NC_020383 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence) position: , mismatch: 1, identity: 0.966

cttttgatccgtaagaacgttccatttcc	CRISPR spacer
cttttgatccgtaaaaacgttccatttcc	Protospacer
**************.**************

229. spacer 1.2|6495|34|NZ_AP014866|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 2, identity: 0.941

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
****.**.**************************

230. spacer 1.2|6495|34|NZ_AP014866|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 2, identity: 0.941

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
****.**.**************************

231. spacer 1.2|6495|34|NZ_AP014866|CRISPRCasFinder matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 2, identity: 0.941

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
****.**.**************************

232. spacer 1.2|6495|34|NZ_AP014866|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 2, identity: 0.941

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
****.**.**************************

233. spacer 1.2|6495|34|NZ_AP014866|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 2, identity: 0.941

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
****.**.**************************

234. spacer 1.2|6495|34|NZ_AP014866|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 2, identity: 0.941

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
****.**.**************************

235. spacer 1.2|6495|34|NZ_AP014866|CRISPRCasFinder matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 2, identity: 0.941

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
****.**.**************************

236. spacer 1.2|6495|34|NZ_AP014866|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 2, identity: 0.941

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
****.**.**************************

237. spacer 1.2|6495|34|NZ_AP014866|CRISPRCasFinder matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 2, identity: 0.941

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
tatgggcattccagataaatataaacccgaggta	Protospacer
****.**.**************************

238. spacer 1.3|6561|33|NZ_AP014866|CRISPRCasFinder matches to NC_022782 (Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence) position: , mismatch: 2, identity: 0.939

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaatgggaaaacaattgagctagttgcaaa	Protospacer
******.**.***********************

239. spacer 1.3|6561|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP017573 (Bacillus thuringiensis strain SCG04-02 plasmid PSCG61, complete sequence) position: , mismatch: 2, identity: 0.939

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacgggaaaataattgagctagttgcaaa	Protospacer
*********.****.******************

240. spacer 1.3|6561|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP029456 (Bacillus cereus strain FORC087 plasmid pFORC087.2, complete sequence) position: , mismatch: 2, identity: 0.939

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacgggaaaataattgagctagttgcaaa	Protospacer
*********.****.******************

241. spacer 1.3|6561|33|NZ_AP014866|CRISPRCasFinder matches to NC_011656 (Bacillus cereus AH187 plasmid pAH187_45, complete sequence) position: , mismatch: 2, identity: 0.939

tgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tgaaaacgggaaaacaattgagctggttgcaaa	Protospacer
*********.**************.********

242. spacer 1.4|6626|34|NZ_AP014866|CRISPRCasFinder matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 2, identity: 0.941

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
****.**.**************************

243. spacer 1.4|6626|34|NZ_AP014866|CRISPRCasFinder matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 2, identity: 0.941

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
****.**.**************************

244. spacer 1.4|6626|34|NZ_AP014866|CRISPRCasFinder matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 2, identity: 0.941

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
****.**.**************************

245. spacer 1.4|6626|34|NZ_AP014866|CRISPRCasFinder matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 2, identity: 0.941

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
****.**.**************************

246. spacer 1.4|6626|34|NZ_AP014866|CRISPRCasFinder matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 2, identity: 0.941

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
****.**.**************************

247. spacer 1.4|6626|34|NZ_AP014866|CRISPRCasFinder matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 2, identity: 0.941

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
****.**.**************************

248. spacer 1.4|6626|34|NZ_AP014866|CRISPRCasFinder matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 2, identity: 0.941

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
****.**.**************************

249. spacer 1.4|6626|34|NZ_AP014866|CRISPRCasFinder matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 2, identity: 0.941

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
****.**.**************************

250. spacer 1.4|6626|34|NZ_AP014866|CRISPRCasFinder matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 2, identity: 0.941

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
****.**.**************************

251. spacer 1.4|6626|34|NZ_AP014866|CRISPRCasFinder matches to NZ_KX258624 (Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence) position: , mismatch: 2, identity: 0.941

tatgggcattccagataaatataaacccgaggta	CRISPR spacer
tatgagcgttccagataaatataaacccgaggta	Protospacer
****.**.**************************

252. spacer 2.2|292417|29|NZ_AP014866|CRT matches to NC_022882 (Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence) position: , mismatch: 2, identity: 0.931

cttttgatccgtaagaacgttccatttcc	CRISPR spacer
cttttgatccataagatcgttccatttcc	Protospacer
**********.***** ************

253. spacer 2.2|292417|29|NZ_AP014866|CRT matches to NC_022877 (Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence) position: , mismatch: 2, identity: 0.931

cttttgatccgtaagaacgttccatttcc	CRISPR spacer
cttttgatccataagatcgttccatttcc	Protospacer
**********.***** ************

254. spacer 2.2|292417|29|NZ_AP014866|CRT matches to NC_022782 (Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence) position: , mismatch: 2, identity: 0.931

cttttgatccgtaagaacgttccatttcc	CRISPR spacer
cttttgatccataagatcgttccatttcc	Protospacer
**********.***** ************

255. spacer 2.4|292549|30|NZ_AP014866|CRT matches to MH598512 (Bacillus phage Wes44, complete genome) position: , mismatch: 2, identity: 0.933

gattccacttgttcaggctctttgaatatc	CRISPR spacer
gattccacttgttcaggctcattgaatacc	Protospacer
******************** *******.*

256. spacer 1.5|6692|33|NZ_AP014866|CRISPRCasFinder matches to NZ_AP014870 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK6) position: , mismatch: 3, identity: 0.909

tggtctaacatctaaagccattaataactccta	CRISPR spacer
cggtctaacatctaaagccattaataactacga	Protospacer
.**************************** * *

257. spacer 1.11|6485|44|NZ_AP014866|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 3, identity: 0.932

aaggtgcgactatgagcgttccagataaatataaacccgaggta	CRISPR spacer
agggtgcgactatgggcattccagataaatataaacccgaggta	Protospacer
*.************.**.**************************

258. spacer 1.11|6485|44|NZ_AP014866|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 3, identity: 0.932

aaggtgcgactatgagcgttccagataaatataaacccgaggta	CRISPR spacer
agggtgcgactatgggcattccagataaatataaacccgaggta	Protospacer
*.************.**.**************************

259. spacer 1.11|6485|44|NZ_AP014866|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 3, identity: 0.932

aaggtgcgactatgagcgttccagataaatataaacccgaggta	CRISPR spacer
agggtgcgactatgggcattccagataaatataaacccgaggta	Protospacer
*.************.**.**************************

260. spacer 1.11|6485|44|NZ_AP014866|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 3, identity: 0.932

aaggtgcgactatgagcgttccagataaatataaacccgaggta	CRISPR spacer
agggtgcgactatgggcattccagataaatataaacccgaggta	Protospacer
*.************.**.**************************

261. spacer 1.11|6485|44|NZ_AP014866|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 3, identity: 0.932

aaggtgcgactatgagcgttccagataaatataaacccgaggta	CRISPR spacer
agggtgcgactatgggcattccagataaatataaacccgaggta	Protospacer
*.************.**.**************************

262. spacer 1.11|6485|44|NZ_AP014866|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 3, identity: 0.932

aaggtgcgactatgagcgttccagataaatataaacccgaggta	CRISPR spacer
agggtgcgactatgggcattccagataaatataaacccgaggta	Protospacer
*.************.**.**************************

263. spacer 1.11|6485|44|NZ_AP014866|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 3, identity: 0.932

aaggtgcgactatgagcgttccagataaatataaacccgaggta	CRISPR spacer
agggtgcgactatgggcattccagataaatataaacccgaggta	Protospacer
*.************.**.**************************

264. spacer 1.11|6485|44|NZ_AP014866|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 3, identity: 0.932

aaggtgcgactatgagcgttccagataaatataaacccgaggta	CRISPR spacer
agggtgcgactatgggcattccagataaatataaacccgaggta	Protospacer
*.************.**.**************************

265. spacer 1.11|6485|44|NZ_AP014866|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 3, identity: 0.932

aaggtgcgactatgagcgttccagataaatataaacccgaggta	CRISPR spacer
agggtgcgactatgggcattccagataaatataaacccgaggta	Protospacer
*.************.**.**************************

266. spacer 1.11|6485|44|NZ_AP014866|CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 3, identity: 0.932

aaggtgcgactat-gagcgttccagataaatataaacccgaggta	CRISPR spacer
-aggtgcgactatagagcgttgcagataaatataaactcgaggta	Protospacer
 ************ ******* ***************.*******

267. spacer 1.11|6485|44|NZ_AP014866|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 3, identity: 0.932

aaggtgcgactat-gagcgttccagataaatataaacccgaggta	CRISPR spacer
-aggtgcgactatagagcgttgcagataaatataaactcgaggta	Protospacer
 ************ ******* ***************.*******

268. spacer 1.13|6616|44|NZ_AP014866|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 3, identity: 0.932

agggtgcgactatgggcattccagataaatataaacccgaggta	CRISPR spacer
aaggtgcgactatgagcgttccagataaatataaacccgaggta	Protospacer
*.************.**.**************************

269. spacer 1.13|6616|44|NZ_AP014866|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 3, identity: 0.932

agggtgcgactatgggcattccagataaatataaacccgaggta	CRISPR spacer
aaggtgcgactatgagcgttccagataaatataaacccgaggta	Protospacer
*.************.**.**************************

270. spacer 1.13|6616|44|NZ_AP014866|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 3, identity: 0.932

agggtgcgactatgggcattccagataaatataaacccgaggta	CRISPR spacer
aaggtgcgactatgagcgttccagataaatataaacccgaggta	Protospacer
*.************.**.**************************

271. spacer 1.13|6616|44|NZ_AP014866|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 3, identity: 0.932

agggtgcgactatgggcattccagataaatataaacccgaggta	CRISPR spacer
aaggtgcgactatgagcgttccagataaatataaacccgaggta	Protospacer
*.************.**.**************************

272. spacer 1.13|6616|44|NZ_AP014866|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 3, identity: 0.932

agggtgcgactatgggcattccagataaatataaacccgaggta	CRISPR spacer
aaggtgcgactatgagcgttccagataaatataaacccgaggta	Protospacer
*.************.**.**************************

273. spacer 1.13|6616|44|NZ_AP014866|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 3, identity: 0.932

agggtgcgactatgggcattccagataaatataaacccgaggta	CRISPR spacer
aaggtgcgactatgagcgttccagataaatataaacccgaggta	Protospacer
*.************.**.**************************

274. spacer 1.13|6616|44|NZ_AP014866|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 3, identity: 0.932

agggtgcgactatgggcattccagataaatataaacccgaggta	CRISPR spacer
aaggtgcgactatgagcgttccagataaatataaacccgaggta	Protospacer
*.************.**.**************************

275. spacer 1.13|6616|44|NZ_AP014866|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 3, identity: 0.932

agggtgcgactatgggcattccagataaatataaacccgaggta	CRISPR spacer
aaggtgcgactatgagcgttccagataaatataaacccgaggta	Protospacer
*.************.**.**************************

276. spacer 1.13|6616|44|NZ_AP014866|CRT matches to NZ_KX258624 (Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence) position: , mismatch: 3, identity: 0.932

agggtgcgactatgggcattccagataaatataaacccgaggta	CRISPR spacer
aaggtgcgactatgagcgttccagataaatataaacccgaggta	Protospacer
*.************.**.**************************

277. spacer 2.1|292352|29|NZ_AP014866|CRT matches to NZ_CP014851 (Bacillus thuringiensis strain HD12 plasmid pHD120112, complete sequence) position: , mismatch: 3, identity: 0.897

gtttttcacaaagcattaataccagctac	CRISPR spacer
gctttccacaaagcattaatgccagctac	Protospacer
*.***.**************.********

278. spacer 2.1|292352|29|NZ_AP014866|CRT matches to NZ_CP011157 (Bacillus cereus strain HN001 plasmid pRML02, complete sequence) position: , mismatch: 3, identity: 0.897

gtttttcacaaagcattaataccagctac	CRISPR spacer
gctttccacaaagtattaataccagctac	Protospacer
*.***.*******.***************

279. spacer 1.9|6956|34|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NZ_CP004882 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMBLin15, complete sequence) position: , mismatch: 4, identity: 0.882

atgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
atgtaggtgacgtcattaaattctcgtacttagt	Protospacer
****.***********************..* **

280. spacer 1.9|6956|34|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NZ_CP011355 (Bacillus thuringiensis strain YC-10 plasmid pYC10, complete sequence) position: , mismatch: 4, identity: 0.882

atgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
atgtaggtgacgtcattaaattctcgtacttagt	Protospacer
****.***********************..* **

281. spacer 1.9|6956|34|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to NC_006945 (Bacillus phage GIL16c, complete genome) position: , mismatch: 4, identity: 0.882

atgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
atgtaggtgacgtcattaaattctcgtacttagt	Protospacer
****.***********************..* **

282. spacer 1.9|6956|34|NZ_AP014866|CRISPRCasFinder,PILER-CR matches to AY701338 (Bacillus thuringiensis phage GIL16c, complete genome) position: , mismatch: 4, identity: 0.882

atgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
atgtaggtgacgtcattaaattctcgtacttagt	Protospacer
****.***********************..* **

283. spacer 1.2|6495|34|NZ_AP014866|CRISPRCasFinder matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 5, identity: 0.853

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
atagagcgttgcagataaatataaactcgaggta	Protospacer
   ******* ***************.*******

284. spacer 1.2|6495|34|NZ_AP014866|CRISPRCasFinder matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 5, identity: 0.853

tatgagcgttccagataaatataaacccgaggta	CRISPR spacer
atagagcgttgcagataaatataaactcgaggta	Protospacer
   ******* ***************.*******

285. spacer 1.5|6692|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP004882 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMBLin15, complete sequence) position: , mismatch: 5, identity: 0.848

tggtctaacatctaaagcc----attaataactccta	CRISPR spacer
tggtctaacatctagagccattaattaataact----	Protospacer
**************.****    **********

286. spacer 1.5|6692|33|NZ_AP014866|CRISPRCasFinder matches to NZ_CP011355 (Bacillus thuringiensis strain YC-10 plasmid pYC10, complete sequence) position: , mismatch: 5, identity: 0.848

tggtctaacatctaaagcc----attaataactccta	CRISPR spacer
tggtctaacatctagagccattaattaataact----	Protospacer
**************.****    **********

287. spacer 1.5|6692|33|NZ_AP014866|CRISPRCasFinder matches to NC_006945 (Bacillus phage GIL16c, complete genome) position: , mismatch: 5, identity: 0.848

tggtctaacatctaaagcc----attaataactccta	CRISPR spacer
tggtctaacatctagagccattaattaataact----	Protospacer
**************.****    **********

288. spacer 1.5|6692|33|NZ_AP014866|CRISPRCasFinder matches to AY701338 (Bacillus thuringiensis phage GIL16c, complete genome) position: , mismatch: 5, identity: 0.848

tggtctaacatctaaagcc----attaataactccta	CRISPR spacer
tggtctaacatctagagccattaattaataact----	Protospacer
**************.****    **********

289. spacer 1.13|6616|44|NZ_AP014866|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 5, identity: 0.886

agggtgcgactatgggcattccagataaatataaacccgaggta	CRISPR spacer
aggtgccgactatgagcgttccagataaatataaacccgaggta	Protospacer
***   ********.**.**************************

290. spacer 1.12|6551|43|NZ_AP014866|CRT matches to CP024689 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-5-125K, complete sequence) position: , mismatch: 6, identity: 0.86

gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
ttagcgttactgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
  .*.*. ***********************************

291. spacer 1.12|6551|43|NZ_AP014866|CRT matches to NC_018685 (Bacillus thuringiensis MC28 plasmid pMC95, complete sequence) position: , mismatch: 6, identity: 0.86

gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
ttagtattactgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
  .**.. ***********************************

292. spacer 1.16|6814|44|NZ_AP014866|CRT matches to NZ_CP024774 (Bacillus thuringiensis LM1212 plasmid pLM3, complete sequence) position: , mismatch: 6, identity: 0.864

-gaggtgcgaccactcggaactaataacgcaaacattgccaccca	CRISPR spacer
gctgatgctg-cactcggaactaataacgcaaacattgccaccca	Protospacer
   *.*** . **********************************

293. spacer 1.16|6814|44|NZ_AP014866|CRT matches to NZ_CP041074 (Bacillus tropicus strain LM1212-W3 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.864

-gaggtgcgaccactcggaactaataacgcaaacattgccaccca	CRISPR spacer
gctgatgctg-cactcggaactaataacgcaaacattgccaccca	Protospacer
   *.*** . **********************************

294. spacer 1.16|6814|44|NZ_AP014866|CRT matches to NZ_CP015253 (Bacillus thuringiensis Bt18247 plasmid p113275, complete sequence) position: , mismatch: 6, identity: 0.864

-gaggtgcgaccactcggaactaataacgcaaacattgccaccca	CRISPR spacer
gctgatgctg-cactcggaactaataacgcaaacattgccaccca	Protospacer
   *.*** . **********************************

295. spacer 1.12|6551|43|NZ_AP014866|CRT matches to CP041751 (Bacillus paranthracis strain NCCP 14796 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.837

gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
tcagcattactgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
  .*... ***********************************

296. spacer 1.12|6551|43|NZ_AP014866|CRT matches to NZ_CP033793 (Bacillus sp. FDAARGOS_527 plasmid unnamed6, complete sequence) position: , mismatch: 7, identity: 0.837

gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
ttagcatcactgaaaacggaaaaacaattgagctagttgcaaa	Protospacer
  .*... ***********************************

297. spacer 1.14|6682|43|NZ_AP014866|CRT matches to NC_005258 (Bacillus phage Bam35c, complete genome) position: , mismatch: 7, identity: 0.837

aaggtgcgactggtctaacatctaaagccattaataactccta	CRISPR spacer
cgtttatgaatggtctaacatctaaagccattaataactccta	Protospacer
 .  *..** *********************************

298. spacer 1.14|6682|43|NZ_AP014866|CRT matches to AY257527 (Bacillus thuringiensis bacteriophage Bam35c, complete genome) position: , mismatch: 7, identity: 0.837

aaggtgcgactggtctaacatctaaagccattaataactccta	CRISPR spacer
cgtttatgaatggtctaacatctaaagccattaataactccta	Protospacer
 .  *..** *********************************

299. spacer 1.14|6682|43|NZ_AP014866|CRT matches to AJ536073 (Bacillus phage pGIL01, complete genome) position: , mismatch: 7, identity: 0.837

aaggtgcgactggtctaacatctaaagccattaataactccta	CRISPR spacer
cgtttatgaatggtctaacatctaaagccattaataactccta	Protospacer
 .  *..** *********************************

300. spacer 1.14|6682|43|NZ_AP014866|CRT matches to NZ_CP053974 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.837

aaggtgcgactggtctaacatctaaagccattaataactccta	CRISPR spacer
cgtttatgaatggtctaacatctaaagccattaataactccta	Protospacer
 .  *..** *********************************

301. spacer 1.14|6682|43|NZ_AP014866|CRT matches to NZ_CP009346 (Bacillus thuringiensis HD1002 plasmid 5, complete sequence) position: , mismatch: 7, identity: 0.837

aaggtgcgactggtctaacatctaaagccattaataactccta	CRISPR spacer
cgtttatgaatggtctaacatctaaagccattaataactccta	Protospacer
 .  *..** *********************************

302. spacer 1.14|6682|43|NZ_AP014866|CRT matches to NZ_CP045027 (Bacillus thuringiensis strain JW-1 plasmid p5, complete sequence) position: , mismatch: 7, identity: 0.837

aaggtgcgactggtctaacatctaaagccattaataactccta	CRISPR spacer
cgtttatgaatggtctaacatctaaagccattaataactccta	Protospacer
 .  *..** *********************************

303. spacer 1.14|6682|43|NZ_AP014866|CRT matches to CP013282 (Bacillus phage pGIL02, complete sequence) position: , mismatch: 7, identity: 0.837

aaggtgcgactggtctaacatctaaagccattaataactccta	CRISPR spacer
cgtttatgaatggtctaacatctaaagccattaataactccta	Protospacer
 .  *..** *********************************

304. spacer 2.1|292352|29|NZ_AP014866|CRT matches to MN694586 (Marine virus AFVG_250M370, complete genome) position: , mismatch: 7, identity: 0.759

gtttttcacaaagcattaataccagctac	CRISPR spacer
taatttctcaaagcattaataccattttc	Protospacer
   **** **************** .* *

305. spacer 1.11|6485|44|NZ_AP014866|CRT matches to NZ_CP011157 (Bacillus cereus strain HN001 plasmid pRML02, complete sequence) position: , mismatch: 8, identity: 0.818

aaggtgcgactatgagcgttccagataaatataaacccgaggta	CRISPR spacer
atgatcgatttatgagcgtcccagataaatataaacccgaggta	Protospacer
* *.*  . .*********.************************

306. spacer 1.12|6551|43|NZ_AP014866|CRT matches to NC_017206 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT83, complete sequence) position: , mismatch: 8, identity: 0.814

gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
ttagcattactgaaaacgggaaaacaattgagctagttgcaaa	Protospacer
  .*... ***********.***********************

307. spacer 1.12|6551|43|NZ_AP014866|CRT matches to NZ_CP047087 (Bacillus paranthracis strain BC307 plasmid pCE2, complete sequence) position: , mismatch: 8, identity: 0.814

gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
ttagcatcactgaaaacgggaaaacaattgagctagttgcaaa	Protospacer
  .*... ***********.***********************

308. spacer 1.12|6551|43|NZ_AP014866|CRT matches to NC_018510 (Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence) position: , mismatch: 8, identity: 0.814

gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
ttagcatcactgaaaacgggaaaacaattgagctagttgcaaa	Protospacer
  .*... ***********.***********************

309. spacer 1.12|6551|43|NZ_AP014866|CRT matches to NC_022882 (Bacillus thuringiensis YBT-1518 plasmid pBMB0233, complete sequence) position: , mismatch: 8, identity: 0.814

gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
ttagcatcactgaaaatggaaaaacaattgagctagttgcaaa	Protospacer
  .*... ********.**************************

310. spacer 1.12|6551|43|NZ_AP014866|CRT matches to NC_020383 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-85, complete sequence) position: , mismatch: 8, identity: 0.814

gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
ttagcattactgaaaacgggaaaacaattgagctagttgcaaa	Protospacer
  .*... ***********.***********************

311. spacer 1.12|6551|43|NZ_AP014866|CRT matches to NZ_CP013280 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence) position: , mismatch: 8, identity: 0.814

gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
ttagcatcactgaaaacgggaaaacaattgagctagttgcaaa	Protospacer
  .*... ***********.***********************

312. spacer 1.12|6551|43|NZ_AP014866|CRT matches to NZ_CP039726 (Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence) position: , mismatch: 8, identity: 0.814

gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
ttagcatcactgaaaacgggaaaacaattgagctagttgcaaa	Protospacer
  .*... ***********.***********************

313. spacer 1.12|6551|43|NZ_AP014866|CRT matches to NZ_CP009350 (Bacillus thuringiensis HD1002 plasmid 4, complete sequence) position: , mismatch: 8, identity: 0.814

gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
ttagcatcactgaaaacgggaaaacaattgagctagttgcaaa	Protospacer
  .*... ***********.***********************

314. spacer 1.12|6551|43|NZ_AP014866|CRT matches to NC_022877 (Bacillus thuringiensis YBT-1518 plasmid pBMB0232, complete sequence) position: , mismatch: 8, identity: 0.814

gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
ttagcatcactgaaaatggaaaaacaattgagctagttgcaaa	Protospacer
  .*... ********.**************************

315. spacer 1.12|6551|43|NZ_AP014866|CRT matches to CP016198 (Bacillus thuringiensis serovar coreanensis strain ST7 plasmid pST7-4, complete sequence) position: , mismatch: 8, identity: 0.814

gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
ttagcatcactgaaaacgggaaaacaattgagctagttgcaaa	Protospacer
  .*... ***********.***********************

316. spacer 1.12|6551|43|NZ_AP014866|CRT matches to NC_022782 (Bacillus toyonensis BCT-7112 plasmid pBCT77, complete sequence) position: , mismatch: 8, identity: 0.814

gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
ttagtatcactgaaaatgggaaaacaattgagctagttgcaaa	Protospacer
  .**.. ********.**.***********************

317. spacer 1.14|6682|43|NZ_AP014866|CRT matches to NZ_CP010096 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMBLin15, complete sequence) position: , mismatch: 8, identity: 0.814

aaggtgcgactggtctaacatctaaagccattaataactccta	CRISPR spacer
cgtttatgaatggtctaacatctaaagccattaataactcctt	Protospacer
 .  *..** ********************************

318. spacer 1.18|6946|44|NZ_AP014866|CRT matches to NZ_CP010096 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMBLin15, complete sequence) position: , mismatch: 8, identity: 0.818

gaggtgcgacatgtgggtgacgtcattaaattctcgtatcttgt	CRISPR spacer
tatatatgtaatgtgggtgacgtcattaaattctcgtatctagt	Protospacer
 * .*..*  ******************************* **

319. spacer 2.4|292549|30|NZ_AP014866|CRT matches to X97918 (Bacteriophage SPP1 complete nucleotide sequence) position: , mismatch: 8, identity: 0.733

gattccacttgttcaggctctttgaatatc	CRISPR spacer
ccgccgaattgttccggctctttgaatatg	Protospacer
   .* * ****** **************

320. spacer 1.11|6485|44|NZ_AP014866|CRT matches to NZ_CP020748 (Bacillus mycoides strain Gnyt1 plasmid unnamed5, complete sequence) position: , mismatch: 9, identity: 0.795

aaggtgcgactatgagcgttccagataaatataaacccgaggta	CRISPR spacer
atgacagatttatgagcgtcccagataaatataaacccgaggta	Protospacer
* *... . .*********.************************

321. spacer 1.12|6551|43|NZ_AP014866|CRT matches to NZ_CP017573 (Bacillus thuringiensis strain SCG04-02 plasmid PSCG61, complete sequence) position: , mismatch: 9, identity: 0.791

gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
ttagcatcactgaaaacgggaaaataattgagctagttgcaaa	Protospacer
  .*... ***********.****.******************

322. spacer 1.12|6551|43|NZ_AP014866|CRT matches to NZ_CP029456 (Bacillus cereus strain FORC087 plasmid pFORC087.2, complete sequence) position: , mismatch: 9, identity: 0.791

gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
ttagcatcactgaaaacgggaaaataattgagctagttgcaaa	Protospacer
  .*... ***********.****.******************

323. spacer 1.12|6551|43|NZ_AP014866|CRT matches to NC_011656 (Bacillus cereus AH187 plasmid pAH187_45, complete sequence) position: , mismatch: 9, identity: 0.791

gaggtgcgactgaaaacggaaaaacaattgagctagttgcaaa	CRISPR spacer
ttagcatcactgaaaacgggaaaacaattgagctggttgcaaa	Protospacer
  .*... ***********.**************.********

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

82343 : 222571

112

Bacillus_phage(31.25%)

holin,protease,integrase,bacteriocin,transposase

attL 118464:118483|attR 144297:144316

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001098031.1\|82343_83279_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_000502626.1\|83368_83638_-	hypothetical protein	NA	NA	NA	NA
WP_000869334.1\|83751_83955_+	hypothetical protein	NA	NA	NA	NA
WP_001180021.1\|84011_84197_+	hypothetical protein	NA	NA	NA	NA
WP_001216652.1\|84313_84733_+	hypothetical protein	NA	NA	NA	NA
WP_001233517.1\|84799_85150_+	PrgI family protein	NA	NA	NA	NA
WP_000892000.1\|85150_86065_+	hypothetical protein	NA	NA	NA	NA
WP_016090237.1\|86067_88176_+	DUF87 domain-containing protein	NA	NA	NA	NA
WP_000890337.1\|88206_92226_+	type IV secretion system protein	NA	NA	NA	NA
WP_000108316.1\|93891_95697_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	5.5e-31	28.1
WP_001149935.1\|96705_98529_+	maturase	A0A0U4J920	Pseudomonas_phage	2.5e-23	33.8
WP_014481869.1\|98688_99564_+	peptidoglycan DD-metalloendopeptidase family protein	A7KUS1	Bacillus_phage	3.5e-15	38.3
WP_000757464.1\|99580_100156_+	hypothetical protein	NA	NA	NA	NA
WP_001242518.1\|100317_100701_+	hypothetical protein	NA	NA	NA	NA
WP_000104242.1\|100697_100997_+	DUF2325 domain-containing protein	NA	NA	NA	NA
WP_000659905.1\|101125_101434_+	hypothetical protein	NA	NA	NA	NA
WP_000343609.1\|101473_102199_+	hypothetical protein	NA	NA	NA	NA
WP_060852695.1\|102249_102495_+	hypothetical protein	NA	NA	NA	NA
WP_001065855.1\|102826_103510_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_001186844.1\|103966_105112_-	DUF418 domain-containing protein	NA	NA	NA	NA
WP_000725572.1\|105152_105635_-	thioredoxin family protein	NA	NA	NA	NA
WP_000523962.1\|106245_107592_+	hypothetical protein	NA	NA	NA	NA
WP_000025329.1\|107591_108020_+	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_060852696.1\|108332_109406_-	hypothetical protein	A0A2H4J8G3	uncultured_Caudovirales_phage	3.0e-77	43.9
WP_000802626.1\|109656_111147_+	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_000888766.1\|112126_112378_-	YolD-like family protein	NA	NA	NA	NA
WP_000364215.1\|112729_113140_+	DUF1878 family protein	NA	NA	NA	NA
WP_000169374.1\|114851_116159_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	8.6e-26	29.7
WP_001053969.1\|116955_118392_-\|transposase	IS4-like element IS231C family transposase	NA	NA	NA	NA
118464:118483	attL	NA	NA	NA	NA
WP_000351941.1\|119279_120179_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_000020440.1\|120301_120889_+	flavodoxin family protein	NA	NA	NA	NA
WP_000921229.1\|120903_121833_+	DMT family transporter	NA	NA	NA	NA
WP_000650425.1\|122261_123236_-	DUF4179 domain-containing protein	NA	NA	NA	NA
WP_000955500.1\|123239_123770_-	RNA polymerase sigma factor SigX	NA	NA	NA	NA
WP_000898260.1\|124313_124553_+	hypothetical protein	NA	NA	NA	NA
WP_000417392.1\|124605_124857_+	hypothetical protein	NA	NA	NA	NA
WP_001154608.1\|125075_125450_-	hypothetical protein	D2XQ01	Bacillus_virus	4.8e-30	52.5
WP_053512450.1\|125498_125840_-	YolD-like family protein	NA	NA	NA	NA
WP_000272577.1\|125836_127102_-	Y-family DNA polymerase	O64031	Bacillus_phage	4.2e-102	46.7
WP_001053969.1\|127910_129347_-\|transposase	IS4-like element IS231C family transposase	NA	NA	NA	NA
WP_000914524.1\|129451_129967_+	hypothetical protein	NA	NA	NA	NA
WP_001043935.1\|130456_130729_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	3.3e-25	68.9
WP_031303430.1\|130975_131170_-	hypothetical protein	NA	NA	NA	NA
WP_014481865.1\|131444_131585_+	hypothetical protein	NA	NA	NA	NA
WP_000843046.1\|131651_131930_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	2.3e-13	59.0
WP_000475295.1\|132631_134275_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_060852697.1\|134481_134670_+	hypothetical protein	A0A1B1P895	Bacillus_phage	7.0e-06	51.9
WP_060852562.1\|134736_136311_+\|transposase	IS21 family transposase	U5N3F9	Enterobacteria_phage	1.5e-21	27.7
WP_060852563.1\|136322_137102_+	ATP-binding protein	U5N3V8	Enterobacteria_phage	3.3e-33	32.2
WP_000734601.1\|138325_138478_+	hypothetical protein	NA	NA	NA	NA
WP_000019020.1\|138810_139137_-	helix-turn-helix transcriptional regulator	A0A0A7AQV8	Bacillus_phage	2.4e-22	51.0
WP_001021539.1\|139350_140394_-\|integrase	tyrosine-type recombinase/integrase	A0A0E3T6D9	Bacillus_phage	1.2e-09	23.1
WP_000149389.1\|140625_140976_+	zinc-finger domain-containing protein	NA	NA	NA	NA
WP_000121085.1\|140997_141510_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_000346798.1\|142093_142258_+	hypothetical protein	NA	NA	NA	NA
WP_001053955.1\|142751_144188_+\|transposase	IS4-like element IS231A family transposase	NA	NA	NA	NA
WP_000532004.1\|144390_145695_+	WXG100 family type VII secretion target	NA	NA	NA	NA
144297:144316	attR	NA	NA	NA	NA
WP_000128275.1\|145717_145936_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_000790837.1\|146009_146402_-	DUF4878 domain-containing protein	NA	NA	NA	NA
WP_001236345.1\|146757_147987_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.5e-85	49.4
WP_000997955.1\|148717_149467_+	hypothetical protein	NA	NA	NA	NA
WP_000065268.1\|149754_149979_-	hypothetical protein	NA	NA	NA	NA
WP_033679476.1\|150158_150989_+	SEC-C motif-containing protein	NA	NA	NA	NA
WP_171840965.1\|151072_151237_+	hypothetical protein	NA	NA	NA	NA
WP_000737575.1\|151360_151498_-	hypothetical protein	NA	NA	NA	NA
WP_001103226.1\|151494_152589_-	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	1.5e-92	48.8
WP_000844156.1\|152933_153182_+	hypothetical protein	NA	NA	NA	NA
WP_000845491.1\|153318_153528_+	hypothetical protein	NA	NA	NA	NA
WP_001032039.1\|154080_154380_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_060852698.1\|154946_155981_+	exosporium leader peptide-containing protein	NA	NA	NA	NA
WP_000364215.1\|156403_156814_+	DUF1878 family protein	NA	NA	NA	NA
WP_000116992.1\|156962_158393_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_014481859.1\|159202_159739_+	ADP-ribosyltransferase	NA	NA	NA	NA
WP_014481860.1\|159698_160010_+	mono-ADP-ribosyltransferase C3 (Exoenzyme C3)	NA	NA	NA	NA
WP_001053955.1\|160423_161860_-\|transposase	IS4-like element IS231A family transposase	NA	NA	NA	NA
WP_000520933.1\|162285_163158_-	DMT family transporter	NA	NA	NA	NA
WP_060852699.1\|163303_164731_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_000116992.1\|165168_166599_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_000364215.1\|166747_167158_-	DUF1878 family protein	NA	NA	NA	NA
WP_000892197.1\|168283_168706_+\|holin	phage holin family protein	A0A0S2MVC4	Bacillus_phage	1.3e-52	77.3
WP_033679389.1\|169066_169318_+	hypothetical protein	NA	NA	NA	NA
WP_060852700.1\|171440_171944_+	hypothetical protein	NA	NA	NA	NA
WP_060852701.1\|172110_172914_+	hypothetical protein	NA	NA	NA	NA
WP_060852702.1\|173003_174905_+	pesticidal protein Cry2Ab	NA	NA	NA	NA
WP_000555978.1\|176965_177598_+	DUF4433 domain-containing protein	NA	NA	NA	NA
WP_000591046.1\|177612_178638_+	macro domain-containing protein	A0A0B4N0V6	Escherichia_phage	9.1e-23	40.4
WP_014481901.1\|178803_179910_+	tyrosine recombinase XerS	A0A1B1IQT7	uncultured_Mediterranean_phage	2.0e-07	28.4
WP_060852703.1\|182801_186314_-	pesticidal protein	NA	NA	NA	NA
WP_060852704.1\|186622_187579_-	N-acetylmuramoyl-L-alanine amidase	A0A0S2MV84	Bacillus_phage	9.6e-51	39.8
WP_001053956.1\|189371_190808_+\|transposase	IS4-like element IS231B family transposase	NA	NA	NA	NA
WP_000275580.1\|191015_192311_+\|transposase	IS21-like element IS232 family transposase	A0A059NT83	Lactococcus_phage	1.0e-42	31.0
WP_000798699.1\|192300_193053_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	7.0e-57	47.3
WP_000704745.1\|194348_195515_-	nucleotide sugar dehydrogenase	A0A1J0FA55	Only_Syngen_Nebraska_virus	1.4e-107	52.1
WP_014481840.1\|195797_198815_-	non-ribosomal peptide synthetase	A0A2K9L3I8	Tupanvirus	4.1e-39	28.0
WP_003275306.1\|198811_200059_-	MFS transporter	A0A1B0RXG2	Streptococcus_phage	9.4e-06	25.1
WP_000560325.1\|200386_201514_-	glycosyltransferase	NA	NA	NA	NA
WP_000412005.1\|201510_202521_-	hypothetical protein	NA	NA	NA	NA
WP_000028781.1\|202501_203743_-	S-adenosylmethionine synthetase	NA	NA	NA	NA
WP_060852706.1\|203726_204749_-	hypothetical protein	NA	NA	NA	NA
WP_000660942.1\|204956_205823_+	shikimate dehydrogenase	NA	NA	NA	NA
WP_000644939.1\|205819_206680_+	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_000700965.1\|206676_207447_+	coenzyme F420-0:L-glutamate ligase	NA	NA	NA	NA
WP_000021282.1\|207773_208004_-	hypothetical protein	A0A217ERD4	Bacillus_phage	2.2e-06	51.8
WP_167374445.1\|208028_208382_-	ArsR family transcriptional regulator	NA	NA	NA	NA
WP_048520037.1\|208672_208882_-	hypothetical protein	NA	NA	NA	NA
WP_000595411.1\|209348_210455_-	helix-turn-helix domain-containing protein	A0A288TXV8	Enterococcus_phage	1.3e-78	47.5
WP_015413263.1\|210466_210865_-\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	3.1e-51	69.7
WP_001043946.1\|211315_211588_+	HU family DNA-binding protein	A7KV42	Bacillus_phage	1.8e-23	67.8
WP_060852707.1\|212350_212674_+	hypothetical protein	NA	NA	NA	NA
WP_081097649.1\|212780_213638_-	recombinase family protein	A0A219Y9V9	Aeromonas_phage	6.2e-33	45.4
WP_000169374.1\|216587_217895_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	8.6e-26	29.7
WP_060852709.1\|219622_222571_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.4e-79	26.7

DBSCAN-SWA_2

252682 : 262314

Lactococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015406625.1\|252682_253801_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	3.0e-173	81.5
WP_000275580.1\|254162_255458_+\|transposase	IS21-like element IS232 family transposase	A0A059NT83	Lactococcus_phage	1.0e-42	31.0
WP_000798699.1\|255447_256200_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	7.0e-57	47.3
WP_087874946.1\|256790_257949_+\|transposase	IS3-like element ISBth8 family transposase	A0A0C5AEA5	Paenibacillus_phage	2.5e-37	42.0
WP_000929144.1\|258391_258688_-	hypothetical protein	NA	NA	NA	NA
WP_000762722.1\|259936_260341_-\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	6.5e-41	67.6
WP_087986228.1\|260753_262314_+\|transposase	IS3 family transposase	A0A0C5AEA5	Paenibacillus_phage	4.9e-68	57.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_AP014865

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_AP014865_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_AP014865_1

384578-384680

Orphan

Consensus_repeat	Method
AACTTGCAACAGGTTGCTCTTTCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_AP014865_1

>merge|NZ_AP014865|1|384578-384680|CRISPRCasFinder
AACTTGCAACATGCTGCTCTTTCTTTTCCCTATTTCTACTTCCTACATCTCTTTTGCGCCTTGCTTTCCTTAATTCTTCAACTTGCAACAGGTTGCTCTTTCT

>NZ_AP014865|1|1|384578-384680|CRISPRCasFinder
AACTTGCAACATGCTGCTCTTTCT	TTTCCCTATTTCTACTTCCTACATCTCTTTTGCGCCTTGCTTTCCTTAATTCTTC
AACTTGCAACAGGTTGCTCTTTCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_AP014865.1\|WP_060852678.1\|398952_399225_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014865.1\|WP_000237075.1\|381842_382310_+\|RsfA-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274342
NZ_AP014865.1\|WP_000592191.1\|377280_377691_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014865.1\|WP_053512205.1\|391673_392108_-\|SMI1/KNR4-family-protein	unknown	unknown	gnl\|CDD\|378155
NZ_AP014865.1\|WP_000475233.1\|394711_395005_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014865.1\|WP_000787540.1\|378107_378521_-\|DUF86-domain-containing-protein	unknown	unknown	gnl\|CDD\|366864
NZ_AP014865.1\|WP_000279639.1\|388737_388884_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014865.1\|WP_060852676.1\|392256_393951_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197775
NZ_AP014865.1\|WP_060852677.1\|395936_397646_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014865.1\|WP_053514496.1\|379838_381488_-\|S8-family-serine-peptidase	unknown	unknown	gnl\|CDD\|173792
NZ_AP014865.1\|WP_000789087.1\|390467_390788_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|373052
NZ_AP014865.1\|WP_001167047.1\|372969_373185_-\|alpha/beta-type-small-acid-soluble-spore-protein	unknown	unknown	gnl\|CDD\|365990
NZ_AP014865.1\|WP_053514497.1\|382471_384169_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|334531
NZ_AP014865.1\|WP_060852674.1\|386085_387795_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014865.1\|WP_000577229.1\|378510_378918_-\|nucleotidyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|376187
NZ_AP014865.1\|WP_025688475.1\|379280_379628_-\|YxeA-family-protein	unknown	unknown	gnl\|CDD\|377665
NZ_AP014865.1\|WP_053514495.1\|373351_375094_-\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|206779
NZ_AP014865.1\|WP_000913858.1\|376082_376562_+\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_AP014865.1\|WP_081097642.1\|390010_390463_-\|SMI1/KNR4-family-protein	unknown	unknown	gnl\|CDD\|379649
NZ_AP014865.1\|WP_002164674.1\|398702_398825_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236723

Protein	Function_ID	Function_description	E-value
NZ_AP014865.1\|WP_000237075.1\|381842_382310_+\|RsfA-family-transcriptional-regulator	gnl\|CDD\|274342	TIGR02894, DNA_bind_RsfA, transcription factor, RsfA family. In a subset of endospore-forming members of the Firmcutes, members of this protein family are found, several to a genome. Two very strongly conserved sequences regions are separated by a highly variable linker region. Much of the linker region was excised from the seed alignment for this model. A characterized member is the prespore-specific transcription RsfA from Bacillus subtilis, previously called YwfN, which is controlled by sigma factor F and seems to fine-tune expression of some genes in the sigma-F regulon. A paralog in Bacillus subtilis is designated YlbO. [Regulatory functions, DNA interactions, Cellular processes, Sporulation and germination].	3.67391e-51
NZ_AP014865.1\|WP_053512205.1\|391673_392108_-\|SMI1/KNR4-family-protein	gnl\|CDD\|378155	pfam09346, SMI1_KNR4, SMI1 / KNR4 family (SUKH-1). Proteins in this family are involved in the regulation of 1,3-beta-glucan synthase activity and cell-wall formation. Genome contextual information showed that SMI1 are primary immunity proteins in bacterial toxin systems.	2.50332e-16
NZ_AP014865.1\|WP_000787540.1\|378107_378521_-\|DUF86-domain-containing-protein	gnl\|CDD\|366864	pfam01934, DUF86, Protein of unknown function DUF86. The function of members of this family is unknown.	1.21888e-29
NZ_AP014865.1\|WP_060852676.1\|392256_393951_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197775	smart00530, HTH_XRE, Helix-turn-helix XRE-family like proteins.	0.00214263
NZ_AP014865.1\|WP_053514496.1\|379838_381488_-\|S8-family-serine-peptidase	gnl\|CDD\|173792	cd04843, Peptidases_S8_11, Peptidase S8 family domain, uncharacterized subfamily 11. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.	4.33725e-128
NZ_AP014865.1\|WP_000789087.1\|390467_390788_-\|hypothetical-protein	gnl\|CDD\|373052	pfam14411, LHH, A nuclease of the HNH/ENDO VII superfamily with conserved LHH. LHH is a predicted nuclease of the HNH/ENDO VII superfamily of the treble clef fold. The name is derived from the conserved motif, LHH. It is found in bacterial polymorphic toxin systems and functions as a toxin module. Like WHH and AHH, LHH nuclease contain 4 conserved histidines of which, the first one is predicted to bind metal-ion and other three ones are involved in activation of water molecule for hydrolysis.	9.87584e-21
NZ_AP014865.1\|WP_001167047.1\|372969_373185_-\|alpha/beta-type-small-acid-soluble-spore-protein	gnl\|CDD\|365990	pfam00269, SASP, Small, acid-soluble spore proteins, alpha/beta type.	1.32756e-18
NZ_AP014865.1\|WP_053514497.1\|382471_384169_-\|hypothetical-protein	gnl\|CDD\|334531	pfam01418, HTH_6, Helix-turn-helix domain, rpiR family. This domain contains a helix-turn-helix motif. The best characterized member of this family is RpiR, a regulator of the expression of rpiB gene.	0.00304509
NZ_AP014865.1\|WP_000577229.1\|378510_378918_-\|nucleotidyltransferase-domain-containing-protein	gnl\|CDD\|376187	pfam18765, Polbeta, Polymerase beta, Nucleotidyltransferase. A member of the nucleotidyltransferase fold found in polymorphic toxins (NTox45) and polyvalent proteins.	7.81079e-24
NZ_AP014865.1\|WP_025688475.1\|379280_379628_-\|YxeA-family-protein	gnl\|CDD\|377665	pfam06486, DUF1093, Protein of unknown function (DUF1093). This family consists of several hypothetical bacterial proteins of unknown function.	1.43681e-25
NZ_AP014865.1\|WP_053514495.1\|373351_375094_-\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|206779	cd11386, MCP_signal, Methyl-accepting chemotaxis protein (MCP), signaling domain. Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.	9.34534e-46
NZ_AP014865.1\|WP_000913858.1\|376082_376562_+\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	0.00531152
NZ_AP014865.1\|WP_081097642.1\|390010_390463_-\|SMI1/KNR4-family-protein	gnl\|CDD\|379649	pfam14567, SUKH_5, SMI1-KNR4 cell-wall. Members of this family are related to the SMI1/KNR4-like or SUKH superfamily of proteins.	1.81098e-35
NZ_AP014865.1\|WP_002164674.1\|398702_398825_+\|hypothetical-protein	gnl\|CDD\|236723	PRK10594, PRK10594, murein L,D-transpeptidase; Provisional.	0.00151195

>NZ_AP014865.1|WP_053514497.1|382471_384169_-|hypothetical-protein
MDNLLQMFRDALLISEPIYKTNELVWNKWNAYFKDVENNNNKVLTSTHASPSFTALVSWLEKKQESGITLVQIYAKIDSYKEEIYKEIELFIEKEFQDVVHSNSLILENDQNIDKPNIVNHEDYYEVNNSAVYYKLRDGIAKNQFEEDEISKVLQYPIETRSSNGVAQLSSHKDEDLRLTNIEEAARWNTLVDDVMSNMDDLTADCLDAITIQWINEAKSPDDFIDFSYEQVLEMCNIPKTVVKNKEYYRAEDKIKIAKRIAALASIFIYLNDDNEVVVLNDRDDDGERLELKREVIKRLFVLDSVVLWRHSVTNEYMGIESCRIKPGSFLTNYLYGSNNTTALLSKKALEYNSYRHKYHKRLIRYLTWQWRIRQMYSSLKKPYSIGGDKGLLAVMDIPKDWKPNRIREQLENVLMDLENEKVISHWEYSDPLDEQQIGKRNWFKNYYTNLGITILPPEEMLQSMDRVIGKKSIEEPQEQLPEVTVVKEIKKTVESVEHIEKKIRDQILKVHNEKKVSIREIADEMSISPSTLSRFCNYKTKRLSKKALEKLTKWCERQEILEKM
>NZ_AP014865.1|WP_000237075.1|381842_382310_+|RsfA-family-transcriptional-regulator
MVISRQDSWTDDNDLLLASTVLQNIRNGGTQLAAFKEVAKLLARTPAACGFRWNSYVRKQYQEEIQQAKQDRKMGNNIPFSPSQIEKNSLSITLDDIILFLQTYKDVNELTKLQNQIEDLETENQSLLQRITMYEEEYRMLLNHIDKTRNLIAVD
>NZ_AP014865.1|WP_053514496.1|379838_381488_-|S8-family-serine-peptidase
MKIFKGILVSSIALTAFNGVGGLLPNEKSEVAYAATYNYSNKQLNSTVHKQVTKQLILKFKNEANLPYQDGIEKFIKEEKQDPELIGILAEYPNVTINRLFNSLNPKEIKNLGKEIKDSDQISSNLLNYYIVETQDDIDVQALLTKIEKSSLVETAYLQEEEAPPAERLPNLSVNPYDEPRLTRQGYLEPAPLGINAPYAWSIKGGDGKGTTFVDMEYGWLFNHEDLVNQKIELISGQNKSEHHDHGTSVLGIVSAEDNNIGGIGIAPKAKVKVVSQIRDNGNYNTADAILSAVNNMQAGDILLLEAQATYDGYGDKNYFPVEVKPDIFDAIRMGTNKGIIIIEAGANGGNDLDQFRDRNGKQVLNRNSPDFKDSGAIMVGAASARVPHKRSYFSNYGSRVDVYGWGNAVDTTDAKPSEFITNLYTSSFAGTSSASPIIAGAAASIQGIAKNNQGRVYTPRQLRAILSDSSTGTKSNDPTSDKIGVLPDLKAILSKLGFSPNLGNDSSIVFPEEQEINKGNKGNEGSTITFPKEDTANSEEDSSFIFPE
>NZ_AP014865.1|WP_025688475.1|379280_379628_-|YxeA-family-protein
MKRIVFMCSVFVMFTVLLSGCNLNRLGTDTYYVQITKDGEKLKEKNVNGDTTYEYKLLGFDKDGKEKEMEFTALKNLRKEAFLRIYYSEKKGVKSWEEVKKDELPTKVKEKLKVD
>NZ_AP014865.1|WP_000577229.1|378510_378918_-|nucleotidyltransferase-domain-containing-protein
MIFQSMITAIIEKLQETVNPYWIIVFGSTAENREREDSDIDIAYVSDTTLGNYERFLLAQELANIVQRDVDLVDLSEASTVFQAQIIHTGKTIFCSDEKRKVIFEMKTLKMYSKLNEERQVVFDDIKKRGSIYEE
>NZ_AP014865.1|WP_000787540.1|378107_378521_-|DUF86-domain-containing-protein
MKNEVILNKISTIERCIKRIQDVYGNDPENLEDFTKQDSIILNIQRACEASIDLAMHIVAGKKLGLPQSSREAFDLLVTAGLLSADLANKLKAMVGFRNIAVHDYQSVNLDIVRQIIEKHLTDFKLFTKEVMGILEF
>NZ_AP014865.1|WP_000592191.1|377280_377691_-|hypothetical-protein
MIKKLIISSIALGATIGVSKPTFAATIHSPSQFKETRNVHVQSLYSPWQYLGQTSRELQIKSKDPKVLAFELAKEAPFYEEELVDICSEILDANVDVVYWTSKEWVRFEEGNYEFKHEIKIFRDKERQQLITTLES
>NZ_AP014865.1|WP_000913858.1|376082_376562_+|CPBP-family-intramembrane-metalloprotease
MLKKINRFMFALPTISFIFLILLGSFLFVIPLDLFLPEIQKNPLTEAPLILQVLLGVLAAPIYETVVFQVFLFWLLSWIPYIKNRDYLIILIASIIFGLNHQYGITYIVGTTIIGLLYNYAYWVYKKKNEKYQVTMPAFGVVFLIHLLHNSIAFIASNL
>NZ_AP014865.1|WP_053514495.1|373351_375094_-|methyl-accepting-chemotaxis-protein
MKKYWHKLSLLQKNVLLTVLVILTLVGSMGALSFNMFQNSMMSIFERQSFETGDAVLNQLDLEIVRDVAKDPTAQRVKKEKLTEQLDKSIKDMKSVGQTYVTGAKLNDKAKLQIVALDTQLANTVSVKPGEYYEQPTYWMKTYDKVIQTKQAQMTEVYEDELGFWVTILEPVTDENKNIIAIVAADLEASIIPLTKKNFMIQGLLFIIISLTIAITIQIFISRNSLSPLKDLQEGLRKVGEGDLSIKLNERSDDIGITNIYFNNTIKKFNRIIDKVRQTAEQVLTSSQELSVSTKENSVAFKEIASAITGLNLGAHSHEYVVQKCLEIVQEMESKMKEIKGAAKQVGNALEDMEQHSVEGKGLIKQIVNQMKRNRDRVQEVSSSIYALEVRSKEIHEILTVITTISNQTNSLALNASTESSCAGEMGEEFSGVADEVRILAERTEASARDIAKLIGETQAEAERAVRSIQKSSKEVEVGITLVQSSGAFFEKISESAQSVTNQIKATSNHSSDILKDNQTIVQFVNELSHIANTYVNSSSNVETSMKEQELYVQDIAELANSLNWLSQELQGLIGEFKSN
>NZ_AP014865.1|WP_001167047.1|372969_373185_-|alpha/beta-type-small-acid-soluble-spore-protein
MQIRENNNSNEILIAAAASAIEQMKYEIAQEFGVTLGPDSTARANGSVGGEITKRLVRMAQEQLSGQYKIH
>NZ_AP014865.1|WP_060852674.1|386085_387795_+|hypothetical-protein
MGKSFVIRNQRSLNGETTNAVLVTLKSWQKLVEAFEEKYYSYKDTYLEDILQHMTYEDRIADVEGFVEKAKPSFSRRAMSALAEKTGRKHRLYGITNADLEVFLYLHKKCYTNGVIPNVTIHMMWEDYKQYKEELAYIQHSQFYIALKKLSLHNIISIENGLDSRYTIKLTHFMNEETEKANPYVYISPVVFTKAFFKLSVAAKKLFLDIAMQQHTETTLKRSLDKQDERGNKTHFGGMYRFLHKKYPHQIRAVIEELTTALPCTGNPLFKICKMQKGVKHTKRYTTLYLSIHSDFLCSKEAGEEQHRDPFTPKVTYARKAKFIEAVLQEMNIGELSADMNKFIHVLKHTCHRQIRSVIRGLRDMVDRKEGYPTKIVYTLKKLLHQTSQYQILDTAAKEGIYPLIAQHIPKERNSDREQAVFNFGLHYSMYSLHNIKKMFRNVHALLKQKFAVPVTEESYHRNYLKYQEETLFRKYAYDQGVNLHAYIALEIEMREKLKVRGHKERTIPSDVREWFIEAIDKLPQEKLHVIELPKQFNLLEFMRTFERLVRAGITITTPDQVLTAMEIK
>NZ_AP014865.1|WP_000279639.1|388737_388884_+|hypothetical-protein
MAVLKDSTYLEMNTYNEIRFFKGIFWGLVFVVPFWSIMITLFIFLYRQ
>NZ_AP014865.1|WP_081097642.1|390010_390463_-|SMI1/KNR4-family-protein
MNDKIISIITTYEKDGDFMGGVNEGTIREAAQMLNVNFPNSYHCFLKQYGSGGLDGMDIHGCETTAADSSVVYHTKLYRETYNLPEQYIVLNDIDGTVTCLDTNQMKDGECPVVFWSRFSKELYAITYENFSDYLFDSLQESVDNLYDED
>NZ_AP014865.1|WP_000789087.1|390467_390788_-|hypothetical-protein
MKNIDWDYVAPPSVNNSGKSNLQLALDGGVPFTKDNHKIELHHLTQKEPGAMVEIPANKHDEFTKALHGLVESGESFRNDKELYKQYNNFRNNYWKMRAREHLEGK
>NZ_AP014865.1|WP_053512205.1|391673_392108_-|SMI1/KNR4-family-protein
MWKTFISNVSTDFQFKVPATKDEISQIKEKLNVELPNDLSSLLNETNGVLDEYDCLFIWSIEQILKENLNLRSFNDFKDLYMPFNCLLFFADGGNGDLFGYAILNGVIQKDDVYVWNHENDSRTWVAPSLKTFIEWWNNGTITV
>NZ_AP014865.1|WP_060852676.1|392256_393951_-|helix-turn-helix-transcriptional-regulator
MEKLKILFQNTLYIAYPLLTGVEGSEKVLNKWQQFYQDVERDLQEIYNSTYSSQTFERLVKWVSKKESLGLSAIDILPKLENHREEIFECLRDDLYMEFGIKLPIIAKELPLYSEAKSDYIERSNAGFMYHLSDTIAKNKFTDDQDKNVRIAQLQDKQNSLVVVSSHDDGDMKLQREELKRWNTLIDSTFLTRVMDDLTADCLDIVTELWVKSAENDKTIVPVHYEQVLDMCNMKQIKNGKAYYRKEDRLKIMERLAALASIFIYVNEDNEIVILNEEDPNESLAYKKQRIRRLFVMDEIIIAKDIDTDKTLGIESMNVTPGSFLSKYLYGSEKLTGLLSKKALEYNSKQQRYHKRLTRYLSWRWRIQQSYQHLTHSYSIGGPKGLLQVMEISTNRKPSLIRQVFEKTLDDLMRDQVIQEWKYSPEIDEEKCKGKNWFENYWLKLKVIISPTNELVKLQQELITKKSKQHAPLIIEMEEKPPVIEEQPISIVNQETPNSIEFYIEKMNTYKEKNNKSIRELAKEIDISYSTLSRMLSGKRKRLNDDTKNKLDKWIERQVVVNLL
>NZ_AP014865.1|WP_000475233.1|394711_395005_-|hypothetical-protein
MFKKVIIGTLATGIMLSGAGGVFAETPTDTGVKLKTIDNKKSFVKKKETQDFPGYKSKGEIPTVKEWNGVTWYLKGATEVSKNSWTGHYEGWRTSNN
>NZ_AP014865.1|WP_060852677.1|395936_397646_+|hypothetical-protein
MGKSFVVRNQRSLNGASTNAVLVTLKSWQKLVEAFEEKYYSYKDTYLEDILQHMTYEDRIADVDGFVEKAKPSFSRRAMSALAEKTGRKHKLYGITNADLEVFLYLHKKCFTNGVIPNVTIHMIWEDYKQYKEEFAYIQHSQFYIALKKLSLHNIISIENGIDGRYTIKLTHFLNEETEKANSYVYISPVVFTKAFFKLSVAAKKLFLDIAMQQHTETTLKRSLDKHDERGNKTHFGGMYRFLHKKYPHQIREVIDELTITLPCTGSPLFKICKMQKGVKHTKRYTTLYLSIHSDFLCTKESGEEQYRDPFTPRATYARKAKFIESLLQEMNIGELSADMNQFIHVLKHTCHRQIRSVIRGLRDMVDRKEGYPTKIVYTLKKLLHQTSQYQILDTAAKEGIYPLIAQHIPKERNSDREQAVFNFGLHYSMYSLHNIKKMFRNVHALLKQKFAVPITEESYHLNYLKYQEETLFRKYAYDQGVNLHAYIALEIEMREKLKVRGHKERTIPSDVREWFIEAIDKLPQEKLRVIELPKQFNLLEFMRTFERLVRAGVTITAPDQVLTAMEIK
>NZ_AP014865.1|WP_002164674.1|398702_398825_+|hypothetical-protein
MNKGISIEVVLEAFSAYLAENGRKQSRIERYNYDITGFYK
>NZ_AP014865.1|WP_060852678.1|398952_399225_+|hypothetical-protein
MSLAIDTSVDDFHFSLIPDHSLSDKDFITEAEEKLLKQTPLSTKGLTERHVEYRPLIMDRNASIINLVVNYGLSLQGLVSLNMSHIQLAL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_AP014865_1	1.1\|384602\|55\|NZ_AP014865\|CRISPRCasFinder	384602-384656	55	NZ_AP014865.1	384762-384816	0	1.0
NZ_AP014865_1	1.1\|384602\|55\|NZ_AP014865\|CRISPRCasFinder	384602-384656	55	NZ_AP014865.1	384922-384976	2	0.964

1. spacer 1.1|384602|55|NZ_AP014865|CRISPRCasFinder matches to position: 384762-384816, mismatch: 0, identity: 1.0

tttccctatttctacttcctacatctcttttgcgccttgctttccttaattcttc	CRISPR spacer
tttccctatttctacttcctacatctcttttgcgccttgctttccttaattcttc	Protospacer
*******************************************************

2. spacer 1.1|384602|55|NZ_AP014865|CRISPRCasFinder matches to position: 384922-384976, mismatch: 2, identity: 0.964

tttccctatttctacttcctacatctcttttgcgccttgctttccttaattcttc	CRISPR spacer
tttccctatttctacttcctacatttcttttgcaccttgctttccttaattcttc	Protospacer
************************.********.*********************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_AP014865_1	1.1\|384602\|55\|NZ_AP014865\|CRISPRCasFinder	384602-384656	55	NZ_CP022446	Bacillus cereus C1L plasmid pC1L1, complete sequence	417447-417501	0	1.0
NZ_AP014865_1	1.1\|384602\|55\|NZ_AP014865\|CRISPRCasFinder	384602-384656	55	NZ_AP014865	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence	384602-384656	0	1.0
NZ_AP014865_1	1.1\|384602\|55\|NZ_AP014865\|CRISPRCasFinder	384602-384656	55	NZ_AP014865	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence	384762-384816	0	1.0
NZ_AP014865_1	1.1\|384602\|55\|NZ_AP014865\|CRISPRCasFinder	384602-384656	55	NZ_AP014865	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence	384922-384976	2	0.964
NZ_AP014865_1	1.1\|384602\|55\|NZ_AP014865\|CRISPRCasFinder	384602-384656	55	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	624999-625053	2	0.964
NZ_AP014865_1	1.1\|384602\|55\|NZ_AP014865\|CRISPRCasFinder	384602-384656	55	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	625157-625211	2	0.964
NZ_AP014865_1	1.1\|384602\|55\|NZ_AP014865\|CRISPRCasFinder	384602-384656	55	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	624919-624973	7	0.873

1. spacer 1.1|384602|55|NZ_AP014865|CRISPRCasFinder matches to NZ_CP022446 (Bacillus cereus C1L plasmid pC1L1, complete sequence) position: , mismatch: 0, identity: 1.0

tttccctatttctacttcctacatctcttttgcgccttgctttccttaattcttc	CRISPR spacer
tttccctatttctacttcctacatctcttttgcgccttgctttccttaattcttc	Protospacer
*******************************************************

2. spacer 1.1|384602|55|NZ_AP014865|CRISPRCasFinder matches to NZ_AP014865 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence) position: , mismatch: 0, identity: 1.0

tttccctatttctacttcctacatctcttttgcgccttgctttccttaattcttc	CRISPR spacer
tttccctatttctacttcctacatctcttttgcgccttgctttccttaattcttc	Protospacer
*******************************************************

3. spacer 1.1|384602|55|NZ_AP014865|CRISPRCasFinder matches to NZ_AP014865 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence) position: , mismatch: 0, identity: 1.0

tttccctatttctacttcctacatctcttttgcgccttgctttccttaattcttc	CRISPR spacer
tttccctatttctacttcctacatctcttttgcgccttgctttccttaattcttc	Protospacer
*******************************************************

4. spacer 1.1|384602|55|NZ_AP014865|CRISPRCasFinder matches to NZ_AP014865 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence) position: , mismatch: 2, identity: 0.964

tttccctatttctacttcctacatctcttttgcgccttgctttccttaattcttc	CRISPR spacer
tttccctatttctacttcctacatttcttttgcaccttgctttccttaattcttc	Protospacer
************************.********.*********************

5. spacer 1.1|384602|55|NZ_AP014865|CRISPRCasFinder matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 2, identity: 0.964

tttccctatttctacttcctacatctcttttgcgccttgctttccttaattcttc	CRISPR spacer
tttccctatttctacttcctacatttcttttgcgccttgcttgccttaattcttc	Protospacer
************************.***************** ************

6. spacer 1.1|384602|55|NZ_AP014865|CRISPRCasFinder matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 2, identity: 0.964

tttccctatttctacttcctacatctcttttgcgccttgctttccttaattcttc	CRISPR spacer
tttccctatttctacttcctacatttcttttgcgccttgcttgccttaattcttc	Protospacer
************************.***************** ************

7. spacer 1.1|384602|55|NZ_AP014865|CRISPRCasFinder matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 7, identity: 0.873

tttccctatttctacttcctacatctcttttgcgccttgctttccttaattcttc	CRISPR spacer
tttccctatttctacttcctacatttcttttgcgccttgcttgccttatatttct	Protospacer
************************.***************** *****  *.*..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

10811 : 80434

Enterobacteria_phage(16.67%)

integrase,transposase

attL 17876:17892|attR 45028:45044

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060852562.1\|10811_12386_+\|transposase	IS21 family transposase	U5N3F9	Enterobacteria_phage	1.5e-21	27.7
WP_060852563.1\|12397_13177_+	ATP-binding protein	U5N3V8	Enterobacteria_phage	3.3e-33	32.2
WP_060852564.1\|14518_15028_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_060852565.1\|15008_16025_+	anti sigma factor C-terminal domain-containing protein	NA	NA	NA	NA
WP_001053969.1\|16474_17911_-\|transposase	IS4-like element IS231C family transposase	NA	NA	NA	NA
17876:17892	attL	NA	NA	NA	NA
WP_000444120.1\|22378_23059_+	hypothetical protein	NA	NA	NA	NA
WP_000793411.1\|23060_23237_+	hypothetical protein	NA	NA	NA	NA
WP_060852566.1\|23963_25124_+	serine hydrolase	A0A2H4JAN9	uncultured_Caudovirales_phage	1.9e-16	25.1
WP_000395068.1\|27133_27307_-	hypothetical protein	NA	NA	NA	NA
WP_001204525.1\|29509_29698_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_000189814.1\|30716_31718_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_060852568.1\|32121_33315_+\|integrase	site-specific integrase	A0A142F1N9	Bacillus_phage	9.0e-06	23.7
WP_060852569.1\|33601_34897_-	amino acid permease	NA	NA	NA	NA
WP_000372880.1\|35047_35488_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_060852570.1\|36411_37110_+	L-serine ammonia-lyase, iron-sulfur-dependent, subunit beta	NA	NA	NA	NA
WP_060852571.1\|37131_38022_+	L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha	NA	NA	NA	NA
WP_060852572.1\|38304_39624_+	septum formation initiator	NA	NA	NA	NA
WP_000196515.1\|39978_40278_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_145977432.1\|40893_41481_-	TetR/AcrR family transcriptional regulator C-terminal ligand-binding domain-containing protein	NA	NA	NA	NA
WP_000064490.1\|41838_43029_+	MFS transporter	NA	NA	NA	NA
WP_042884146.1\|44290_44899_+	Fic family protein	NA	NA	NA	NA
WP_060852573.1\|45314_48197_+	collagenase ColA	NA	NA	NA	NA
45028:45044	attR	NA	NA	NA	NA
WP_000364215.1\|49123_49534_+	DUF1878 family protein	NA	NA	NA	NA
WP_000116992.1\|49682_51113_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_000275580.1\|54224_55520_+\|transposase	IS21-like element IS232 family transposase	A0A059NT83	Lactococcus_phage	1.0e-42	31.0
WP_000798699.1\|55509_56262_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	7.0e-57	47.3
WP_060852575.1\|57788_60518_+	GGDEF domain-containing protein	NA	NA	NA	NA
WP_060852576.1\|60987_61569_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_060852577.1\|61664_62534_+	NAD(P)-binding domain-containing protein	NA	NA	NA	NA
WP_025687304.1\|63112_64714_+	S-layer homology domain-containing protein	A0A1J0MS59	Bacillus_phage	5.0e-44	54.9
WP_016078303.1\|65985_66384_+\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	1.2e-50	68.2
WP_060852578.1\|66395_67508_+	helix-turn-helix domain-containing protein	A0A288TXV8	Enterococcus_phage	6.1e-81	48.6
WP_000582596.1\|70136_70769_+	hypothetical protein	NA	NA	NA	NA
WP_060852580.1\|70765_71401_+	hypothetical protein	NA	NA	NA	NA
WP_000828156.1\|71697_72081_+	hypothetical protein	NA	NA	NA	NA
WP_060852581.1\|72097_72736_+	NERD domain-containing protein	A0A2R2ZH57	Clostridioides_phage	4.0e-21	37.4
WP_088010471.1\|73025_73775_+	epoxyqueuosine reductase QueH	NA	NA	NA	NA
WP_001154000.1\|73926_74085_-	hypothetical protein	NA	NA	NA	NA
WP_000287794.1\|75137_75923_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	3.9e-26	33.5
WP_000353530.1\|75939_76797_-	glucose transporter GlcU	NA	NA	NA	NA
WP_000210393.1\|77855_78149_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_001206765.1\|78696_79110_+	hypothetical protein	NA	NA	NA	NA
WP_060852582.1\|80035_80434_+\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	1.2e-50	68.2

DBSCAN-SWA_2

138147 : 249481

Tupanvirus(33.33%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060852598.1\|138147_139266_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	2.9e-171	80.9
WP_060852599.1\|139725_140712_-	choloylglycine hydrolase family protein	M1I458	Paramecium_bursaria_Chlorella_virus	3.0e-31	32.3
WP_000472915.1\|141562_141988_-	DUF4879 domain-containing protein	NA	NA	NA	NA
WP_060852600.1\|142573_144043_+	glutamate decarboxylase	NA	NA	NA	NA
WP_081097637.1\|144733_145654_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_000725626.1\|146044_146491_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_001039025.1\|146949_148038_-	HBL/NHE enterotoxin family protein	NA	NA	NA	NA
WP_000743455.1\|148311_149442_-	HBL/NHE enterotoxin family protein	NA	NA	NA	NA
WP_001053955.1\|150210_151647_-\|transposase	IS4-like element IS231A family transposase	NA	NA	NA	NA
WP_000798699.1\|153972_154725_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	7.0e-57	47.3
WP_000275580.1\|154714_156010_-\|transposase	IS21-like element IS232 family transposase	A0A059NT83	Lactococcus_phage	1.0e-42	31.0
WP_000416178.1\|156326_156494_-	hypothetical protein	NA	NA	NA	NA
WP_060852602.1\|157002_157644_+	hypothetical protein	NA	NA	NA	NA
WP_000947505.1\|157905_158157_-	DUF2164 family protein	NA	NA	NA	NA
WP_060852603.1\|158296_159070_-	ParB N-terminal domain-containing protein	NA	NA	NA	NA
WP_002164693.1\|159202_160171_-	2,3-diaminopropionate biosynthesis protein SbnB	NA	NA	NA	NA
WP_000914216.1\|160198_161176_-	2,3-diaminopropionate biosynthesis protein SbnA	C3U2M1	Lactococcus_phage	4.4e-27	29.2
WP_001007707.1\|161340_162273_-	ornithine carbamoyltransferase	A0A1J0F9B8	Only_Syngen_Nebraska_virus	1.6e-18	28.1
WP_140165520.1\|162745_162961_+	hypothetical protein	NA	NA	NA	NA
WP_001028932.1\|163064_163763_-	4'-phosphopantetheinyl transferase superfamily protein	NA	NA	NA	NA
WP_060852604.1\|163997_170534_-	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	3.8e-183	29.6
WP_060852688.1\|170775_171495_-	thioesterase	NA	NA	NA	NA
WP_060852605.1\|171550_176047_-	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	1.7e-81	27.7
WP_000031546.1\|176028_177108_-	HAD-IIIC family phosphatase	NA	NA	NA	NA
WP_060852606.1\|177104_180188_-	cyclic peptide export ABC transporter	A0A2P1JQM9	Mycobacterium_phage	2.8e-11	28.1
WP_000608548.1\|180203_181280_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_060852607.1\|181298_188987_-	hybrid non-ribosomal peptide synthetase/type I polyketide synthase	A0A2K9KZV5	Tupanvirus	1.3e-94	26.1
WP_025686627.1\|188961_190539_-	amino acid adenylation domain-containing protein	A0A2K9L3I8	Tupanvirus	4.4e-69	32.1
WP_060852608.1\|190535_191729_-	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_001152970.1\|191728_191974_-	acyl carrier protein	NA	NA	NA	NA
WP_060852609.1\|192004_192853_-	3-hydroxyacyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_060852610.1\|192893_194111_-	ACP S-malonyltransferase	NA	NA	NA	NA
WP_060852611.1\|194130_195258_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_060852612.1\|195254_196403_-	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_000368639.1\|196399_196663_-	acyl carrier protein	NA	NA	NA	NA
WP_060852613.1\|196695_199350_-	C39 family peptidase	NA	NA	NA	NA
WP_060852614.1\|199669_205393_-	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	7.3e-170	27.4
WP_060852615.1\|205419_215430_-	type I polyketide synthase	D0R7J2	Paenibacillus_phage	6.1e-63	35.2
WP_060852616.1\|216671_217067_-	hypothetical protein	NA	NA	NA	NA
WP_001102753.1\|217357_217711_-	hypothetical protein	NA	NA	NA	NA
WP_060852617.1\|217726_220615_-	S-layer protein	NA	NA	NA	NA
WP_060852618.1\|220940_228533_-	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	1.7e-166	28.5
WP_060852619.1\|228898_229825_+	aldo/keto reductase	NA	NA	NA	NA
WP_060852620.1\|230309_231767_+	2,4-diaminobutyrate decarboxylase	NA	NA	NA	NA
WP_001019438.1\|231867_232512_+	hypothetical protein	NA	NA	NA	NA
WP_001056472.1\|233351_233762_-	hypothetical protein	NA	NA	NA	NA
WP_001105577.1\|233889_234108_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_060852621.1\|234253_234580_+	helix-turn-helix transcriptional regulator	A0A0A7RTK4	Clostridium_phage	4.8e-10	55.9
WP_000289919.1\|235323_235719_+	hypothetical protein	NA	NA	NA	NA
WP_000284559.1\|237430_237733_+	hypothetical protein	NA	NA	NA	NA
WP_060852622.1\|238158_238725_-	acyltransferase	NA	NA	NA	NA
WP_060852623.1\|238717_239848_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_060852624.1\|239867_242426_-	glycosyltransferase	A0A1V0SAH6	Catovirus	6.8e-11	32.8
WP_000787392.1\|242602_243394_-	enoyl-CoA hydratase	NA	NA	NA	NA
WP_060852625.1\|243759_244881_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	3.3e-175	82.6
WP_060852626.1\|245397_245610_-	transcriptional regulator	A0A1Z1LZP5	Bacillus_phage	2.6e-17	65.7
WP_060852627.1\|246154_246823_+	hypothetical protein	NA	NA	NA	NA
WP_001053969.1\|248044_249481_+\|transposase	IS4-like element IS231C family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NZ_AP014864

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_AP014864_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_AP014864_1

1149125-1149232

Orphan

Consensus_repeat	Method
AAGTTGTGATAGATATATTTGAAAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_AP014864_1

>merge|NZ_AP014864|1|1149125-1149232|CRISPRCasFinder
AAGTTGTGATAGATATATTTGAAAAATCGTTGATATATTGCAAGTTGTGATAGATATATTTGAAAAATCGTTGATATATTGCAAGTTGTGATAGATATATTCGAAAAA

>NZ_AP014864|1|1|1149125-1149232|CRISPRCasFinder
AAGTTGTGATAGATATATTTGAAAAA	TCGTTGATATATTGCAAGTTGTGATAGATATATTTGAAAAATCGTTGATATATTGC
AAGTTGTGATAGATATATTCGAAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_AP014864.1\|WP_060851699.1\|1145865_1147641_+\|aspartate--tRNA-ligase	unknown	unknown	gnl\|CDD\|234775
NZ_AP014864.1\|WP_001242605.1\|1144050_1144227_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014864.1\|WP_000027084.1\|1144581_1145853_+\|histidine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234586
NZ_AP014864.1\|WP_000857712.1\|1149324_1149966_-\|RsfA-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274342
NZ_AP014864.1\|WP_000941229.1\|1138134_1140474_+\|single-stranded-DNA-specific-exonuclease-RecJ	unknown	unknown	gnl\|CDD\|273193
NZ_AP014864.1\|WP_000812943.1\|1150003_1151290_-\|replication-associated-recombination-protein-A	unknown	unknown	gnl\|CDD\|237355
NZ_AP014864.1\|WP_000242533.1\|1158023_1158236_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014864.1\|WP_001119066.1\|1134718_1136983_+\|protein-translocase-subunit-SecDF	unknown	unknown	gnl\|CDD\|237276
NZ_AP014864.1\|WP_000469281.1\|1157641_1157830_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP014864.1\|WP_000704116.1\|1151583_1152000_+\|Rrf2-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224870
NZ_AP014864.1\|WP_000066409.1\|1154422_1155082_+\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|276809
NZ_AP014864.1\|WP_001262795.1\|1141244_1143428_+\|GTP-diphosphokinase	unknown	unknown	gnl\|CDD\|223394
NZ_AP014864.1\|WP_000409743.1\|1137139_1138033_+\|cation-transporter	unknown	unknown	gnl\|CDD\|223131
NZ_AP014864.1\|WP_001266965.1\|1143444_1143885_+\|D-tyrosyl-tRNA(Tyr)-deacylase	unknown	unknown	gnl\|CDD\|235383
NZ_AP014864.1\|WP_000346215.1\|1140521_1141034_+\|adenine-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|235028
NZ_AP014864.1\|WP_001053553.1\|1157848_1157977_+\|YrzQ-family-protein	unknown	unknown	gnl\|CDD\|289801
NZ_AP014864.1\|WP_060851700.1\|1153197_1154313_+\|tRNA-2-thiouridine(34)-synthase-MnmA	unknown	unknown	gnl\|CDD\|234664
NZ_AP014864.1\|WP_000903179.1\|1147982_1148750_+\|tRNA-threonylcarbamoyladenosine-dehydratase	unknown	unknown	gnl\|CDD\|224100
NZ_AP014864.1\|WP_000528082.1\|1155177_1157514_+\|ATP-dependent-RecD-like-DNA-helicase	unknown	unknown	gnl\|CDD\|273632
NZ_AP014864.1\|WP_000439881.1\|1152035_1153181_+\|cysteine-desulfurase	unknown	unknown	gnl\|CDD\|224029

Protein	Function_ID	Function_description	E-value
NZ_AP014864.1\|WP_060851699.1\|1145865_1147641_+\|aspartate--tRNA-ligase	gnl\|CDD\|234775	PRK00476, aspS, aspartyl-tRNA synthetase; Validated.	0
NZ_AP014864.1\|WP_000027084.1\|1144581_1145853_+\|histidine--tRNA-ligase	gnl\|CDD\|234586	PRK00037, hisS, histidyl-tRNA synthetase; Reviewed.	0
NZ_AP014864.1\|WP_000857712.1\|1149324_1149966_-\|RsfA-family-transcriptional-regulator	gnl\|CDD\|274342	TIGR02894, DNA_bind_RsfA, transcription factor, RsfA family. In a subset of endospore-forming members of the Firmcutes, members of this protein family are found, several to a genome. Two very strongly conserved sequences regions are separated by a highly variable linker region. Much of the linker region was excised from the seed alignment for this model. A characterized member is the prespore-specific transcription RsfA from Bacillus subtilis, previously called YwfN, which is controlled by sigma factor F and seems to fine-tune expression of some genes in the sigma-F regulon. A paralog in Bacillus subtilis is designated YlbO. [Regulatory functions, DNA interactions, Cellular processes, Sporulation and germination].	3.52946e-76
NZ_AP014864.1\|WP_000941229.1\|1138134_1140474_+\|single-stranded-DNA-specific-exonuclease-RecJ	gnl\|CDD\|273193	TIGR00644, recJ, single-stranded-DNA-specific exonuclease RecJ. All proteins in this family are 5'-3' single-strand DNA exonucleases. These proteins are used in some aspects of mismatch repair, recombination, and recombinational repair. [DNA metabolism, DNA replication, recombination, and repair].	0
NZ_AP014864.1\|WP_000812943.1\|1150003_1151290_-\|replication-associated-recombination-protein-A	gnl\|CDD\|237355	PRK13342, PRK13342, recombination factor protein RarA; Reviewed.	0
NZ_AP014864.1\|WP_001119066.1\|1134718_1136983_+\|protein-translocase-subunit-SecDF	gnl\|CDD\|237276	PRK13024, PRK13024, bifunctional preprotein translocase subunit SecD/SecF; Reviewed.	0
NZ_AP014864.1\|WP_000704116.1\|1151583_1152000_+\|Rrf2-family-transcriptional-regulator	gnl\|CDD\|224870	COG1959, COG1959, Predicted transcriptional regulator [Transcription].	2.95252e-47
NZ_AP014864.1\|WP_000066409.1\|1154422_1155082_+\|tetratricopeptide-repeat-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	5.08849e-17
NZ_AP014864.1\|WP_001262795.1\|1141244_1143428_+\|GTP-diphosphokinase	gnl\|CDD\|223394	COG0317, SpoT, Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription].	0
NZ_AP014864.1\|WP_000409743.1\|1137139_1138033_+\|cation-transporter	gnl\|CDD\|223131	COG0053, MMT1, Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism].	3.35577e-88
NZ_AP014864.1\|WP_001266965.1\|1143444_1143885_+\|D-tyrosyl-tRNA(Tyr)-deacylase	gnl\|CDD\|235383	PRK05273, PRK05273, D-tyrosyl-tRNA(Tyr) deacylase; Provisional.	2.58104e-98
NZ_AP014864.1\|WP_000346215.1\|1140521_1141034_+\|adenine-phosphoribosyltransferase	gnl\|CDD\|235028	PRK02304, PRK02304, adenine phosphoribosyltransferase; Provisional.	1.36126e-92
NZ_AP014864.1\|WP_001053553.1\|1157848_1157977_+\|YrzQ-family-protein	gnl\|CDD\|289801	pfam13056, DUF3918, Protein of unknown function (DUF3918). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 40 amino acids in length. There are two completely conserved residues (G and R) that may be functionally important.	7.47863e-08
NZ_AP014864.1\|WP_060851700.1\|1153197_1154313_+\|tRNA-2-thiouridine(34)-synthase-MnmA	gnl\|CDD\|234664	PRK00143, mnmA, tRNA-specific 2-thiouridylase MnmA; Reviewed.	0
NZ_AP014864.1\|WP_000903179.1\|1147982_1148750_+\|tRNA-threonylcarbamoyladenosine-dehydratase	gnl\|CDD\|224100	COG1179, COG1179, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism].	1.50325e-123
NZ_AP014864.1\|WP_000528082.1\|1155177_1157514_+\|ATP-dependent-RecD-like-DNA-helicase	gnl\|CDD\|273632	TIGR01448, recD_rel, helicase, putative, RecD/TraA family. This model describes a family similar to RecD, the exodeoxyribonuclease V alpha chain of TIGR01447. Members of this family, however, are not found in a context of RecB and RecC and are longer by about 200 amino acids at the amino end. Chlamydia muridarum has both a member of this family and a RecD. [Unknown function, Enzymes of unknown specificity].	0
NZ_AP014864.1\|WP_000439881.1\|1152035_1153181_+\|cysteine-desulfurase	gnl\|CDD\|224029	COG1104, NifS, Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism].	0

>NZ_AP014864.1|WP_000903179.1|1147982_1148750_+|tRNA-threonylcarbamoyladenosine-dehydratase
MLHQFSRNELAFGKEGLEILKNSTVGILGIGGVGSFAAEALARSGVGRLVLVDKDVVDITNVNRQIHALVSTVGRSKVELMKERIADINPECEVIGLEMFYTDETYEEFFKYGLDFVVDASDTITFKIHLIKQCLRRKIKIISSMGAANKMDPTRFRIADISKTHTDPIAKVIRTKLRKEGIKKGVKVVFSDENPIVIREEVRKEIVPDENAKIRKAKLPPSSNAFVPSVAGLIMASHVVRERIKNVEVKRVGQE
>NZ_AP014864.1|WP_060851699.1|1145865_1147641_+|aspartate--tRNA-ligase
MAERTHACGKVTVEAVGQTVQLKGWVQKRRDLGGLIFIDLRDRTGIVQVVFNPETSKEALEVAETIRSEYVLHVEGTVVERGEGAINDNMATGRIEVQATKVNVLNAAKTTPIIIADDTDASEDVRLKYRYLDLRRPVMFNTFKMRHDVTKTIRNFLDTEEFLEVETPILTKSTPEGARDYLVPSRVHDGEFYALPQSPQLFKQLLMVGGFERYYQVARCFRDEDLRADRQPEFTQIDIEASFLTQDEILDMMERMMTKVMKDAKGVEVSAPFPRMKYADAMARYGSDKPDTRFEMELTDLSEFAADCGFKVFTSAVESGGQVKAINAKGAASKYSRKDIDALTEFVKVYGAKGLAWLKVEEDGLKGPIAKFFGEEDANVLMSTLEATAGDLLLFVADKKSVVADSLGALRLRLGKELELIDESKFNFLWVTDWPLLEYDEDAERYFAAHHPFTMPFREDVELLETAPEKARAQAYDLVLNGYELGGGSLRIYERDVQEKMFKALGFSQEEAQEQFGFLLEAFEYGTPPHGGIALGLDRLVMLLAGRTNLRDTIAFPKTASASCLLTEAPSPVAESQLEELNLKLSLKEEK
>NZ_AP014864.1|WP_000027084.1|1144581_1145853_+|histidine--tRNA-ligase
MSIQIPRGTQDILPGTVELWQYIEGQAREICRRYNYKEIRTPIFEHTELFLRGVGDTTDIVQKEMYSFQDRGERSLTLRPEGTAPVVRSYVENKMFGDATQPTKLYYIGQMFRYERPQAGRYRQFVQFGIEAIGSNDPAIDAEVIALAVEFYRGMGLKNIKVVLNSLGDAASRQAHRDALIAHFEPRIGEFCSDCQSRLEKNPLRILDCKKDRNHELMGTAPSITEYLNEDSAVYYDKVQELLTMMDVPFEKDPNLVRGLDYYQHTVFEIMSEAEGFGAITTLSGGGRYNGLVQEIGGPEMPGIGFAMSIERLIMALKAENIELPLEHSIDCYVVALGEKAKDHAAKVAFDLRKAGLSVEKDYLDRKMKAQFKSADRLKAKFVAVLGEDELDKGIINLKDMATGEQEEVALDVFASYVAEKLI
>NZ_AP014864.1|WP_001242605.1|1144050_1144227_+|hypothetical-protein
MRMNEKGHSVTNGANQLFNVNFHDFISKEQNNTSMELASEFGISLQDVKRLKKQIERS
>NZ_AP014864.1|WP_001266965.1|1143444_1143885_+|D-tyrosyl-tRNA(Tyr)-deacylase
MRVVLQRSKKASVTVDGEIVGQIPFGLTLLVGITHEDTEKDATYIAEKIANLRIFEDESGKMNHSVLDVEGQVLSISQFTLYGDCRKGRRPNFMDAAKPDYAERLYDFFNEEVRKQGLHVETGKFGAMMDVSLINDGPVTLIVESK
>NZ_AP014864.1|WP_001262795.1|1141244_1143428_+|GTP-diphosphokinase
MANEQVLTAEQVLEKASQYLADEDIELVARAYEYARDAHSEQYRKSGEPYIIHPIQVAGILVDLHMDPATVSAGFLHDVVEDTEITLEDIEREFNKEIAMLVDGVTKLGKIKYKSHEQQQAENHRKMFIAMAQDIRVILIKLADRLHNMRTLKHLPQEKQRRIANETLEIFAPLAHRLGISTIKWELEDTSLRYLNPQQYYRIVNLMKRKRAEREEYLDEVMTGIREKLKEVAIQPEISGRPKHIYSIYRKMALQNKQFNEIYDLLAVRVVVNSIKDCYAVLGIIHTCWKPMPGRFKDYIAMPKANLYQSLHTTVIGPKGDPLEVQIRTKEMHEIAEFGIAAHWAYKEGKTAETTGTLEKKLTWFRQILEWQNEASNAEEFMESLKIDLFSDMVFVFTPKGDVMELPLGSVPIDFAYRVHSEIGNKTIGAKVNGKMVTLDYKLKTGDIIEILTSKHSYGPSQDWVKLAQTSHAKNKIRQFFKKQRRDENIEKGRELVEKEVRGLEYEMKEVLAPDNLKRVAEKFNFANEEDMFAAVGYSGITASQIVTRLTDKFRKQREEEEIVEVKEVRKPMKIRKWDSGVKVSGADNLLIRLSKCCNPVPGDDIVGYITKGRGVSIHRRDCVNVHTEEAVERLLEVEWEGSPEKEIEYNVDIEISGYDRRGLLNEVLQAVTETKTYISAVSGRSDRNKMATINMSISIRNLQHLKKVVERIKRVPEIYAVRRMMH
>NZ_AP014864.1|WP_000346215.1|1140521_1141034_+|adenine-phosphoribosyltransferase
MDFKQHIAIVPDYPKEGIVFKDITPLMNDGKAYKAATDAIVEYAKERDIDVVVGPEARGFIIGCPVSYALEVGFAPVRKLGKLPREVITVDYGKEYGKDVLTIHKDAIKPGQRVLITDDLLATGGTIEATIKLVEELGGVVAGIAFLVELTYLDGRKMLDGYDVLVLEKY
>NZ_AP014864.1|WP_000941229.1|1138134_1140474_+|single-stranded-DNA-specific-exonuclease-RecJ
MLQPKTRWKEKEYNDERVSELASKLQLSPLVVSLFLGRGLDTEDKILDFLNTENQEFHDPFLLEGMDRTVERVNKAIQNGEQILIFGDYDADGVSSTTVLYLALQELGAEVEFYIPNRFTEGYGPNEEAFRWAHSAGFSLIITVDTGIAAVHEANVAKELGIDLIITDHHEPPPELPEALAIIHPKLDGGVYPFHYLAGVGVAFKVAHALLGRVPEHLLEIAVIGTVADLVSLHGENRLLVKRGLKHMRMTRNIGLKALFKVANVSQSEITEESIGFSIAPRINAVGRLEDAAPAVHLLLSDDPEEAKELAEEIDELNKLRKDIVKQITEEAIAEVENNFPPEENKVLVLAKEGWNPGVIGIVASKLVERFYRPTIVLSIDPIKETAKGSARSIAGFDLFANLSDCRELLPHFGGHPMAAGMTLHMNDVDELRRRLNEQADAILTEEDFIPITAVDVFCKVEDVTLAAIEDMQKLAPFGVGNPKPRIAVKDAELESIRAIGSDGSHLKMALRDGQATLDTIGFGFGAYAKEISPVAKVSVIGEASINEWNNFKKPQLMVQDIAVEAWQLFDWRSMRNAEANLAELPKEKITMVYFSEEVLNKFSLESYKEKLMHASEVTHLDDQYIVLLDLPKGTDELRELFKVGFPARIYTLFYQENNHLFSTVPTREHFKWYYSFLSQKTPFSLRQYGEQLCRHKGWSKDTVNFMTQVFFELEFVTIKDGVIFMADKKQKRDLIESNTYREKMNHLQLEKELVYSTYQQLYTWFETIRNHKEVEQLG
>NZ_AP014864.1|WP_000409743.1|1137139_1138033_+|cation-transporter
MEKDERFKQAEFGAIVGIVGNIILAIVKAVIGYIGNSKALLADAVHSASDVIGSLAVLFGLRAAKQPPDEDHPYGHGKAESISAIIVAVLLFIVGLEIAISSIKAFSQELEPPKGITIFAVVLSIVVKEGMFQYKFRLGKRVNSDAIIANAYEHRSDVFSSIAALIGICAAIIGGKLGIDWLVYADPIAGLVVSLLVVKMAWSIGAEAIHATLDHVLHEEDVIPLREAVLQVDGVKKIGSLYAREHGHYVIVDIKVSVDPYITVEEGHRIGKHVKEILMKQDNVQNVFVHINPYSPN
>NZ_AP014864.1|WP_001119066.1|1134718_1136983_+|protein-translocase-subunit-SecDF
MAKRGTRIAAFFLIVLLIGGVIGAAGKDIAKGISLGLDLRGGFEILYEVKPAKKGDKIDRDVLVSTVGALENRVNVLGVSEPNIQIEGQDRIRVQLAGVQDQQKAREMLSTQAKLTFRDVDDNLLMDGTDLKGGGAKQTFDEQGRASVGLTLKSAEKFREVTEKISKMPPPTNLMVIWLDFEEGKDSYKAESAKPNPKFLSAATVNQVFNQAEVSIVGGNFTVESAKQLSSLLNAGALPVDLKEMYSTSVGAKFGQQALEQTIFASAIGIALIFLFMLVFYRLPGLVAVIMLGLYIFVTLLVFNWMHAVLTLPGIAALVLGVGIAVDANIITYERLKEELKIGKSMMSAFRAGNHRSLATILDANVTTLAAAGVLFVYGNSSVKGFATSLIVSILVGFITNVFGTRFLLGLLVKSRYFDKKPGYFGVKQKDIIPLTKGVVHPPTRFDRINFVNIGHKFLIFSIVVVIAGAIILPIFKLNLGIDFASGTRIDLQSKQAVTVSDVHKDFKELNIDVKEENIVPTGDDNKGFAVRTLGVLSKDEIAKTKTFFHDKYGTDPNVSTVSPTIGKEIARNAFIAVLIASAVIILYVSIRFRFTYALSAVLALLHDAFVMIVMFSIFQLEVDLTFIAAVLTIIGYSINDSIVTFDRNRELYKQKKRVRDIKDLEEIVNASIRQTLGRSINTVLTVLFPVIALLIFGSESLRNFSFALLVGLIVGTYSSVFVASQIWLMLENRRLKKGKNKKKVEKVESEPQV
>NZ_AP014864.1|WP_000857712.1|1149324_1149966_-|RsfA-family-transcriptional-regulator
MKTRQDAWTKEDDLLLAETVLRHIRSGSTQIKAFDEVGDALNRTSAACGFRWNAEVRPNYEDAVQLAKKQRKELKRSEANIEKNRFTKTKQLVIDADFSEDIMPSKQDLTMQNVISFLQNLEHNNPSLAKLQTENDVLQAQLTSLQKTNHELETKLAVLTKKQQAIEEDYAMLVRIMDRARKLVSVEEQEEQIAPIFKTDQNGNLDIIYSAEN
>NZ_AP014864.1|WP_000812943.1|1150003_1151290_-|replication-associated-recombination-protein-A
MKQPLAHRMRPTNIQEIIGQQHLVGEGKILWRMVQANHFQSMILYGPPGTGKTSIASAIAGSTGTPFRLLNAVTHNKKDMEVVVQEAKMHRHLVLILDEVHRLDKAKQDFLLPHLESGLLTLIGATTSNPFHAINSAIRSRCQIFELHALTEEDILIGLKRALEDKEKGLGEYAVTVTDEALHHFANASGGDMRSAYNALELAVLSSFTTDDQAAEITLEIAEECLQKKSFVHDKGGDAHYDVLSAFQKSVRGSDVNAALHYLARLIEAGDLQSIGRRLLIMAYEDIGLASPQAGPRTLAAIESAERVGFPEARIPLANAVIELCLSPKSNSAYKALDAALHDLRNGQTGDIPSHLKDSHYKGAESLGRGIGYLYPHDHPNGWVRQQYLPDKIKSKQYYKPKTTGKFEQALSTVYERLQTSNKTKNKG
>NZ_AP014864.1|WP_000704116.1|1151583_1152000_+|Rrf2-family-transcriptional-regulator
MKISTKGRYGLTIMIDLAKKFGEGPISLKSIAQAHDLSEHYLEQLISPLRNARLVKSTRGAYGGYVLSDQPANITAGDVIRVLEGPISVVEMIEEEEPAQRQLWMRVRDAVQEVLDSTTLEDLVRYEEENHGGYMFYI
>NZ_AP014864.1|WP_000439881.1|1152035_1153181_+|cysteine-desulfurase
MERIYLDHAATSPTHPEVVEKMIPYMTEIFGNPSSIHFYGRQTRHAVDEARRVCARSIHANPNEIIFTSGGTEADNLALIGVARANRHKGNHIITTQIEHHAILHTCELLEREGFEVTYLPVDETGLIQVSDIQKALTEETILVSVMFGNNEVGTMQPIVEIGKLLKDHQAYFHTDAVQAYGLVEINVKEFGIDLLSISAHKINGPKGVGFLYAGANVKFEPLLIGGEQERKRRAGTENVPSIAGLQHAILIAEKTREQKNAQYEEFKDIMVSVFKNEGITFEVNGNLEHRLPHVLNVSFTGMNIEPFLVNLDLAGIAVSSGSACTAGSIDPSHVLVAMFGKDSDQIRSSVRFSFGLGNTKEQIEKAAYETVKIVKRLTQN
>NZ_AP014864.1|WP_060851700.1|1153197_1154313_+|tRNA-2-thiouridine(34)-synthase-MnmA
MNKLPHETRVVIGISGGVDSSVAALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYNDVIEVCNQIGIPYYAVNFEKQYWDKVFTYFLDEYRAGRTPNPDVMCNKEIKFKAFLEHAIALGADYVATGHYARVAYMDGEYKMLRGVDDNKDQTYFLNQLSQEQLSKTMFPLGELKKPQIREMAKEAGLATAAKKDSTGICFIGERNFKDFLSNYLPAQPGVMQTLSGEVKGKHDGLMYYTIGQRHGLGIGGNGDPWFAVGKNLKENILYVDQGFHNELLYGDEVIATNVGWVSNKEKETEFKCTAKFRYRQEDNKVTVQIVDENTVRILCDEPIRAITPGQAVVFYDGDECLGGATIDEVYRSGKKLDYLG
>NZ_AP014864.1|WP_000066409.1|1154422_1155082_+|tetratricopeptide-repeat-protein
MSNKLETGIQYMQEGNWEEAAKNFTEAIEENPKDALGYINFANLLDVLGDSERAILFYKRALELDDKSAAAYYGLGNVYYGQEQFTEAKAVFEQAMQAGLQSADVTFMLGITHVQLGNDRLALPFLQRATELDENDVEAVFQCGLCFARLEHVQEAKPYFEKVLEMDEEHADAYYNLGVAYVFEENNEKALALFKKATEIQPDHFLAGNGVRLLEQEAE
>NZ_AP014864.1|WP_000528082.1|1155177_1157514_+|ATP-dependent-RecD-like-DNA-helicase
MGNQHAMDLFEEEKKFIKAQVLHTIFHNEENLYSVVSMKVIETNETYDEKKVMINGHFPRMHEDEVFTLTGHFKDHPKYGKQYMVETFKKELPQTKAGMVQYLASDLFKGIGKRTAEKIVDHLGEHAISKIMDDPEALNGVVNKQKAQEIYETIVEHQGLEKVMSFLNGYGFGTKLSIKIYQQYKEMTLEVIRNNPYQLIEEVDGIGFGRADDIGRALGISGNHDDRVRAGCFYTLENVSLQLGHVYMRKDQLVRETMSLLNNQEGRVTEEDIIGCIETMQSEGKVIIEEERVYLATLFYSEKGVVKSIRRLMNQEETPSFPEAEVLKTLGEIEEQLNVQYAPFQQEAIQTALHKPMMLLTGGPGTGKTTVIKGIVEMYASLHGLSLNPNEYSDDNPFPILLTAPTGRAAKRMSESTGLPACTIHRLLGWTPEGSFQRNETDPVQGKLLIIDEFSMVDIWLANQLFKSLPTNIQVIVVGDEDQLPSVGPGQVLKDLLNAGAVPTVKLTEIYRQAEGSSVIQLAHAIKNGTLPPDLAQNKKDRSFISCTGAQIVEVVKKVCENAKTKGFSARDVQVLAPMYRGPAGINVLNEALQQVFNPKREKSKEIAYGDVVYRRGDKVLQLVNQPESQVFNGDIGEIVSVFYAKENVEQQDMIIVSFDGIEVTYTKPDLNQITHAYCCSIHKSQGSEFPIVIMPIVKSYNRMLRRNLIYTGITRSKKFLIICGEEAAFQSGVNRLDDAMRQTTLASRLQESQGEVQMVTVNGEEMDVENISPYDFM
>NZ_AP014864.1|WP_000469281.1|1157641_1157830_+|hypothetical-protein
MFICPNCKGKDIGKIGVNQFYCWNCYIELSVSKGKIHTHQVEEDGSLSSLDDLFDENERTIG
>NZ_AP014864.1|WP_001053553.1|1157848_1157977_+|YrzQ-family-protein
MNLRNSLIALGVGAAAYQYARKQDVFSKRNMKKARKMIKSYL
>NZ_AP014864.1|WP_000242533.1|1158023_1158236_-|hypothetical-protein
MVLFMLGLSAIFMILEWICIGFGIWKGFFIHSSRKEKAKQLWQYGILGVGCYGLSYLFSEIGLFYLHMGA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_AP014864_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_AP014864_2

2250361-2250471

Orphan

Consensus_repeat	Method
GTAGGACCAGTTATTCCGATTCCGGTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_AP014864_2

>merge|NZ_AP014864|2|2250361-2250471|CRISPRCasFinder
GTAGGACCAGTTATTCCGATTCCGGTAGGACCTGTAACCCCAGTAGGACCAGTTATTCCGATTCCGGTAGGACCTGTAACCCCAGTAGGACCAGTTATTCCGATTCCGGTA

>NZ_AP014864|2|2|2250361-2250471|CRISPRCasFinder
GTAGGACCAGTTATTCCGATTCCGGTA	GGACCTGTAACCCCAGTAGGACCAGTTATTCCGATTCCGGTAGGACCTGTAACCCCA
GTAGGACCAGTTATTCCGATTCCGGTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_AP014864.1\|WP_000403894.1\|2255712_2256606_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_AP014864.1\|WP_000771162.1\|2257427_2257904_+\|DUF2690-domain-containing-protein	unknown	unknown	gnl\|CDD\|371292
NZ_AP014864.1\|WP_000902408.1\|2258780_2259269_-\|DinB-family-protein	unknown	unknown	gnl\|CDD\|368313
NZ_AP014864.1\|WP_001244202.1\|2244246_2245293_+\|agmatine-deiminase-family-protein	unknown	unknown	gnl\|CDD\|377332
NZ_AP014864.1\|WP_000476405.1\|2248239_2249781_+\|alpha-amylase	unknown	unknown	gnl\|CDD\|236518
NZ_AP014864.1\|WP_000287978.1\|2241493_2242315_+\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133382
NZ_AP014864.1\|WP_000709178.1\|2237392_2238550_+\|agmatine-deiminase-family-protein	unknown	unknown	gnl\|CDD\|377332
NZ_AP014864.1\|WP_060851880.1\|2258016_2258553_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_AP014864.1\|WP_000233820.1\|2239311_2240244_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226304
NZ_AP014864.1\|WP_000473741.1\|2256897_2257410_+\|DUF2690-domain-containing-protein	unknown	unknown	gnl\|CDD\|371292
NZ_AP014864.1\|WP_000256470.1\|2253162_2253687_+\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|225695
NZ_AP014864.1\|WP_000645274.1\|2254623_2255589_-\|quinone-oxidoreductase	unknown	unknown	gnl\|CDD\|176189
NZ_AP014864.1\|WP_000916574.1\|2238713_2239130_+\|phosphate-starvation-inducible-protein-PsiE	unknown	unknown	gnl\|CDD\|235075
NZ_AP014864.1\|WP_000129185.1\|2247244_2248036_-\|arylamine-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366312
NZ_AP014864.1\|WP_001081123.1\|2259461_2259917_+\|DinB-family-protein	unknown	unknown	gnl\|CDD\|378981
NZ_AP014864.1\|WP_001254972.1\|2242396_2244139_+\|amidohydrolase	unknown	unknown	gnl\|CDD\|238625
NZ_AP014864.1\|WP_001095187.1\|2251254_2253156_+\|mannonate-oxidoreductase	unknown	unknown	gnl\|CDD\|234750
NZ_AP014864.1\|WP_060851878.1\|2240473_2241451_+\|agmatine-deiminase-family-protein	unknown	unknown	gnl\|CDD\|377332
NZ_AP014864.1\|WP_001042044.1\|2253847_2254558_+\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366010
NZ_AP014864.1\|WP_000137533.1\|2245339_2247127_-\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071

Protein	Function_ID	Function_description	E-value
NZ_AP014864.1\|WP_000403894.1\|2255712_2256606_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	9.70454e-61
NZ_AP014864.1\|WP_000771162.1\|2257427_2257904_+\|DUF2690-domain-containing-protein	gnl\|CDD\|371292	pfam10901, DUF2690, Protein of unknown function (DUF2690). This bacterial family of proteins has no known function.	1.59251e-18
NZ_AP014864.1\|WP_000902408.1\|2258780_2259269_-\|DinB-family-protein	gnl\|CDD\|368313	pfam05163, DinB, DinB family. DNA damage-inducible (din) genes in Bacillus subtilis are coordinately regulated and together compose a global regulatory network that has been termed the SOS-like or SOB regulon. This family includes DinB from B. subtilis.	7.06884e-18
NZ_AP014864.1\|WP_001244202.1\|2244246_2245293_+\|agmatine-deiminase-family-protein	gnl\|CDD\|377332	pfam04371, PAD_porph, Porphyromonas-type peptidyl-arginine deiminase. Peptidyl-arginine deiminase (PAD) enzymes catalyze the deimination of the guanidino group from carboxy-terminal arginine residues of various peptides to produce ammonia. PAD from Porphyromonas gingivalis (PPAD) appears to be evolutionarily unrelated to mammalian PAD (pfam03068), which is a metalloenzyme. PPAD is thought to belong to the same superfamily as aminotransferase and arginine deiminase, and to form an alpha/beta propeller structure. This family has previously been named PPADH (Porphyromonas peptidyl-arginine deiminase homologs). The predicted catalytic residues in PPAD are Asp130, Asp187, His236, Asp238 and Cys351. These are absolutely conserved with the exception of Asp187 which is absent in two family members. PPAD is also able to catalyze the deimination of free L-arginine, but has primarily peptidyl-arginine specificity. It may have a FMN cofactor.	1.45897e-124
NZ_AP014864.1\|WP_000476405.1\|2248239_2249781_+\|alpha-amylase	gnl\|CDD\|236518	PRK09441, PRK09441, cytoplasmic alpha-amylase; Reviewed.	0
NZ_AP014864.1\|WP_000287978.1\|2241493_2242315_+\|MerR-family-transcriptional-regulator	gnl\|CDD\|133382	cd01107, HTH_BmrR, Helix-Turn-Helix DNA binding domain of the BmrR transcription regulator. Helix-turn-helix (HTH) multidrug-efflux transporter transcription regulator, BmrR and YdfL of Bacillus subtilis, and related proteins; N-terminal domain. Bmr is a membrane protein which causes the efflux of a variety of toxic substances and antibiotics. BmrR is comprised of two distinct domains that harbor a regulatory (effector-binding) site and an active (DNA-binding) site. The conserved N-terminal domain contains a winged HTH motif that mediates DNA binding, while the C-terminal domain binds coactivating, toxic compounds. BmrR shares the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.	1.07811e-29
NZ_AP014864.1\|WP_000709178.1\|2237392_2238550_+\|agmatine-deiminase-family-protein	gnl\|CDD\|377332	pfam04371, PAD_porph, Porphyromonas-type peptidyl-arginine deiminase. Peptidyl-arginine deiminase (PAD) enzymes catalyze the deimination of the guanidino group from carboxy-terminal arginine residues of various peptides to produce ammonia. PAD from Porphyromonas gingivalis (PPAD) appears to be evolutionarily unrelated to mammalian PAD (pfam03068), which is a metalloenzyme. PPAD is thought to belong to the same superfamily as aminotransferase and arginine deiminase, and to form an alpha/beta propeller structure. This family has previously been named PPADH (Porphyromonas peptidyl-arginine deiminase homologs). The predicted catalytic residues in PPAD are Asp130, Asp187, His236, Asp238 and Cys351. These are absolutely conserved with the exception of Asp187 which is absent in two family members. PPAD is also able to catalyze the deimination of free L-arginine, but has primarily peptidyl-arginine specificity. It may have a FMN cofactor.	2.805e-116
NZ_AP014864.1\|WP_060851880.1\|2258016_2258553_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	6.14338e-33
NZ_AP014864.1\|WP_000233820.1\|2239311_2240244_+\|hypothetical-protein	gnl\|CDD\|226304	COG3781, COG3781, Predicted membrane protein [Function unknown].	5.98761e-79
NZ_AP014864.1\|WP_000473741.1\|2256897_2257410_+\|DUF2690-domain-containing-protein	gnl\|CDD\|371292	pfam10901, DUF2690, Protein of unknown function (DUF2690). This bacterial family of proteins has no known function.	3.50796e-18
NZ_AP014864.1\|WP_000256470.1\|2253162_2253687_+\|N-acetyltransferase	gnl\|CDD\|225695	COG3153, COG3153, Predicted acetyltransferase [General function prediction only].	1.8543e-55
NZ_AP014864.1\|WP_000645274.1\|2254623_2255589_-\|quinone-oxidoreductase	gnl\|CDD\|176189	cd05286, QOR2, Quinone oxidoreductase (QOR). Quinone oxidoreductase (QOR) and 2-haloacrylate reductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. 2-haloacrylate reductase, a member of this subgroup, catalyzes the NADPH-dependent reduction of a carbon-carbon double bond in organohalogen compounds. Although similar to QOR, Burkholderia 2-haloacrylate reductase does not act on the quinones 1,4-benzoquinone and 1,4-naphthoquinone. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	1.76082e-153
NZ_AP014864.1\|WP_000916574.1\|2238713_2239130_+\|phosphate-starvation-inducible-protein-PsiE	gnl\|CDD\|235075	PRK02833, PRK02833, phosphate-starvation-inducible protein PsiE; Provisional.	1.99531e-45
NZ_AP014864.1\|WP_000129185.1\|2247244_2248036_-\|arylamine-N-acetyltransferase	gnl\|CDD\|366312	pfam00797, Acetyltransf_2, N-acetyltransferase. Arylamine N-acetyltransferase (NAT) is a cytosolic enzyme of approximately 30kDa. It facilitates the transfer of an acetyl group from Acetyl Coenzyme A on to a wide range of arylamine, N-hydroxyarylamines and hydrazines. Acetylation of these compounds generally results in inactivation. NAT is found in many species from Mycobacteria (M. tuberculosis, M. smegmatis etc) to man. It was the first enzyme to be observed to have polymorphic activity amongst human individuals. NAT is responsible for the inactivation of Isoniazid (a drug used to treat Tuberculosis) in humans. The NAT protein has also been shown to be involved in the breakdown of folic acid.	1.67266e-47
NZ_AP014864.1\|WP_001081123.1\|2259461_2259917_+\|DinB-family-protein	gnl\|CDD\|378981	pfam12867, DinB_2, DinB superfamily. The DinB family are an uncharacterized family of potential enzymes. The structure of these proteins is composed of a four helix bundle.	6.92304e-19
NZ_AP014864.1\|WP_001254972.1\|2242396_2244139_+\|amidohydrolase	gnl\|CDD\|238625	cd01300, YtcJ_like, YtcJ_like metal dependent amidohydrolases. YtcJ is a Bacillus subtilis ORF of unknown function. The Arabidopsis homolog LAF3 has been identified as a factor required for photochrome A signalling.	4.9095e-122
NZ_AP014864.1\|WP_001095187.1\|2251254_2253156_+\|mannonate-oxidoreductase	gnl\|CDD\|234750	PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed.	7.68453e-161
NZ_AP014864.1\|WP_060851878.1\|2240473_2241451_+\|agmatine-deiminase-family-protein	gnl\|CDD\|377332	pfam04371, PAD_porph, Porphyromonas-type peptidyl-arginine deiminase. Peptidyl-arginine deiminase (PAD) enzymes catalyze the deimination of the guanidino group from carboxy-terminal arginine residues of various peptides to produce ammonia. PAD from Porphyromonas gingivalis (PPAD) appears to be evolutionarily unrelated to mammalian PAD (pfam03068), which is a metalloenzyme. PPAD is thought to belong to the same superfamily as aminotransferase and arginine deiminase, and to form an alpha/beta propeller structure. This family has previously been named PPADH (Porphyromonas peptidyl-arginine deiminase homologs). The predicted catalytic residues in PPAD are Asp130, Asp187, His236, Asp238 and Cys351. These are absolutely conserved with the exception of Asp187 which is absent in two family members. PPAD is also able to catalyze the deimination of free L-arginine, but has primarily peptidyl-arginine specificity. It may have a FMN cofactor.	2.50941e-17
NZ_AP014864.1\|WP_001042044.1\|2253847_2254558_+\|histidine-phosphatase-family-protein	gnl\|CDD\|366010	pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members.	3.42128e-40
NZ_AP014864.1\|WP_000137533.1\|2245339_2247127_-\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0

>NZ_AP014864.1|WP_000476405.1|2248239_2249781_+|alpha-amylase
MFKRITIVGLSVVMFLPSIYEGSKAYADTVNNGTLMQYFEWYAPNDGNHWNRLRTDAENLAEKGITSVWIPPAYKGTTQNDVGYGAYDLYDLGEFNQKGTVRTKYGTKAQLKSAIDALHKKNIDVYGDVVMNHKGGADYTETVTAVEVDPNNRNNEVSGDYEISAWTGFNFPGRGDSYSNFKWKWYHFDGTDWDEGRKLNRIYKFRGIGKAWDWEVSSENGNYDYLMYADLDFDHPDVANEMKKWGTWYANELNLDGFRLDAVKHIDHEYLRDWVNHVRQQTGKEMFTVAEYWQNDIQTLNNYLAKVNYNQSVFDAPLHYNFHYASTGNGNYDMRNILKGTVVANHPTLAVTLVENHDSQPGQSLESVVSPWFKPLAYAFILTRAEGYPSVFYGDYYGTKGNSNYEIPALKDKIDPILTARKNFAYGTQRDYFDHPDVIGWTREGDSVHANSGLATLISDGPGGAKWMDVGKNNAGEVWYDITGNQTNTVTINKDGWGQFQVSGGSVSIYVQQ
>NZ_AP014864.1|WP_000129185.1|2247244_2248036_-|arylamine-N-acetyltransferase
MTDFQKQFFARLHIEEKDTVLFEDLSNIMYAMAQTVPFENLNILEKNFKEISKENLKEKILVNNRGGLCYELNPTMYYFLKDSGFDVHLVSGTVYNAANSIWAVDSGHIATVLTHHNELYLIEVGFGSYLPLAPVPFSGEVIHSATGDYRIRKEMTEKGNYILEMRKNNEFLDQSAADDWTLGYAFYIEEVDEEKANTAQKIIVEHEGSPFNKVPLIVKLTEDGHASLTKDSLTVAKNGKKTKETVTDMQYTNLLHSKFGITL
>NZ_AP014864.1|WP_000137533.1|2245339_2247127_-|oligoendopeptidase-F
MTELKDRLQVADIEKWDLTDIYHTIEDWESDFHKIEVLTKELHEFNGNIHDGNSLLAYLTKSEEISSIISLMFAYARLQSDLDTRDTDAQSLVDKVSQLHVKVSAAKSFFSPFLLSIDESTLHSYIEETEGLQYYKEDLFELYRYKKHVLNKDQEAILSQMGEALSSPQHTFGMLNNADILFGEVTTDDGEKVNLTRGMYAKLIEDTNREKRKEAYKAYYKPYVQLKNSIASTLSAAIKNNVTVSKLRNYPSALEKSLFGDMVPKEVYENLIDTTKKNIQTLHTYNEIRKEKLNVDELRQYDLGVDLVEGAKQDIPYSEAFDIMIASLAPLGEEYIETLKSFKDKRYIDVRETPGKRSGAYNFGVYGIHPFILLNHHDDLNSLFTLTHECGHGMHTHYSHGYQPRISAHYSIFVAEVASTVNEVLLIHYLLKEAKETNVRNHLVNHFIEKFKGTFFTQIMFAEFEKITHEMAEQGKPLNAQVFSEIYEKLFKEYNGDSLVFDEEVKYGWARIPHFYRPFYVYKYATGFASAIQIADKLLSGDPNAQKNYIEFLKGGSSDYPLNLLKKAGVDLTTPEPIESALKQFTQLVEEFSTL
>NZ_AP014864.1|WP_001244202.1|2244246_2245293_+|agmatine-deiminase-family-protein
MRNIENSLYYMPAEWEKHEGTWLQWPHDKAHRGEGYRAKLDDIWISMAKELHYGENVHIVVCDEEEKIHVQSKLMEANVNMDKIDFLIQETDDIWIRDNGPIFVTDKEGNRCLTHWIFNGWGDKYPYENDANIPNKISEMYRIPKVESSVCLEGGGIEINGNGTLMAAKTSIINENRNPTLSQKEIEIELTKYLGVTNFIWITGIRGEDNYDEDTDYHIDGAARFVNENTILYEYDPFGEGEPYLLEAYEKHYQELRQAKNIDGKPFQLIPVPVTRKVVKEADCKGSYLNFYIGNEVVLVPIYGDEHDKLGLQIIEGQFPGRRIVGIYVNELYAYGGMIHCVTQQHIE
>NZ_AP014864.1|WP_001254972.1|2242396_2244139_+|amidohydrolase
MRRTIMIICLVLSMVWISACTAGVGEGESGSAVLPSQLPKNVVFKNGTIYTSNEKQDIVEAVAVKEGKIIFVGSNKDVEEFINEDTKVVDLQGRFILPGFVDNHNHIFEAKSPAAGNCSVSPDASLQKQRSYLKACKKGVKDGEWISGTGFSLEALLKDMDEKSEQQTPLQVLDELFPNNPVLIMERTSHSVWVNSKALELAGINKDTKDPQGGRIIRDSETGEPFGILYDTAGDIVMEKAWNSQPNLFEKNYEGLLDGLDEVAKNGITTVGDGRLYWKRGWLDVWNKVNDEKKLTSRVVLRPWVYPNLNEAEQMEYFKKIKRDDVSSRMLINQVKMYSDGISINSTAKTLEKYKFEWFTGTPYGLNYIPEEKMKWWLTELNKIGYGALIHTIGDAGVRESLNAIEAAKKEGANQPYTLTHVEMVEDSDIDRFAKLGISADFQVGHDFAEDPKQSWASTYFTNQQMKRIMPLGRIWKTGANVSLSSDWDVNELNPLVTISNALSIDEKGLSDVYAAIDAYTIKPAKALGLDNITGSIEVGKSADMVLLNEDITKMSADKIPNAKVLVTVLQGEVVYHKEK
>NZ_AP014864.1|WP_000287978.1|2241493_2242315_+|MerR-family-transcriptional-regulator
MYTIAEFSRICKMSTRMLRHYDKEEILKPAYVNPVNGYRYYEQEQLEVALKIKKLREYKFPLPKIKIVLQSSDQDSFVQHIQSQIIELSHEVKQNLQVISEMNEMVKVNSSLNIARHRNYDILMGMRNEVTIITQRVKIDIDDMDDYFYDLYEEVQKNNFQIVGSPSAVFYDEEYIPSNSDIELRIPVMQGNDEDVAQEYEMKQLSPHHIVTTMHYGSYDYIGYAYIALEEWIERNGYVIINSPYEVYIKGPECDCLAEEYVTQICFLVTKIE
>NZ_AP014864.1|WP_060851878.1|2240473_2241451_+|agmatine-deiminase-family-protein
MEQKHNGIIFTAIPDESNEYYQPFYEDLIYFNECLNEKKSIADQLISLSVEEQDFHTSCFEYDDIWLRDVAPVVTNHLVKFKYRPNYLPDDQGRYLDQQFNKWLKKNDFEYVKSPLILDGGNLIWNKKDTVILTERIFDDNDDWTEEEIIEQLEWDLDVSRVIIIPAEDGDVLAHADGMVKFIDEHTMFISDFLGDHEFRYSVQEIIQEQMPEAEFIVVPSSYTEKGQYDQEIASAKGLYINMLESCDALYVPKFGLAKDEEVLRYIQQYTEKQVIQIHVGEISTMGGAMNCLTWYCPSHLLSSKMRRLKNQNEDFSMKKIFDWF
>NZ_AP014864.1|WP_000233820.1|2239311_2240244_+|hypothetical-protein
MVHYNNQNSLHQIFTLKGTIIRDIFPQIVLYTCISTIVAVINYYYTEININQTPWVIVGGALGLLLVFRTNTAYDRYWEGRKLFGAIGACTRNLAISFLCHWDSKGKSMEQEKIKFLHLLIAFPKLAKGHLREEKDLSEVKSLLAVCSEKEKAFLVESNHLPISIVFMLKTILSKGLKTGQIHPNAIISMETDLNTLLTSVGGCDRIKTTPIPFAYFAHIKILLIIFCATLPIGLVDSLGWFTVLATTFISFAFIGIEAIGVEIEDPFGQDPNDLPLEGICIGVEAHLVNLYNQNDLLEVMGLNLDKKII
>NZ_AP014864.1|WP_000916574.1|2238713_2239130_+|phosphate-starvation-inducible-protein-PsiE
MLKNFKIVFSYFPIVLQYILNVALICLGVVLSVFLMKEVIQFMQELKLDGNESSYHLIDSIVVFFLYFEFIVMIIKYFQMNFHFPLRYFIYIGITAIVRLIIIDHDSPLDLLLYACAIFVLISALFIANSKMMRRDLE
>NZ_AP014864.1|WP_000709178.1|2237392_2238550_+|agmatine-deiminase-family-protein
MKKAIKFCLIATLSTTIISGCSFEGNNENVKGKEGEKVEVQKNAGKYTMPDEKDKHEGTWLQWPHEYTYGEEYKKEVEPIWVKMASALTEGEKVHIVAYDQEEKERINNLLTDEGLNMEKIDFFIAPTDDVWARDSGPIFVYDSNKNLKILDPAFNGWGKKTPYKNDAQIRKNVSKQSGIERIDWGKFVLEGGAIELDSNGTALLTRSAVTNKNRNPDLSEKEIEKYISDLGVSNFIWLDGVPNLDITDFHIDGFAKFHNKSTIVTMKEDDLAEWGLSNKDMDTLLDAKNASGQKYKYEYLPLSKEKVALENGKTLDYKGSYINYYIGNTVVLVPNYNDPNDKIANDTIQKLYPDRKVVGIDVRELYKNGGMIHCVTQQQPIALK
>NZ_AP014864.1|WP_001095187.1|2251254_2253156_+|mannonate-oxidoreductase
MNTMTFEKLQYNELKDIVKSYCVSGLGKELLNKLEPSTSIKVVRNRLNETTEARAILDAEGHVPFFGISNIASTIQKLEKGMILDPEELVSVSDFLRGCRKIKKFMLDKEFFAPVLASYANSMTEYKSIEEEINFSIKGNSIDAAASKELKRIRNNIDSVDGKIKERLTKFLNSSANKKFIQEFFISKKDDRYTIPIKSSYKNQVAGSIIEASAKGSTVFIEPHTVTKLNAELAGLKAEEAVEEYQILATLSGMVLENIYSIKINMELISQYDMVFAKAKFSKSIDGIEPKLNDHGYIHLVNCKHPLLTGQVVPLNFKIGQEYRSLIITGPNAGGKTIVLKTIGLLTLATMSGLHIAGDKGTEIAIFENVFVDIGDNQSIENALSTFSSHMKNLSEIMRMSNNNTLLLFDEIGSGTEPNEGAALAISILEELYFAGCITVASTHYGEIKRFSEMHDDFMNAAMQFNSETLEPLYKLVIGKSGESNALWIANKMNVKEHVLKRAKEYMGNKEYALEKVNESKIRKPKFVQEKRESHYEYKIGDRVNLLDHDDFGIIYKEKDNFYNVVVYYNGEFVEVNVKRITLEVAAKELYPEGYDLNTLFVDYKERKMQHDIERGSKKALRKIQKEIRKNRG
>NZ_AP014864.1|WP_000256470.1|2253162_2253687_+|N-acetyltransferase
MVTIRQEQKNDYRKTEEVVKEAFLKEEFSDKTEHELVKRIRECDAFVPELSIVAVDEDIVGHIMLSKITIEQDGTSVESLALAPVSVARGHQKKGIGGKLIVAALEKAKELGYGSVVVLGHPEYYPKFGFKKASEWNIKAPFEVPEEVFMIMELTENSLRGVKGIVQYSSAFAE
>NZ_AP014864.1|WP_001042044.1|2253847_2254558_+|histidine-phosphatase-family-protein
MNKRETDSNENAVTLYVTRHGKTILNTNHRAQGWADSPLVEKGVEVATNLGTGLKDIHFMNAYSSDSGRAIETANLVLKYSEQSKLKLEQRKDLRELNFGIFEGEKLENMWDVVGKAAGVASPEELMKFSIQEVINLIRVADPTKQAEDWELFSTRIKAEIDKISEEAAGNGGGNVLVVVHGLLITTLIEMLDSSKTKLGVENASVTKIVYQDGTYTVESVGDMSYVAKGKESVEI
>NZ_AP014864.1|WP_000645274.1|2254623_2255589_-|quinone-oxidoreductase
MKALCFETFGDANVLHYKEIHNPIISPNEILVRTKAIGLNFADIYRRRGDYHLAGNPPYVLGYEGAGIVEKVGADVTTINLGDRIAFADVPFANAELVAVPSEKVIPLPDSISFETAASVLLQGLTAHYLTHDSYQLKQGDIALVHAAAGGVGQLLIQMIKLQGGTVIGLTSSKEKAKIATLAGADHVFLYTEAWHMKVLEMTNGTGVNVVYESVGSTLGESFNATKIGGTVVFYGMAGGNPAPVDPRMLMDTSKTLTGGDLWNVLTTYEERKKRSTQLFDWIATGKLNISNPTTFSLQDGALAHELLESRKSTGKILLIP
>NZ_AP014864.1|WP_000403894.1|2255712_2256606_+|LysR-family-transcriptional-regulator
MEIKQLITFKVAAHTLNFTQTAKKLNFAQSSVTAQIKTLEAELGTPLFERLGKRLFLTEAGRKFQLYADKMIALSNEAKMAVKDDEEIAGTLIIGAQESQCTYRLPSILKKFKAQFPQIKLIFKPAHSNKDAKEQLMEGKVDLAFILDECKTEDVLHVEPLMKEELKVVAAPTHRLLEQPSVSIKDLESETLLLTELGCSYRTLFEELFRGEDVYPANKIEFVSVEAIKQCVIADLGIAILPAIVVEKDIREGTLKELMLNETISPIYTQIAWHKDKWMTAPLQQFIDVTREFFTTD
>NZ_AP014864.1|WP_000473741.1|2256897_2257410_+|DUF2690-domain-containing-protein
MFKKLMKVCVLSAASVGVLFSFQGSTFAATDLSSYYDGKNPATTKVYGGSTTCDADGFNAKSTAVYEGSKKVGTVYLRYSNKCHAAWAKFVLDQPAPAVSGGVYAYAVVNKYKNGVFQKSVTSNQGNGTIKTGQTSTYTGMVFDLTADFGYTADAEAVTFNNGYGKTARY
>NZ_AP014864.1|WP_000771162.1|2257427_2257904_+|DUF2690-domain-containing-protein
MKLLKKTSACLLLSLLVVTSMFSTTNSDKAYAEDHSYDGKSPYYNSCDQSAVTKEKKWIDSNSYVELKFSTTCKTAWAKVTVTRLAVYNNEADARIVRKTDGKAYTCGSAGGNGVVNKGQTSCYTPMVYDLDPRKAQAQGKHAIPNSDAYNYAETIWY
>NZ_AP014864.1|WP_060851880.1|2258016_2258553_-|GNAT-family-N-acetyltransferase
MRLESERIYLRPLCQLDAPIILESTMDDEIRYMTGTKSTFSLEQITKHIDHINNDSSRYDFAICLQSTDKMIGELSILDIDEENKRAGFRISMLSIALTGQGYGTEAIKIVLRFVFEQLSLNRLQLEVFSHNLRGIKAYKKVGFVKEGTLRQSLFYNDTYSDEIIMAILKSDYIGRPL
>NZ_AP014864.1|WP_000902408.1|2258780_2259269_-|DinB-family-protein
MLHILKQQYNLISSTRETLFSFLEEIPVEKLHSTVSNFGSGSIIKTHIHVADCYRYWLGSFAFKQKRADFSFASDYEIEHADVEKVRARFKLVDETVQRFLDEYNDRWLENIANEVKWQKEPWSTTPLWLLTHTETHEFHHKGQIVSMARHLGYTPPDTDLS
>NZ_AP014864.1|WP_001081123.1|2259461_2259917_+|DinB-family-protein
MNRLVGLKQFEITRGALLKFMETLDDKTVDTQPEGFNNTIRWHIGHVLTAAETFMFGREFKQLPTEYPGMFGYGSRPSKWTTEGPSLEVLTAQLKEQAKRINEIPAEAFENKLPEPFLGLETVGELYGMMLYHEADHIGQMKAMERIIKAL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_AP014864_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_AP014864_3

2846579-2846744

Orphan

Consensus_repeat	Method
AGGAATGAATATTCATTCCGAAACAAAAGTAAA	PILER-CR

2 spacers

The CRISPR arrays of NZ_AP014864_3

>merge|NZ_AP014864|3|2846579-2846744|PILER-CR
AGGAATGAATATTCATTCCTAAATAGAATTAAAAAATGAGAGTAGGAGAGGGTATTTGTGCAACTAAAGGAATGAATATTCATTCCGGAAAGACTAGTTTAATAGAGTTTACAAAATAATGTAATAGAATAATAGGAATGAATATTCATTCCGTAACTAACGTAAA

>NZ_AP014864|3|1|2846579-2846744|PILER-CR
AGGAATGAATATTCATTCCTAAATAGAATTAAA	AAATGAGAGTAGGAGAGGGTATTTGTGCAACTAA
AGGAATGAATATTCATTCCGGAAAGACTAGTTT	AATAGAGTTTACAAAATAATGTAATAGAATAATAGGAATGAATATT
CATTCCGTAACTAACGTAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_AP014864.1\|WP_000664630.1\|2843189_2844479_+\|3-phosphoshikimate-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|235037
NZ_AP014864.1\|WP_000364215.1\|2856125_2856536_+\|DUF1878-family-protein	unknown	unknown	unknown
NZ_AP014864.1\|WP_001273575.1\|2838428_2839505_+\|bifunctional-3-deoxy-7-phosphoheptulonate-synthase/chorismate-mutase	unknown	unknown	gnl\|CDD\|183614
NZ_AP014864.1\|WP_000997702.1\|2833499_2833937_-\|YndM-family-protein	unknown	unknown	gnl\|CDD\|371204
NZ_AP014864.1\|WP_060852020.1\|2834118_2837601_+\|DUF4020-domain-containing-protein	unknown	unknown	gnl\|CDD\|372518
NZ_AP014864.1\|WP_060852022.1\|2847795_2848830_+\|exosporium-leader-peptide-containing-protein	unknown	unknown	gnl\|CDD\|223003
NZ_AP014864.1\|WP_001228137.1\|2842071_2843172_+\|prephenate-dehydrogenase	unknown	unknown	gnl\|CDD\|235824
NZ_AP014864.1\|WP_000169374.1\|2851374_2852682_+\|group-II-intron-reverse-transcriptase/maturase	RT	pfam00078_RT_CAS-I:CAS-III	gnl\|CDD\|275209
NZ_AP014864.1\|WP_000633864.1\|2860009_2861635_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|237894
NZ_AP014864.1\|WP_000709539.1\|2832818_2833349_+\|cysteine-hydrolase	unknown	unknown	gnl\|CDD\|238496
NZ_AP014864.1\|WP_060852024.1\|2864192_2864867_-\|TerC-family-protein	unknown	unknown	gnl\|CDD\|163429
NZ_AP014864.1\|WP_000116992.1\|2856684_2858115_+\|IS4-family-transposase	unknown	unknown	gnl\|CDD\|376573
NZ_AP014864.1\|WP_000808770.1\|2862162_2864136_+\|LTA-synthase-family-protein	unknown	unknown	gnl\|CDD\|224287
NZ_AP014864.1\|WP_001100928.1\|2844604_2845762_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|226925
NZ_AP014864.1\|WP_000637705.1\|2864977_2865640_-\|DUF3841-domain-containing-protein	unknown	unknown	gnl\|CDD\|378997
NZ_AP014864.1\|WP_001107309.1\|2845991_2846558_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|292911
NZ_AP014864.1\|WP_001053969.1\|2853478_2854915_-\|IS4-like-element-IS231C-family-transposase	unknown	unknown	gnl\|CDD\|376573
NZ_AP014864.1\|WP_001269425.1\|2839787_2840960_+\|chorismate-synthase	unknown	unknown	gnl\|CDD\|171518
NZ_AP014864.1\|WP_001197280.1\|2840978_2842079_+\|histidinol-phosphate-transaminase	unknown	unknown	gnl\|CDD\|134568
NZ_AP014864.1\|WP_000364215.1\|2849252_2849663_+\|DUF1878-family-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_AP014864.1\|WP_000664630.1\|2843189_2844479_+\|3-phosphoshikimate-1-carboxyvinyltransferase	gnl\|CDD\|235037	PRK02427, PRK02427, 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional.	0
NZ_AP014864.1\|WP_001273575.1\|2838428_2839505_+\|bifunctional-3-deoxy-7-phosphoheptulonate-synthase/chorismate-mutase	gnl\|CDD\|183614	PRK12595, PRK12595, bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed.	0
NZ_AP014864.1\|WP_000997702.1\|2833499_2833937_-\|YndM-family-protein	gnl\|CDD\|371204	pfam10710, DUF2512, Protein of unknown function (DUF2512). Proteins in this family are predicted to be integral membrane proteins, and many of them are annotated as being YndM protein. They are all found in Firmicutes. The true function is not known.	8.18943e-46
NZ_AP014864.1\|WP_060852020.1\|2834118_2837601_+\|DUF4020-domain-containing-protein	gnl\|CDD\|372518	pfam13212, DUF4020, Domain of unknown function (DUF4020). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, and is typically between 176 and 195 amino acids in length.	3.97626e-73
NZ_AP014864.1\|WP_060852022.1\|2847795_2848830_+\|exosporium-leader-peptide-containing-protein	gnl\|CDD\|223003	PHA03169, PHA03169, hypothetical protein; Provisional.	1.36807e-08
NZ_AP014864.1\|WP_001228137.1\|2842071_2843172_+\|prephenate-dehydrogenase	gnl\|CDD\|235824	PRK06545, PRK06545, prephenate dehydrogenase; Validated.	2.3201e-159
NZ_AP014864.1\|WP_000169374.1\|2851374_2852682_+\|group-II-intron-reverse-transcriptase/maturase	gnl\|CDD\|275209	TIGR04416, hypothetical_protein, group II intron reverse transcriptase/maturase. Members of this protein family are multifunctional proteins encoded in most examples of bacterial group II introns. These group II introns are mobile selfish genetic elements, often with multiple highly identical copies per genome. Member proteins have an N-terminal reverse transcriptase (RNA-directed DNA polymerase) domain (pfam00078) followed by an RNA-binding maturase domain (pfam08388). Some members of this family may have an additional C-terminal DNA endonuclease domain that this model does not cover. A region of the group II intron ribozyme structure should be detectable nearby on the genome by Rfam model RF00029. [Mobile and extrachromosomal element functions, Other].	9.945e-139
NZ_AP014864.1\|WP_000633864.1\|2860009_2861635_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|237894	PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional.	0
NZ_AP014864.1\|WP_000709539.1\|2832818_2833349_+\|cysteine-hydrolase	gnl\|CDD\|238496	cd01014, nicotinamidase_related, Nicotinamidase_ related amidohydrolases. Cysteine hydrolases of unknown function that share the catalytic triad with other amidohydrolases, like nicotinamidase, which converts nicotinamide to nicotinic acid and ammonia.	1.25857e-63
NZ_AP014864.1\|WP_060852024.1\|2864192_2864867_-\|TerC-family-protein	gnl\|CDD\|163429	TIGR03717, R_switched_YjbE, integral membrane protein, YjbE family. Rfam model RF00080 describes a structured RNA element called the yybP-ykoY leader, or SraF, which may precede one or several genes in a genome. Members of this highly hydrophobic protein family commonly are preceded by a yybP-ykoY leader, which may serve as a riboswitch. From the larger group of TerC homologs (pfam03741), this subfamily contains protein YjbE from Bacillus subtilis. A transport function is proposed.	3.86116e-74
NZ_AP014864.1\|WP_000116992.1\|2856684_2858115_+\|IS4-family-transposase	gnl\|CDD\|376573	pfam01609, DDE_Tnp_1, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. This family contains transposases for IS4, IS421, IS5377, IS427, IS402, IS1355, IS5, which was original isolated in bacteriophage lambda.	1.62725e-17
NZ_AP014864.1\|WP_000808770.1\|2862162_2864136_+\|LTA-synthase-family-protein	gnl\|CDD\|224287	COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane].	0
NZ_AP014864.1\|WP_001100928.1\|2844604_2845762_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|226925	COG4552, Eis, Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only].	9.55809e-71
NZ_AP014864.1\|WP_000637705.1\|2864977_2865640_-\|DUF3841-domain-containing-protein	gnl\|CDD\|378997	pfam12952, DUF3841, Domain of unknown function (DUF3841). This presumed domain is around 190 amino acids in length. As yet no function has been given to any member of the family.	3.22882e-33
NZ_AP014864.1\|WP_001107309.1\|2845991_2846558_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|292911	pfam16295, TetR_C_10, Tetracycline repressor, C-terminal all-alpha domain.	8.56994e-64
NZ_AP014864.1\|WP_001269425.1\|2839787_2840960_+\|chorismate-synthase	gnl\|CDD\|171518	PRK12463, PRK12463, chorismate synthase; Reviewed.	0
NZ_AP014864.1\|WP_001197280.1\|2840978_2842079_+\|histidinol-phosphate-transaminase	gnl\|CDD\|134568	PRK01533, PRK01533, histidinol-phosphate aminotransferase; Validated.	0
NZ_AP014864.1\|WP_001053969.1\|2853478_2854915_-\|IS4-like-element-IS231C-family-transposase	gnl\|CDD\|376573	pfam01609, DDE_Tnp_1, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. This family contains transposases for IS4, IS421, IS5377, IS427, IS402, IS1355, IS5, which was original isolated in bacteriophage lambda.	5.01379e-28

>NZ_AP014864.1|WP_001107309.1|2845991_2846558_+|TetR/AcrR-family-transcriptional-regulator
MAKNKQEDIFDAAMQLFAERGYDGTTIPMIAEKANVGAGTIYRYFENKEALVNSLFSKSMLQLSEMIKTDFPVEANIREQFSHTYNRLFEFARNNVDAFLFTNSHCDSYFLDEQSKKIFDDFIGFFMNIIEDGIAKGLLRPLPPVALIIIVYQPLEKLTKVIATGQLEYSKELVKELEESSWNAIRII
>NZ_AP014864.1|WP_001100928.1|2844604_2845762_+|GNAT-family-N-acetyltransferase
MNVIQLKEDKFREALRLSEYAFQYKVDEERLQQQLTKMKESHEVYGIMEGEDLAAKLHLIPFHIYIGKEKFKMGGVAGVATYPEYRRSGYVKELLQHSLQTMKKDGFTVSMLHPFAVTFYRKYGWELCANLLVCHLTKSDLVMKKQVNGTVKRFNKENHPEEVEKLYETFAEHFSGMLVRNEKWWLQAVYEDLTLAIYYDENKSAAGYMLYKIENYKMTVDEFVPLHNEARNGLWNFICQHDSMIKELEMTVSENEQLLYTLQEPRVKTEIKPYFMGRIVDVEQFLKQYELNWNNVQQEVILHITDSFAPWNNVSVRLANYEIAIIEEPMDKGIKLDINALSTILLGYKRPLELNELELISGSEEEIRAFENVVPVRKPFIYDFF
>NZ_AP014864.1|WP_000664630.1|2843189_2844479_+|3-phosphoshikimate-1-carboxyvinyltransferase
MKERTIQPVNNGLNGNITIPGDKSISHRAVMFGSIAEGKTTIKGFLPGADCLSTISCFKEMGVEITQNGDEVTVVGKGLEGLQEPKAVLDVGNSGTTIRLMSGILANTPFFSCVQGDESIAKRPMKRVTNPLKQMGANIDGREEGTFTPLTIRGGDLKAIEYISPVASAQVKSAILLAGLRAEGVTAVTEPHISRDHTERMLEAFGVKVTREGKTVKLSGGQKLTATDIQVPGDVSSAAFFLVAGAIIPNSKLVLQNVGMNPTRTGIIDVLEKMGATFTVDLINEGASEPAANITIETSSLKGIEIGGDIIPRLIDEIPVIALAATQAEGITVIKDAHELKVKETNRIDTVVAELTKLGARIEATDDGMIIYGKSALKGNTVNSYGDHRIGMMLAIAGCLAEGKTIIEDAEAVGVSYPTFFDELQKLAK
>NZ_AP014864.1|WP_001228137.1|2842071_2843172_+|prephenate-dehydrogenase
MRKKVVLIGTGLIGGSLALAIKKEHDVTITGYDIFQEQVERAKELHVVDEIAVDLQHACEEAHLIVFASPVEETKKLLHKLASFRLREDVIVTDVGSTKGTIMNEAETLFSKEVSFIGGHPMAGSHKTGVESAKAHLFENAFYILTPMHHVPNEHVEELKDWLKGTGSHFLVLNTEEHDYVTGIVSHFPHLIAAGLVKQVEKHAGDNPLIHQLAAGGFKDITRIASSSPKMWSDIVKQNREHLMVLLKEWISEMEDLYKTVSTGDACEIQNYFADAKEYRDSLPVRKRGAIPAYHDLYVDVLDKVGALAHITSILAREEISITNLQILEAREGLLGVLRISFQREEDRMKAKLALGEEEYQTYETI
>NZ_AP014864.1|WP_001197280.1|2840978_2842079_+|histidinol-phosphate-transaminase
MQVKDQLSSLQPYKPGKSPEQMKEVYGDHSFVKLASNENPFGCSSRVLDELQKSWLEHALYPDGGATTLRQTIADKLHVKMEQVLCGSGLDEIIQIISRAVLRAGDNIVTAGATFPQYRHHAIIEGCEVKEIALNNGVYDLEEISSVVDNDTKIVWICNPNNPTGTYVNDRKLTQFIEGISENTLIVIDEAYYEYVTAKDFPETLPLLEKHKNILVLRTFSKAYGLASFRVGYAVGQEELIEKLNVVRLPFNVSSLAQKAATIAFGDDEFIEEIVRVNTEGLQQYESFCRENDIPFYPSQTNFIFLPVENAGEIYEACAHAGFIIRPFPNGIRITVGTREQNEGVISVLQQHFENKKRKSRDEENA
>NZ_AP014864.1|WP_001269425.1|2839787_2840960_+|chorismate-synthase
MRYITAGESHGPQLTVILEGVPAGLTLTAEHINKELLRRQKGHGRGRRMQIETDTVEIVSGVRHGMTLGSPITLIVKNDDFKHWTKVMGAEPISEKESKDMKRTITKPRPGHADLNGAIKYGHRDIRNVLERSSARETTVRVAAGAVAKQILSELGVEIAGHVLEIGGVKAKHISNLSIEEIQTITENSPVRCLDKEVEQEMMNAIDNAKSSGDSIGGIVEVIAEGMPIGVGSYVHYDRKLDAKLAGAIMSINAFKGAEIGVGFEAARQPGSKVHDEILWDEEKGYTRRTNNAGGLEGGMTTGMPIIVRGVMKPIPTLYKPLASVDIDTKEAFQASIERSDSCAVPAAGVVAESVVAWELADALVEQFGKDRMELLKQNIMQHNNYAKEF
>NZ_AP014864.1|WP_001273575.1|2838428_2839505_+|bifunctional-3-deoxy-7-phosphoheptulonate-synthase/chorismate-mutase
MANHELDQLRKQVDEINLQLLHLLNKRGEIVQKIGEQKQVQGTKRFDPVREREVLDMIAEHNEGPFETSTVQHIFKTIFKASLELQEDDNRKALLVSRKKKQENTIVDVKGELIGNGTQTFIMGPCAVESLEQVRQVGQAMKDQGLKLMRGGAFKPRTSPYDFQGLGVEGLQILRQVADEFDLAIISEILNPNDVEMALDYVDVIQVGARNMQNFDLLRAVGKVNKPVLLKRGLAATIDEFINAAEYIIAQGNDQIILCERGIRTYERATRNTLDISAVPILKKETHLPVIVDVTHSTGRRDLLLPTAKAALAIGADAVMAEVHPDPAVALSDSAQQMDIPEFHRFMDELKGFKNKLS
>NZ_AP014864.1|WP_060852020.1|2834118_2837601_+|DUF4020-domain-containing-protein
MWITSEVEIPDELIDHLEQGKLVLFVGAGVSMKGKSNLPNFDDLVDEIAKTLYVEKREITEPHDYYFGKIAKTKDVHQVARDLVHIEKSKPNPLHYAIPRLFPLDTDIRIVTTNFDQHFTTAIKEINRDINVYYAPALPTGRAFKGLAYIHGNVEQEKEALILTDGDFGRAYLTEGWARRFLVDLFSNYTVLFVGYSHNDPVMKYLATGLPPSTRRFAFVAQGENTYHWEHLGIRPIVYPNKVNNHQSLVKAVKRWAELMGDNYITKRMRIRDIVTVPPSVEQEQLSYIKQSIKKIETVRYFVEFAHDYEWVEWLEVEGKLQNLFMLTPNYNEVDELLAEWLVEQFLFSHQKELFQLIYKNYSKISPLLWRTICNYLTETKSKMDPLLFARWTLLLLETAEKDSSSIEKISKLLQKCSFPEHKEIALLILTFILDGKLKLKRVRKWGNDTQESIELEESSRLPVSTFSHVEQIWNEKMRPYIAYYAVPIMMIGLEKLRMLSLRQTALKKRNKENIEKEFHQNDLVFLIRIVKECLTYLCKNNEKKADYYITEMIEANSVLQKQIAIDAMNKNIFVRVDDKMKWLLHEGLLLDFTYKHEVFQLLKRHYAHCLEKTKEEVTRTVIKHLTEERVFDACLVLDLLFKCDSNSPSTANGYELMKQKHPHFHSERYSVQKKEDTEQSITCNVTADGLLQLKDVEIMKQVQQFSQDRVLEQRHFLEMLSKACKLNTEWSISFAYQLVGVQEISNEVWFVCIREWRNNRGLTNDQIQKIIPLLQKFVRNTAFHWLISSFLYEISNRLEELEENSIRVVKRFAFSVFPQVMKSDTDFKLGKQDFYNESIQHPVGKMTAVLLKLLSYDHLYDRNVYEYLFLFEEQVRVNSERTNFMFARLIADITFLYHIEKQWCRKYLLPYLDLKKQNEITEYAWAGLCYTQINLPLFTEMKRFIKYAVEHLEVLHPHTREAFLKWLSFVFIKCVLYWEQKTDWLYPLLILENEENKIKFMQFLCYYVKTLSVKEQQKFWTAWLSVFLRERPKMGEITAREYVMLLRIILYMDEILEKGLCIMSRTFSSVHGKCTGEEMKRLLIEMLHKKESMKAHKEMFANVFFILLQTCHEAVLFEKEIIQIKELLVQYKVEEYVLHLLENEIIRIGIVMGDLQKEL
>NZ_AP014864.1|WP_000997702.1|2833499_2833937_-|YndM-family-protein
MNDFTVVLIKFISCIIAFSIGLALFFPATFVQIISFSLFVTIVSYMFVDKIILNRIGNTGAIMSDFLLTYLSVWIFGNILLDNYMQIAWGSILSAIVFTLSEVIVHRFSNSHTRHNNDNIRINRRFAYGTEFAEEQNILDKDKKK
>NZ_AP014864.1|WP_000709539.1|2832818_2833349_+|cysteine-hydrolase
MKKALIVIDVQAGMYTAGMPVHNGGKFLQTLQELIRECRSNDIPVIYIQHNGPKDHPLEKGTDGWRIHAAIAPQEGDNIVEKTTPDSFHNTNLSEVLQEKGIEHVILSGMQTEYCVDTTTRRACSEGYKVTLVSDAHSTFNTEVLRAEDIVKHHNAVLGAFADVVAVKDLKVAASK
>NZ_AP014864.1|WP_060852022.1|2847795_2848830_+|exosporium-leader-peptide-containing-protein
MSNKSEKYSKWLDSYDFLSAGAFDPSLVGPTLSPIPPFTLPTGPTGVTGPTGDTGPTGVTGPTGVTGPTGDTGATGPTGATGPTGDTGPTGDTGPTGDTGPTGVTGPTGDTGPTGDTGPTGDTGPTGDTGPTGDTGPTGATGPTGDTGPTGDTGPTGVTGPTGDTGPTGDTGPTGVTGATGETEGCLCDCCVLPMQNVLQQLIGETVLLGTIADAPNVPPLFFLFTITSVSDFLVTVTDGTTSFVVNISDVTGVGFLPPGPSITLLPPVDLGCECDCRERPIRELLDTLIGSTVNLLANTGSTAADFNVEQTGLGIVLGTLPISPNTIVRFAISTCKITAVNIL
>NZ_AP014864.1|WP_000364215.1|2849252_2849663_+|DUF1878-family-protein
MDLIKEVTLLRYQFRLMQSMIQSDEFPFYRFVIDHEFEEEQVNALRNISIAFHDRLTREEVSIFAQNDHLFSKFKLPLDMLYSPEKPNLDEFKLYITKIFYQEFELKYLLLSLKKQCIFVNVCDYLLEQLKMNNNV
>NZ_AP014864.1|WP_000169374.1|2851374_2852682_+|group-II-intron-reverse-transcriptase/maturase
MTKTPITLQELRQRIYRKAKSEPTHRFWGLFTHITKMTTLHEAYQQARKNNGAPGIDGKSFADIELEGVIPFLTGIQEELQAGIYRPQSNRKVEIPKANGKMRTLQIPCIRDRVVQGALKLILEAIFEADFCPNSYGFRPKRSPHQALAEVRRSILRRMTIIIDVDLSRYFDTIRHNILLEKIAKRVQDPQVMHLVKQVIKAAGKIGVPQGGPFSPLAANIYLNEVDWTFDAIRRKTAEGNYEAVNYHRFADDIVIAVSGHSSKSGWAELALRRLWEQLKPLGVELNLEKTQMINVLKGESFGFLGFDLRRIPNRNKNGFFVFMIPKKKARTTVKAKIRELIQNAGAKPAQDLIKQINAVLTGWVNYFRIGNSSQAFSEVRDYTEMKIRTLLTRRKRRRKRSIGWQRWSNEYLYGVLGLYWDWKVLPLKSAESFR
>NZ_AP014864.1|WP_001053969.1|2853478_2854915_-|IS4-like-element-IS231C-family-transposase
MNLSIQDELQLFSEELYRHLTPSLLEELAKELGFVKRKRKFSGNELATICIWVSQRTASDSLVRLCSQLHAATGTLMSPEGLNKRFDKKAVEFLKYIFSALWKSKLCKTSAISSAALTYFQRIRILDATIFQVPKHLAHVYPGSGGCAQTAGIKIQLEYDLHSGQFLNFQVGPGKNNDKTFGTDCLDTLRPGDLCIRDLGYFSLEDLDQMDQRGVCYISRLKLNHTVYTKNPFPEYFRNGTIKKQSQYIQVDLENIMHTLKPGQTYEIKESYIGKNQRLFTRVIIYRLTEEQILERRKKQSYTESKKGITFSEKSKRLTGINIYVTNTPWEVVPMEQIHDFYSLRWQIEIIFKTWKSLFQIHHWQTIKQERLECHVYGKLIAIFICSSTMFKMRQLLLQKHKRELSEYKAIGMIQDHLSLLYQAIQRNTRIITKVLIRLFTLLKKNGRKSHRYEKKTIFDIMGVVYEYNGLRKQKKAA
>NZ_AP014864.1|WP_000364215.1|2856125_2856536_+|DUF1878-family-protein
MDLIKEVTLLRYQFRLMQSMIQSDEFPFYRFVIDHEFEEEQVNALRNISIAFHDRLTREEVSIFAQNDHLFSKFKLPLDMLYSPEKPNLDEFKLYITKIFYQEFELKYLLLSLKKQCIFVNVCDYLLEQLKMNNNV
>NZ_AP014864.1|WP_000116992.1|2856684_2858115_+|IS4-family-transposase
MSVSVSDELQLFAQEIQSFLSPNTLRDLARDVGFVQRTSKYQAKDLVALCIWMSQNIATTSLAQLSSCLESSTEVLISPEGLNQRFNTSAVQFLQHILTNLLNKKLTSSMPLSSPYTSVFKRIRILDSTAFQLPDIFSTIYPGAGGCSHTAGMKIQLEYDLLSGQFLHIHTGPGKQHDRTYGSLCVPTVTPNDLCIRDLGYFHLKDLQHIQDKKAYYISRIKSNTRIYQKNLTPDYFQDGRIKKGTEYIQIDMEVLMNSLQPGQTYEISDAYVGMTDKVPTRVIVHRLTDEQQQKRLQDQAVREKKKGIKYSPRSKRLSGINVYMTNTSTDTVPMGQVHDWYSLRWQIEILFKTWKSFFHIHHCKKIKRERLECHLYGQLIAILLCSSTMFQMRQLLLMKKKRELSEYKAIYMIRDYFFLIYQAIQKDTQELSKILIRLFNLLQQNGRKSHRYEKKTVFDILGVVYNSTISEDQAA
>NZ_AP014864.1|WP_000633864.1|2860009_2861635_+|ATP-binding-cassette-domain-containing-protein
MITVSNVSLRFADRKLFEDVNIKFTPGNCYGLIGANGAGKSTFLKILSGEIEPSTGDIHITPGERLAVLKQNHFEYEEFPVLETVIMGHTQLYKVMQEKNAIYMKEDFSDEDGMRAAELEGEFAELNGWEAESEAAILLKGLGIGEDLHDKKLSELTGAEKVKVLLAQALFGQPDILLLDEPTNHLDLKAIQWLENFLMNFENTVIVVSHDRHFLNKVCTHMADLDFGKIQLYVGNYDFWYESSQLALKLTQDANKKKEEKVKELQNFIARFSSNASKAKQATSRKKLLDKITLDDIRPSSRRYPFVGFTPEREVGNDLLTVEGLSKTIDGEKVLDNVYFTLNKGDKVAFIGRNDIAMTTLFKILMGEMEPDSGSFKWGVTTSQSYFPRDNSKYFENSDYNLVEWLRQFSPQDESESFLRGFLGRMLFSGEEVKKNVSVLSGGEKVRCMLSKMMLSGANVITLDDPTNHLDLESITALNNGLIAFKGTILFTSHDHQFVQTIANRIIEVTPNGVIDKEATYDEFLENEELQKQVDAMYKGQ
>NZ_AP014864.1|WP_000808770.1|2862162_2864136_+|LTA-synthase-family-protein
MKQFLLKSKSVLSNHFGFFLFAVILLWLKTYAAYVTEFNLGISNTIQKFLLFFNPLSSAVLFLGLALFAKGKRSYIWLIIINLLLSILLYANVVYYRFFSDFITFPTLTQTNNFGDLGGSILALLHLYDPLYFLDTIILIVLVATKFANPKPIRVAKHKLSLVFVAGILLFSVNLGLAESDRPELLTRTFDRNYIVKYLGAYNYTIYDGIQSAKASTERALADGDNMTEVRNYLTSTYASPNPEYFGKGKGMNVIYIHLESFQNFLIDYKLNGQEVTPFLNSFTKDANTLYFDNFFHQTGQGKTSDAEFMLENSMFGLPQGSVFTTKSHNTYQSAPAILGQQGYTSAVFHGNYKTFWNRDDIYKSFGFNKFFDASYYDMNEKDVVNYGLKDKPFFNESIPLLQTLKQPFYTKFITLSNHFPYPIDKAEATIEPATTGDSSVDTYFQTARYLDESVKGFIDYLKQSGLYDNSIIVMYGDHYGISDNHNAAMSKVMGKEMNSFENAQLQRVPLIVRVPGVKGGVQHQYGGEIDVLPTLLHLLGTDTKNYVQFGSDLLSPDHKQVVAFRNGNYVSPTVTALNGKYYDTTTGKPVEFTDEIKKNEQMVQNSLKYSDQVVNGDLLRFYTPEGFTPVDRSKYNYNNRDKNKTKVKTTPEGEAK
>NZ_AP014864.1|WP_060852024.1|2864192_2864867_-|TerC-family-protein
MDFLSAEYLSALLAIIVIDLVLAGDNAIVIGLAARRLPKDQQKKVIIWGTIGAIAIRALATLVVVWLLKIPGLLLIGGVLLIWIAYKLIAEGKDHDIKAEEGFWSAIKTIIIADALMGIDNVLAVAGAAHGNFSLVIIGLLVSIPVVVWGSTLILKWVDRFPVIITIGAAVLAYTAAKMIVDEKWFAGFFESNPFVKWAFIIIIIISVVFFGKAKQKATAGSVS
>NZ_AP014864.1|WP_000637705.1|2864977_2865640_-|DUF3841-domain-containing-protein
MIVYTVQTEEAWKQFKKLGYLEGNKEFIDPDDVYSYDWMVRVAKTRLPHYEGNYPIWVWEANNYPNRNHKAWGRTNSKMVILTLDVPKEWVLWSYFDYWCCAMTDGSTYLHTKNKCTLDEWYTYMDKEYGIIFDFDYLLSHPDWCLGKEDSLEKQGVIGKTPLSFVKKVRRFRAKTDKSISKIRSDNWDNRKENRIKKMNRKLRKRNDKQKRIQKRLIRN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_AP014864_1	1.1\|1149151\|56\|NZ_AP014864\|CRISPRCasFinder	1149151-1149206	56	NZ_AP014864.1	1149110-1149165	1	0.982

1. spacer 1.1|1149151|56|NZ_AP014864|CRISPRCasFinder matches to position: 1149110-1149165, mismatch: 1, identity: 0.982

tcgttgatatattgcaagttgtgatagatatatttgaaaaatcgttgatatattgc	CRISPR spacer
tcgttgatatattgtaagttgtgatagatatatttgaaaaatcgttgatatattgc	Protospacer
**************.*****************************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

899 : 52293

Streptococcus_phage(11.11%)

transposase,integrase,holin,protease,tRNA

attL 768:783|attR 5486:5501

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
768:783	attL	NA	NA	NA	NA
WP_000727738.1\|899_1676_+\|integrase	YidC family membrane integrase SpoIIIJ	NA	NA	NA	NA
WP_000111516.1\|1672_2290_+	protein jag	NA	NA	NA	NA
WP_000393754.1\|2516_3893_+\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE	NA	NA	NA	NA
WP_000541031.1\|3939_5829_+\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
5486:5501	attR	NA	NA	NA	NA
WP_001019628.1\|5850_6570_+	16S rRNA (guanine(527)-N(7))-methyltransferase RsmG	NA	NA	NA	NA
WP_000799016.1\|6675_7548_+	nucleoid occlusion protein	S5VTK0	Leptospira_phage	9.1e-16	36.4
WP_113303242.1\|7711_8500_+	sporulation initiation inhibitor protein Soj	Q8JL10	Natrialba_phage	6.3e-24	29.7
WP_001051830.1\|8492_9344_+	stage 0 sporulation protein Spo0J	I3NLC2	Bifidobacterium_phage	2.5e-18	34.4
WP_001020714.1\|9364_9961_-\|protease	spore protease YyaC	A0A0A8WIQ6	Clostridium_phage	2.1e-24	39.4
WP_000364814.1\|10220_11102_+	mechanosensitive ion channel family protein	NA	NA	NA	NA
WP_060851485.1\|11122_11320_+	DUF951 domain-containing protein	NA	NA	NA	NA
WP_060851486.1\|11435_12536_+	redox-regulated ATPase YchF	NA	NA	NA	NA
WP_001233778.1\|12727_13018_+	30S ribosomal protein S6	NA	NA	NA	NA
WP_000981966.1\|13044_13557_+	single-stranded DNA-binding protein	A0A290GHL8	Caldibacillus_phage	7.9e-52	63.5
WP_000918873.1\|13602_13836_+	30S ribosomal protein S18	NA	NA	NA	NA
WP_000814838.1\|13915_14851_+	YybS family protein	NA	NA	NA	NA
WP_001113785.1\|14929_16903_+	DHH family phosphoesterase	NA	NA	NA	NA
WP_000864228.1\|16899_17346_+	50S ribosomal protein L9	NA	NA	NA	NA
WP_001286148.1\|17373_18735_+	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	6.6e-122	52.8
WP_000100238.1\|18950_20240_+	adenylosuccinate synthase	L7Y4J5	Megavirus	6.6e-71	36.6
WP_000971865.1\|21034_21742_+	cell wall metabolism DNA-binding response regulator WalR	W8CYM9	Bacillus_phage	7.6e-45	42.7
WP_000755367.1\|21745_23587_+	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	8.9e-37	35.0
WP_000061560.1\|23583_24900_+	hypothetical protein	NA	NA	NA	NA
WP_000383740.1\|24880_25723_+	two-component system regulatory protein YycI	NA	NA	NA	NA
WP_000522837.1\|25706_26501_+	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	6.1e-43	35.3
WP_000008033.1\|26564_27740_+\|protease	serine protease	W5SAB9	Pithovirus	1.0e-09	31.9
WP_001052827.1\|27793_27979_+	CxxH/CxxC protein	NA	NA	NA	NA
WP_001027000.1\|28038_28518_+	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_060851487.1\|29605_31042_+\|transposase	IS4-like element IS231C family transposase	NA	NA	NA	NA
WP_000713633.1\|32490_33369_+	radical SAM protein	NA	NA	NA	NA
WP_000800228.1\|33408_35226_-	oligoendopeptidase F	A0A1X9I5X5	Streptococcus_phage	7.5e-121	39.2
WP_000432447.1\|35362_36346_-	GMP reductase	G3MBI2	Bacillus_virus	3.4e-160	84.7
WP_000039350.1\|36821_38267_+	ATP-dependent RNA helicase DbpA	A0A1V0SBR7	Catovirus	4.5e-60	34.4
WP_000427879.1\|38307_38868_-	DUF1836 domain-containing protein	NA	NA	NA	NA
WP_000995363.1\|39032_39680_+	hemolysin III family protein	NA	NA	NA	NA
WP_000996541.1\|39864_40881_+	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	3.6e-96	51.6
WP_000542575.1\|41326_41917_+	acetamide transporter	NA	NA	NA	NA
WP_002026638.1\|42016_42904_+	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_000094042.1\|42992_43619_-	superoxide dismutase [Mn]	Q56AR7	Bacillus_thuringiensis_phage	6.9e-58	53.7
WP_000047627.1\|43836_44907_+	nitric oxide synthase oxygenase	NA	NA	NA	NA
WP_001242442.1\|45267_46836_+	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	4.3e-16	23.9
WP_001103412.1\|46888_48187_-	MFS transporter	NA	NA	NA	NA
WP_000933565.1\|48513_50283_+	two-component system sensor histidine kinase LytS	Q9EYF3	Enterobacteria_phage	1.3e-64	30.6
WP_000921843.1\|50260_51001_+	response regulator transcription factor	NA	NA	NA	NA
WP_000104901.1\|51133_51565_+\|holin	antiholin-like murein hydrolase modulator LrgA	NA	NA	NA	NA
WP_000168869.1\|51600_52293_+\|holin	antiholin-like protein LrgB	NA	NA	NA	NA

DBSCAN-SWA_2

316936 : 360556

Bacillus_phage(36.96%)

transposase,head,capsid,holin,protease,terminase,tail,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000926669.1\|316936_317572_-	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	8.1e-38	40.6
WP_000684725.1\|317808_318651_+	DegV family protein	A0A0N9SI50	Staphylococcus_phage	3.6e-17	40.3
WP_000400857.1\|318823_319138_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_060851522.1\|319286_320699_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	1.3e-11	39.8
WP_060851523.1\|320826_321228_+	hypothetical protein	NA	NA	NA	NA
WP_060851524.1\|321259_322615_-	recombinase family protein	A0A1B1P7M0	Bacillus_phage	7.9e-216	84.3
WP_060851525.1\|322633_323290_-	helix-turn-helix domain-containing protein	A0A1B1P7L1	Bacillus_phage	9.6e-119	96.3
WP_060851526.1\|323486_323723_+	helix-turn-helix transcriptional regulator	A0A2H4JE95	uncultured_Caudovirales_phage	2.8e-36	97.4
WP_060851527.1\|323735_323966_+	hypothetical protein	A0A1B1P7N2	Bacillus_phage	2.5e-21	71.4
WP_171840934.1\|323962_324115_+	hypothetical protein	A0A1B1P7M3	Bacillus_phage	8.4e-18	96.0
WP_165365583.1\|324130_324301_+	hypothetical protein	NA	NA	NA	NA
WP_016125194.1\|324394_324598_+	hypothetical protein	A0A1B2APY4	Phage_Wrath	4.9e-21	78.8
WP_016125193.1\|324597_324879_+	hypothetical protein	A0A1B2AQ09	Phage_Wrath	2.9e-40	86.0
WP_060851528.1\|324856_325405_+	host-nuclease inhibitor Gam family protein	A0A2H4JFX2	uncultured_Caudovirales_phage	7.3e-88	91.2
WP_060851529.1\|325410_326007_+	hypothetical protein	A0A1B2AQ10	Phage_Wrath	1.8e-92	90.9
WP_060851530.1\|326029_326962_+	AAA family ATPase	A0A2H4JFH2	uncultured_Caudovirales_phage	1.7e-89	53.9
WP_060851531.1\|326961_327396_+	DUF669 domain-containing protein	Q9ZXC5	Bacillus_phage	5.3e-49	64.1
WP_060851532.1\|327465_329853_+	DNA primase	A0A2H4JEX8	uncultured_Caudovirales_phage	0.0e+00	94.7
WP_060851533.1\|330150_330585_+	hypothetical protein	A0A2H4J832	uncultured_Caudovirales_phage	1.5e-75	95.8
WP_060851534.1\|330587_330965_+	hypothetical protein	H0USU9	Bacillus_phage	4.6e-33	56.4
WP_060851535.1\|330967_331507_+	ERCC4 domain-containing protein	A0A2H4J819	uncultured_Caudovirales_phage	4.7e-87	89.4
WP_060851536.1\|331540_331978_+	hypothetical protein	A0A2H4JBP0	uncultured_Caudovirales_phage	2.5e-62	83.4
WP_060851537.1\|332049_332268_+	hypothetical protein	NA	NA	NA	NA
WP_060851538.1\|332462_332858_+	sigma-70 family RNA polymerase sigma factor	A0A2H4JFW6	uncultured_Caudovirales_phage	3.7e-57	87.8
WP_081097609.1\|333003_333507_+	hypothetical protein	A0A1C8E9B7	Bacillus_phage	6.4e-22	57.0
WP_060851539.1\|333510_333792_+	hypothetical protein	A0A1C8EAA0	Bacillus_phage	2.6e-36	83.2
WP_060851540.1\|333788_334154_+	HNH endonuclease	A0A2H4JA38	uncultured_Caudovirales_phage	1.2e-41	63.6
WP_060851541.1\|334274_334709_+	hypothetical protein	A0A1B2APW6	Phage_Wrath	3.9e-68	94.4
WP_060851542.1\|334705_336430_+\|terminase	terminase large subunit	A0A1B2AQ28	Phage_Wrath	0.0e+00	94.9
WP_060851543.1\|336534_337740_+\|portal	phage portal protein	A0A1B2APW5	Phage_Wrath	1.5e-218	95.3
WP_060851544.1\|337708_338287_+\|head,protease	HK97 family phage prohead protease	A0A2H4J6Z9	uncultured_Caudovirales_phage	1.0e-84	82.0
WP_060851545.1\|338288_339650_+\|capsid	phage major capsid protein	A0A1B2APY9	Phage_Wrath	1.4e-180	86.1
WP_060851546.1\|339651_339912_+	hypothetical protein	A0A1B2APX3	Phage_Wrath	3.6e-29	70.9
WP_060851547.1\|339892_340225_+\|head	phage head closure protein	A0A2H4J220	uncultured_Caudovirales_phage	1.8e-25	54.5
WP_060851548.1\|340236_340593_+	HK97 gp10 family phage protein	D2XR21	Bacillus_phage	1.2e-30	57.8
WP_060851549.1\|340589_340922_+	hypothetical protein	D2XR22	Bacillus_phage	1.0e-47	87.3
WP_060851550.1\|340922_341513_+\|tail	phage tail protein	D2XR23	Bacillus_phage	6.5e-82	78.1
WP_000415929.1\|341517_341880_+	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	6.8e-42	70.0
WP_060851551.1\|342110_345743_+	hypothetical protein	A0A2H4JAI2	uncultured_Caudovirales_phage	7.3e-184	85.1
WP_060851552.1\|345784_347254_+\|tail	phage tail family protein	A0A0S2MV63	Bacillus_phage	9.7e-236	80.0
WP_060851553.1\|347250_352797_+\|tail	phage tail protein	A0A0S2MVB4	Bacillus_phage	0.0e+00	56.1
WP_042597362.1\|352812_353187_+	hypothetical protein	A0A0S2MVE0	Bacillus_phage	4.3e-63	93.5
WP_060851554.1\|353348_354560_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	4.4e-69	37.9
WP_060851555.1\|354825_355251_+\|holin	phage holin family protein	A0A0S2MVC4	Bacillus_phage	1.4e-65	89.4
WP_060851556.1\|355250_356180_+	N-acetylmuramoyl-L-alanine amidase	A0A0S2MVR5	Bacillus_phage	1.0e-158	85.5
WP_061186062.1\|356295_356466_+	hypothetical protein	A0A2H4J852	uncultured_Caudovirales_phage	2.4e-13	92.9
WP_060851557.1\|356726_356963_+	DNA-binding protein	A0A2H4JBQ8	uncultured_Caudovirales_phage	4.8e-20	66.2
WP_049106735.1\|357130_357463_-	hypothetical protein	A0A1B1P7R0	Bacillus_phage	3.1e-25	60.7
WP_060851558.1\|357523_358357_-	hypothetical protein	A0A2H4J6G7	uncultured_Caudovirales_phage	6.9e-122	82.9
WP_081097512.1\|359527_360232_+	ComF family protein	NA	NA	NA	NA
WP_001990088.1\|360358_360556_+	cold shock protein CspC	Q9AZD3	Lactococcus_phage	9.8e-19	67.7

DBSCAN-SWA_3

413488 : 478666

Staphylococcus_phage(16.67%)

holin,protease,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000673222.1\|413488_413857_+\|holin	CidA/LrgA family holin-like protein	NA	NA	NA	NA
WP_000078309.1\|413853_414546_+	LrgB family protein	NA	NA	NA	NA
WP_000557264.1\|414640_414874_+	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_000761976.1\|415035_415776_+	carboxylesterase	NA	NA	NA	NA
WP_000391087.1\|415918_418345_+	ribonuclease R	Q0GXV6	Lactococcus_phage	1.7e-91	40.6
WP_001123919.1\|418594_419062_+	SsrA-binding protein	W5RAM5	Staphylococcus_phage	5.4e-47	63.2
WP_000815812.1\|419944_420622_+	response regulator transcription factor	NA	NA	NA	NA
WP_060851561.1\|421006_422023_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000042077.1\|422042_423059_+	iron chelate uptake ABC transporter family permease subunit	A0A2H4IY97	uncultured_Caudovirales_phage	3.0e-58	36.8
WP_060851562.1\|423055_424120_+	iron chelate uptake ABC transporter family permease subunit	NA	NA	NA	NA
WP_000590071.1\|424116_424869_+	ATP-binding cassette domain-containing protein	NA	NA	NA	NA
WP_000576727.1\|425305_426844_+	anthrolysin O/cereolysin O family cholesterol-dependent cytolysin	NA	NA	NA	NA
WP_002164645.1\|427253_427619_+	YxeA family protein	NA	NA	NA	NA
WP_001053969.1\|428130_429567_-\|transposase	IS4-like element IS231C family transposase	NA	NA	NA	NA
WP_001034141.1\|429853_430819_-	DUF4822 domain-containing protein	NA	NA	NA	NA
WP_002164644.1\|431421_432378_+	NERD domain-containing protein	NA	NA	NA	NA
WP_000834710.1\|432427_432832_+	phosphate-starvation-inducible protein PsiE	NA	NA	NA	NA
WP_000076830.1\|432974_433490_+	spermidine N1-acetyltransferase	NA	NA	NA	NA
WP_060851563.1\|433926_435474_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	8.2e-52	29.2
WP_060851564.1\|435479_436673_+	MFS transporter	A0A2K5B2B5	Erysipelothrix_phage	7.0e-43	32.4
WP_060852514.1\|436853_437066_+	DUF3955 domain-containing protein	NA	NA	NA	NA
WP_000980930.1\|437145_437385_+	DUF3947 family protein	NA	NA	NA	NA
WP_000568587.1\|437415_437772_-	fluoride efflux transporter CrcB	NA	NA	NA	NA
WP_000639315.1\|437768_438173_-	fluoride efflux transporter CrcB	NA	NA	NA	NA
WP_000714050.1\|438519_439578_+	endonuclease	NA	NA	NA	NA
WP_060851565.1\|439610_441113_+	DUF4077 domain-containing protein	NA	NA	NA	NA
WP_085961003.1\|441171_442526_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	7.3e-129	85.5
WP_000573649.1\|442728_443124_+	SET domain-containing protein-lysine N-methyltransferase	NA	NA	NA	NA
WP_001057102.1\|443506_444424_+	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_001021108.1\|444793_446056_+\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	2.0e-88	42.4
WP_000043202.1\|446246_447425_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_001115309.1\|447469_447910_-	DUF1641 domain-containing protein	NA	NA	NA	NA
WP_000760481.1\|448342_448687_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002026553.1\|449060_450224_+	MFS transporter	NA	NA	NA	NA
WP_000793532.1\|450240_451080_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	2.9e-83	56.5
WP_060851566.1\|451188_452109_+	Cys-Gln thioester bond-forming surface protein	NA	NA	NA	NA
WP_060851567.1\|452681_455870_+	peptidase M60	NA	NA	NA	NA
WP_000689907.1\|455914_456553_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_001022930.1\|456857_458288_+	alanine:cation symporter family protein	NA	NA	NA	NA
WP_000346373.1\|458620_460063_+	alanine:cation symporter family protein	NA	NA	NA	NA
WP_085961003.1\|460131_461485_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	7.3e-129	85.5
WP_000673841.1\|461807_462989_+	pyrimidine nucleoside transporter NupC	NA	NA	NA	NA
WP_000673874.1\|463341_464523_+	pyrimidine nucleoside transporter NupC	NA	NA	NA	NA
WP_001076347.1\|464567_465737_-	DUF418 domain-containing protein	NA	NA	NA	NA
WP_000949403.1\|465887_466394_-	ferritin	NA	NA	NA	NA
WP_000355744.1\|466447_466771_-	hypothetical protein	NA	NA	NA	NA
WP_002026558.1\|466859_467423_+	TIGR00730 family Rossman fold protein	A0A1V0S9E9	Catovirus	4.4e-11	23.1
WP_000390910.1\|467527_467809_+	hypothetical protein	NA	NA	NA	NA
WP_000656312.1\|467824_468022_-	hypothetical protein	NA	NA	NA	NA
WP_001041894.1\|468596_469037_-	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	3.5e-48	65.1
WP_000124196.1\|469279_469480_-	hypothetical protein	NA	NA	NA	NA
WP_000227591.1\|469494_470928_-	alanine:cation symporter family protein	NA	NA	NA	NA
WP_001026075.1\|471337_471832_+	cation:proton antiporter regulatory subunit	NA	NA	NA	NA
WP_000380225.1\|471836_473036_+	cation:proton antiporter	NA	NA	NA	NA
WP_000900214.1\|473120_473714_+	DedA family protein	NA	NA	NA	NA
WP_000422806.1\|473851_474286_+	DUF3920 family protein	NA	NA	NA	NA
WP_000845467.1\|474395_474806_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_000488929.1\|474857_475556_+	pirin family protein	NA	NA	NA	NA
WP_000745123.1\|475712_477362_+\|protease	neutral protease NprB	NA	NA	NA	NA
WP_145977397.1\|477471_478666_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.6e-26	31.3

DBSCAN-SWA_4

518011 : 555883

Acinetobacter_phage(25.0%)

protease,coat,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_145977397.1\|518011_519206_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.6e-26	31.3
WP_001232993.1\|519646_520360_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_001180555.1\|520503_520689_+	hypothetical protein	NA	NA	NA	NA
WP_001002981.1\|520702_520951_+\|coat	spore coat protein	NA	NA	NA	NA
WP_145977398.1\|520947_522147_+	L-lactate dehydrogenase	NA	NA	NA	NA
WP_000666172.1\|522169_523183_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_000713769.1\|523242_523890_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_000826873.1\|524033_524561_+	hypothetical protein	NA	NA	NA	NA
WP_000218968.1\|524971_525337_+	arsenate reductase family protein	M1PLC0	Streptococcus_phage	5.1e-21	48.6
WP_000026897.1\|525378_525762_+	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_000640870.1\|526262_526607_+	hypothetical protein	NA	NA	NA	NA
WP_002008881.1\|526610_526919_+	thioredoxin family protein	NA	NA	NA	NA
WP_001242139.1\|527071_527416_+	hypothetical protein	NA	NA	NA	NA
WP_000601768.1\|527959_528985_+	methionine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-29	38.1
WP_000359401.1\|528977_529643_+	ABC transporter permease	NA	NA	NA	NA
WP_000735099.1\|529666_530479_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000757013.1\|530550_531357_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000929160.1\|531595_532381_+	Fe-S cluster assembly ATPase SufC	A0A285PWH2	Cedratvirus	1.3e-08	25.8
WP_000152167.1\|532396_533689_+	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_001020767.1\|533688_534909_+	cysteine desulfurase SufS	Q2XUY6	environmental_halophage	2.3e-118	47.6
WP_000009523.1\|534898_535330_+	iron-sulfur cluster assembly scaffold protein SufU	A0A0K1LS29	Mycobacterium_phage	1.5e-14	37.6
WP_001118827.1\|535378_536776_+	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_081097515.1\|537570_538962_+	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_000248466.1\|539027_539330_+	DUF1805 domain-containing protein	NA	NA	NA	NA
WP_000021803.1\|539384_540116_+	sporulation protein YunB	NA	NA	NA	NA
WP_000944663.1\|540189_541173_-	M23 family metallopeptidase	NA	NA	NA	NA
WP_000166372.1\|541362_542259_+	lipoyl synthase	NA	NA	NA	NA
WP_000272746.1\|542280_542760_-	YbaK/EbsC family protein	NA	NA	NA	NA
WP_000721022.1\|542834_543389_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_002164635.1\|543986_544802_-\|protease	YhfC family intramembrane metalloprotease	NA	NA	NA	NA
WP_000178775.1\|544902_545637_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_000744132.1\|545671_546250_-	YhcN/YlaJ family sporulation lipoprotein	NA	NA	NA	NA
WP_000435943.1\|546368_546671_+	DUF1027 domain-containing protein	NA	NA	NA	NA
WP_001174567.1\|546716_547214_-	hypothetical protein	NA	NA	NA	NA
WP_060851573.1\|547626_549096_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	G3MB42	Bacillus_virus	9.5e-66	38.8
WP_060851574.1\|549245_549512_-	DUF3055 domain-containing protein	NA	NA	NA	NA
WP_000439090.1\|549529_550501_-	class II fructose-bisphosphatase	NA	NA	NA	NA
WP_000274006.1\|550648_551089_+	DUF86 domain-containing protein	NA	NA	NA	NA
WP_000503345.1\|551169_551802_+	transcriptional regulator	NA	NA	NA	NA
WP_000276467.1\|551911_552676_+	TIGR01457 family HAD-type hydrolase	NA	NA	NA	NA
WP_000683451.1\|552821_553403_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_000575374.1\|553958_554774_-	HAD hydrolase family protein	NA	NA	NA	NA
WP_000241503.1\|554770_555883_-\|protease	cysteine protease StiP family protein	A0A172Q0S8	Acinetobacter_phage	3.0e-40	32.0

DBSCAN-SWA_5

559560 : 614929

Bacillus_phage(72.34%)

coat,capsid,integrase,plate,holin,protease,terminase,tail,portal

attL 561551:561568|attR 608682:608699

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000614215.1\|559560_560562_+\|coat	spore coat protein CotS	NA	NA	NA	NA
WP_001125507.1\|560623_560839_-	hypothetical protein	NA	NA	NA	NA
WP_000431159.1\|561257_561494_-	NifU family protein	Q58MC7	Prochlorococcus_phage	2.0e-10	46.6
561551:561568	attL	NA	NA	NA	NA
WP_000248588.1\|561689_561998_+	YuzD family protein	NA	NA	NA	NA
WP_000788487.1\|562049_562844_+	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_000049706.1\|562967_563636_+	hypothetical protein	NA	NA	NA	NA
WP_006918875.1\|563708_564347_-	DUF4304 domain-containing protein	NA	NA	NA	NA
WP_002025033.1\|564333_564804_-	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_000383680.1\|564893_565148_+	hypothetical protein	NA	NA	NA	NA
WP_000607083.1\|565184_565568_+	hypothetical protein	NA	NA	NA	NA
WP_002026505.1\|565856_566654_+	DUF2628 domain-containing protein	NA	NA	NA	NA
WP_000626489.1\|566723_567005_+	hypothetical protein	NA	NA	NA	NA
WP_000212737.1\|567164_567506_+	alkylphosphonate utilization operon protein PhnA	NA	NA	NA	NA
WP_145977399.1\|567705_568530_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_000470314.1\|568486_569146_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.4e-22	33.0
WP_001054090.1\|569200_569374_-	aspartyl-phosphate phosphatase Spo0E family protein	NA	NA	NA	NA
WP_060851575.1\|569607_570678_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_060851576.1\|571029_571269_+	YuzB family protein	NA	NA	NA	NA
WP_000077400.1\|571536_572403_+	diaminopimelate epimerase	NA	NA	NA	NA
WP_000573826.1\|572444_572798_+	iron-sulfur cluster assembly accessory protein	A0A2H4N7M3	Lake_Baikal_phage	3.7e-16	43.3
WP_000765222.1\|573287_574055_+	hypothetical protein	NA	NA	NA	NA
WP_000833148.1\|574739_575093_+	YxeA family protein	A0A0K2CYS5	Paenibacillus_phage	1.3e-13	40.2
WP_000237488.1\|575182_576244_-\|integrase	site-specific integrase	A0A1B2AQ00	Phage_Wrath	4.6e-171	83.6
WP_060852516.1\|577208_577439_+	hypothetical protein	H0UST5	Bacillus_phage	5.9e-31	92.1
WP_081097611.1\|577574_578741_+	hypothetical protein	NA	NA	NA	NA
WP_021727905.1\|579153_579495_-	helix-turn-helix transcriptional regulator	H0UST7	Bacillus_phage	1.0e-10	33.3
WP_060851577.1\|579652_579859_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_021727908.1\|580038_580227_+	helix-turn-helix domain-containing protein	A0A1B2APY7	Phage_Wrath	2.0e-21	80.6
WP_000788368.1\|580243_580399_+	hypothetical protein	I7J4K2	Bacillus_phage	3.8e-18	84.0
WP_060851578.1\|580436_581111_+	Rha family transcriptional regulator	A0A288WFT2	Bacillus_phage	1.6e-84	67.4
WP_060851579.1\|581134_582016_+	hypothetical protein	NA	NA	NA	NA
WP_060851580.1\|582148_582922_+	conserved phage C-terminal domain-containing protein	A0A1W6JNI1	Staphylococcus_phage	5.7e-54	47.8
WP_060851581.1\|582933_583815_+	ATP-binding protein	A0A0S2SXI8	Bacillus_phage	6.8e-27	33.6
WP_060851582.1\|583814_584042_+	hypothetical protein	C7DTL1	Bacillus_phage	6.2e-25	72.0
WP_060851583.1\|584034_584781_+	sigma-70 family RNA polymerase sigma factor	Q2I8C6	Bacillus_phage	2.0e-96	73.0
WP_060851584.1\|584997_585402_+	hypothetical protein	A0A0E3Y4X1	Fusobacterium_phage	2.7e-10	35.7
WP_060852517.1\|585608_585794_+	hypothetical protein	A0A0S2MV96	Bacillus_phage	9.9e-21	83.6
WP_081097518.1\|585838_585976_+	hypothetical protein	NA	NA	NA	NA
WP_060851585.1\|586161_586425_+	hypothetical protein	NA	NA	NA	NA
WP_060851586.1\|587096_587312_-	spore germination protein	A0A2H4J3A3	uncultured_Caudovirales_phage	3.8e-24	80.3
WP_060851587.1\|587459_587810_+	hypothetical protein	A0A218KDG0	Bacillus_phage	5.1e-26	51.3
WP_078187667.1\|587821_587944_+	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_078187666.1\|588055_588226_+	hypothetical protein	A0A1B0T6D0	Bacillus_phage	8.8e-08	75.0
WP_060851588.1\|588253_588736_+	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	8.5e-72	83.1
WP_001012146.1\|588735_589278_+\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	2.9e-89	91.7
WP_060851589.1\|590001_590184_+	hypothetical protein	NA	NA	NA	NA
WP_060851590.1\|590227_590584_+	hypothetical protein	I7J6Y9	Bacillus_phage	9.2e-15	42.5
WP_153598852.1\|590613_590757_+	hypothetical protein	A0A288WG60	Bacillus_phage	5.6e-16	73.9
WP_060851591.1\|590763_590946_+	hypothetical protein	A0A1C8E9B9	Bacillus_phage	1.0e-09	60.4
WP_060851592.1\|591187_591514_+	HNH endonuclease	A0A1S7FZ53	Listeria_phage	1.4e-17	46.7
WP_060852518.1\|591573_591819_+	hypothetical protein	NA	NA	NA	NA
WP_060851594.1\|592148_592649_+\|terminase	P27 family phage terminase small subunit	A0A1B1P762	Bacillus_phage	1.9e-10	36.2
WP_060851595.1\|592632_594303_+\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	4.4e-184	57.7
WP_060851596.1\|594318_595548_+\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	6.7e-73	36.8
WP_060851597.1\|595501_596248_+\|protease	Clp protease ClpP	D2XR17	Bacillus_phage	6.4e-42	44.5
WP_060851598.1\|596240_597377_+\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	5.4e-101	54.3
WP_060851599.1\|597391_597715_+	hypothetical protein	NA	NA	NA	NA
WP_060851600.1\|597704_598061_+	hypothetical protein	NA	NA	NA	NA
WP_060851601.1\|598047_598428_+	hypothetical protein	NA	NA	NA	NA
WP_060851602.1\|598417_598828_+	hypothetical protein	NA	NA	NA	NA
WP_060851603.1\|598830_599412_+	hypothetical protein	A0A1B1P778	Bacillus_phage	6.9e-44	49.2
WP_060851604.1\|599482_599839_+	hypothetical protein	A0A1S7FZ84	Listeria_phage	5.2e-10	36.5
WP_171840935.1\|599883_600021_+	hypothetical protein	NA	NA	NA	NA
WP_060851605.1\|600020_603524_+\|tail	phage tail tape measure protein	E2ELJ5	Clostridium_phage	1.3e-81	49.7
WP_060851606.1\|603525_604203_+\|tail	phage tail protein	A0A1C8EA72	Bacillus_phage	6.3e-97	77.9
WP_060851607.1\|604199_606542_+\|tail	phage tail protein	A0A1C8E983	Bacillus_phage	0.0e+00	86.0
WP_060851608.1\|606556_607837_+\|plate	BppU family phage baseplate upper protein	A0A1C8E978	Bacillus_phage	4.0e-185	75.6
WP_030026929.1\|607989_608214_+	hemolysin XhlA family protein	A0A1B1P780	Bacillus_phage	7.0e-29	95.9
WP_000373914.1\|608289_608715_+\|holin	phage holin family protein	A0A1B1P787	Bacillus_phage	9.1e-70	96.5
608682:608699	attR	NA	NA	NA	NA
WP_060851609.1\|608714_609650_+	N-acetylmuramoyl-L-alanine amidase	A0A0S2MVR5	Bacillus_phage	8.7e-182	96.1
WP_060851610.1\|610191_610530_-	hypothetical protein	A0A1B1P7R0	Bacillus_phage	4.7e-37	78.6
WP_060851611.1\|610583_611162_-	type IV secretory system conjugative DNA transfer family protein	H0USX9	Bacillus_phage	1.4e-97	89.6
WP_001137905.1\|611167_611347_-	hypothetical protein	NA	NA	NA	NA
WP_000649833.1\|611355_611553_-	helix-turn-helix transcriptional regulator	A0A288WG80	Bacillus_phage	3.4e-19	76.2
WP_060851612.1\|611736_612054_+	hypothetical protein	H0USY0	Bacillus_phage	2.4e-51	97.1
WP_000170777.1\|612050_612233_+	hypothetical protein	Q2I8E2	Bacillus_phage	1.4e-22	90.0
WP_000891536.1\|612348_613530_+	cell division protein FtsK	H0USY1	Bacillus_phage	6.9e-216	94.7
WP_000551103.1\|613471_614092_+	replication-relaxation family protein	H0USY2	Bacillus_phage	6.5e-109	93.2
WP_060851613.1\|614101_614929_-	cytosolic protein	A0A2H4J6G7	uncultured_Caudovirales_phage	6.1e-102	69.9

DBSCAN-SWA_6

983869 : 991555

uncultured_Caudovirales_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001036848.1\|983869_984853_+	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	1.1e-17	27.2
WP_000403758.1\|984842_985613_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	3.7e-13	27.1
WP_001086126.1\|985645_986410_+	class B sortase	NA	NA	NA	NA
WP_000587818.1\|986482_986806_-	heme oxygenase	NA	NA	NA	NA
WP_001235508.1\|987101_988301_+	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	3.6e-71	41.2
WP_001014310.1\|988339_988534_-	YwbE family protein	NA	NA	NA	NA
WP_001293578.1\|988534_988708_-	hypothetical protein	NA	NA	NA	NA
WP_060851665.1\|988876_989569_+	response regulator transcription factor	W8CYM9	Bacillus_phage	7.0e-35	38.2
WP_000247684.1\|989570_990506_+	HAMP domain-containing histidine kinase	Q8QNA2	Ectocarpus_siliculosus_virus	3.0e-12	26.6
WP_000221069.1\|990631_991555_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.4e-46	44.4

DBSCAN-SWA_7

1039287 : 1130879

106

Bacillus_phage(37.74%)

coat,head,capsid,plate,protease,terminase,tRNA,tail,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000472289.1\|1039287_1040547_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.0e-148	66.3
WP_000119176.1\|1040653_1042324_+\|protease	ATP-dependent protease LonB	E3T4F6	Cafeteria_roenbergensis_virus	7.4e-14	33.0
WP_060851672.1\|1042506_1044837_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	4.3e-177	43.5
WP_000869116.1\|1044833_1045430_+	ribosome biogenesis GTP-binding protein YsxC	NA	NA	NA	NA
WP_000359767.1\|1045463_1045880_-	organic hydroperoxide resistance protein	NA	NA	NA	NA
WP_000133916.1\|1045882_1046335_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_000547863.1\|1046751_1048086_+\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_000008991.1\|1048103_1048937_+	cytochrome c biogenesis protein CcsA	NA	NA	NA	NA
WP_001226395.1\|1048952_1049882_+	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_000992345.1\|1049884_1050637_+	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_001087065.1\|1050657_1051647_+	porphobilinogen synthase	NA	NA	NA	NA
WP_000712943.1\|1051646_1052936_+	glutamate-1-semialdehyde 2,1-aminomutase	A0A1V0SKB7	Klosneuvirus	1.7e-05	34.1
WP_002024850.1\|1053015_1054026_+	stage VI sporulation protein D	NA	NA	NA	NA
WP_000350658.1\|1054092_1055118_+\|coat	spore coat protein YsxE	NA	NA	NA	NA
WP_000072252.1\|1055637_1058283_+\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	1.6e-164	42.8
WP_000582071.1\|1058376_1059678_+	bifunctional tetrahydrofolate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_060851673.1\|1059843_1060794_+	hypothetical protein	NA	NA	NA	NA
WP_001226292.1\|1061026_1061602_+	septum formation inhibitor Maf	NA	NA	NA	NA
WP_001013397.1\|1061648_1062047_+	DNA repair protein RadC	NA	NA	NA	NA
WP_060851674.1\|1062050_1063445_-	recombinase family protein	A0A2H4JFH9	uncultured_Caudovirales_phage	3.9e-218	81.7
WP_060851675.1\|1063528_1064215_-	helix-turn-helix transcriptional regulator	A0A2H4JDE4	uncultured_Caudovirales_phage	5.7e-122	95.2
WP_060851676.1\|1064385_1064637_+	Cro/Cl family transcriptional regulator	A0A2H4JEY2	uncultured_Caudovirales_phage	2.4e-33	85.7
WP_171840937.1\|1064614_1064755_+	hypothetical protein	A0A2H4J841	uncultured_Caudovirales_phage	7.0e-11	81.0
WP_171840938.1\|1064751_1064904_+	hypothetical protein	A0A2H4JAZ7	uncultured_Caudovirales_phage	4.9e-10	66.0
WP_060851677.1\|1064919_1065147_+	hypothetical protein	NA	NA	NA	NA
WP_060851678.1\|1065147_1065498_+	hypothetical protein	A0A1B2AQ59	Phage_Wrath	4.7e-48	79.3
WP_060851679.1\|1065592_1065850_+	hypothetical protein	NA	NA	NA	NA
WP_060851680.1\|1065846_1066197_+	hypothetical protein	NA	NA	NA	NA
WP_060851681.1\|1066196_1066481_+	hypothetical protein	A0A2H4J9A3	uncultured_Caudovirales_phage	3.2e-34	77.7
WP_060851682.1\|1066458_1067007_+	host-nuclease inhibitor Gam family protein	A0A2H4JFP8	uncultured_Caudovirales_phage	1.1e-75	78.0
WP_060851683.1\|1067009_1067261_+	hypothetical protein	A0A2H4JG95	uncultured_Caudovirales_phage	7.6e-40	95.2
WP_060851684.1\|1067266_1067863_+	hypothetical protein	A0A1B2AQ10	Phage_Wrath	1.7e-93	90.9
WP_000694784.1\|1067878_1068571_+	AAA family ATPase	A0A2H4J9A0	uncultured_Caudovirales_phage	1.6e-119	95.9
WP_000008625.1\|1068570_1069044_+	DUF669 domain-containing protein	A0A2H4J986	uncultured_Caudovirales_phage	8.0e-83	96.8
WP_060851685.1\|1069115_1071458_+	DNA primase	A0A1B2AQ05	Phage_Wrath	0.0e+00	98.2
WP_060851686.1\|1071778_1072207_+	hypothetical protein	A0A2H4JFQ6	uncultured_Caudovirales_phage	7.5e-72	88.0
WP_060851687.1\|1072210_1072396_+	hypothetical protein	NA	NA	NA	NA
WP_060851688.1\|1072392_1072932_+	ERCC4 domain-containing protein	A0A0S2SXQ1	Bacillus_phage	2.2e-44	50.8
WP_060851689.1\|1072933_1073206_+	hypothetical protein	A0A0H3V0M3	Geobacillus_virus	7.5e-17	53.5
WP_060851690.1\|1073256_1073694_+	hypothetical protein	A0A2H4JBP0	uncultured_Caudovirales_phage	3.6e-61	82.8
WP_060851691.1\|1073764_1073998_+	hypothetical protein	NA	NA	NA	NA
WP_060851692.1\|1074182_1074485_+	hypothetical protein	Q3HKX6	Bacillus_phage	4.7e-36	76.0
WP_140159945.1\|1074643_1074832_+	hypothetical protein	S5MC27	Brevibacillus_phage	1.1e-11	62.3
WP_038413844.1\|1074873_1075260_+	phage protein	A0A2H4JFW6	uncultured_Caudovirales_phage	4.4e-47	74.4
WP_038413842.1\|1075459_1075849_+	DUF3942 family protein	NA	NA	NA	NA
WP_060851693.1\|1076160_1076364_+	hypothetical protein	A0A1C8E9B9	Bacillus_phage	1.9e-17	72.3
WP_000074276.1\|1076404_1076623_+	hypothetical protein	NA	NA	NA	NA
WP_000627439.1\|1076619_1076934_+	Rho termination factor N-terminal domain-containing protein	A0A1B0T6C6	Bacillus_phage	5.2e-46	89.4
WP_038413837.1\|1076930_1077323_+	HNH endonuclease	A0A1B1P7N1	Bacillus_phage	9.6e-74	96.9
WP_038413835.1\|1077407_1077845_+\|terminase	P27 family phage terminase small subunit	A0A1B1P7N7	Bacillus_phage	2.0e-67	90.3
WP_038413833.1\|1077841_1079569_+\|terminase	terminase large subunit	A0A2H4JDG5	uncultured_Caudovirales_phage	0.0e+00	97.7
WP_038413832.1\|1079584_1080790_+\|portal	phage portal protein	A0A1B2APW5	Phage_Wrath	1.3e-209	91.0
WP_038413830.1\|1080758_1081337_+\|head,protease	HK97 family phage prohead protease	A0A2H4J6Z9	uncultured_Caudovirales_phage	1.4e-84	81.5
WP_038413828.1\|1081338_1082706_+\|capsid	phage major capsid protein	A0A1B2APY9	Phage_Wrath	7.8e-155	79.3
WP_038413826.1\|1082707_1082968_+\|head,tail	phage gp6-like head-tail connector protein	A0A1C8E967	Bacillus_phage	1.7e-39	94.2
WP_038413824.1\|1082942_1083278_+	phage protein	A0A1B0T691	Bacillus_phage	7.2e-54	97.2
WP_038413822.1\|1083267_1083597_+	hypothetical protein	A0A1B0T6B7	Bacillus_phage	4.4e-56	96.3
WP_038413820.1\|1083596_1083974_+	HK97 gp10 family phage protein	A0A1C8E995	Bacillus_phage	5.1e-64	99.2
WP_038413819.1\|1083985_1084621_+\|tail	phi13 family phage major tail protein	A0A1C8E980	Bacillus_phage	3.8e-112	96.2
WP_000113342.1\|1084632_1085019_+	hypothetical protein	A0A1C8E984	Bacillus_phage	7.3e-66	100.0
WP_006927278.1\|1085057_1085246_+	hypothetical protein	A0A1C8E979	Bacillus_phage	8.2e-31	98.4
WP_038413814.1\|1088783_1089467_+\|tail	phage tail family protein	A0A1B1P7Q0	Bacillus_phage	9.1e-128	97.8
WP_038413812.1\|1089463_1091806_+\|tail	phage tail protein	A0A1B1P7P0	Bacillus_phage	0.0e+00	97.8
WP_060851694.1\|1091820_1093101_+\|plate	BppU family phage baseplate upper protein	A0A1C8E978	Bacillus_phage	1.4e-190	77.7
WP_038413980.1\|1093150_1093360_+	hemolysin XhlA family protein	A0A1B2APY8	Phage_Wrath	7.0e-23	84.8
WP_038413810.1\|1093361_1093565_+	hypothetical protein	A0A1B1P886	Bacillus_phage	8.8e-31	95.3
WP_038413809.1\|1093561_1094614_+	N-acetylmuramoyl-L-alanine amidase	A0A1C8E990	Bacillus_phage	6.4e-189	93.1
WP_038413808.1\|1094792_1095125_-	hypothetical protein	A0A2H4J846	uncultured_Caudovirales_phage	1.5e-32	70.0
WP_038413806.1\|1095203_1095452_-	hypothetical protein	A0A1B1P7Q5	Bacillus_phage	2.7e-37	95.1
WP_060851695.1\|1095765_1096599_-	hypothetical protein	A0A2H4J9W9	uncultured_Caudovirales_phage	4.1e-122	90.3
WP_060851696.1\|1096705_1097110_+	DNA repair protein RadC	NA	NA	NA	NA
WP_000466736.1\|1097267_1098287_+	rod shape-determining protein MreB	NA	NA	NA	NA
WP_001135488.1\|1098328_1099180_+	rod shape-determining protein MreC	NA	NA	NA	NA
WP_000975766.1\|1099194_1099740_+	rod shape-determining protein MreD	NA	NA	NA	NA
WP_000391521.1\|1099775_1100462_+	septum site-determining protein MinC	NA	NA	NA	NA
WP_000503309.1\|1100464_1101262_+	septum site-determining protein MinD	NA	NA	NA	NA
WP_000797471.1\|1101396_1102143_+	stage IV sporulation protein SpoIVFA	NA	NA	NA	NA
WP_000599064.1\|1102135_1102996_+	stage IV sporulation protein SpoIVFB	NA	NA	NA	NA
WP_000855481.1\|1103063_1104452_+	Rne/Rng family ribonuclease	NA	NA	NA	NA
WP_000270907.1\|1104621_1104930_+	50S ribosomal protein L21	NA	NA	NA	NA
WP_001973720.1\|1104941_1105286_+\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_000944957.1\|1105289_1105580_+	50S ribosomal protein L27	NA	NA	NA	NA
WP_001003587.1\|1105643_1106192_+	Spo0B domain-containing protein	NA	NA	NA	NA
WP_000497128.1\|1106191_1107478_+	GTPase ObgE	NA	NA	NA	NA
WP_000276723.1\|1107617_1108325_+	response regulator transcription factor	NA	NA	NA	NA
WP_000865181.1\|1108314_1109397_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_000114529.1\|1109490_1110267_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-29	38.4
WP_060851697.1\|1110241_1112164_+	ABC transporter permease	NA	NA	NA	NA
WP_001028685.1\|1112213_1114127_+	ABC transporter permease	NA	NA	NA	NA
WP_000621705.1\|1114223_1115075_+	prephenate dehydratase	NA	NA	NA	NA
WP_000510666.1\|1115235_1115883_-	MOSC domain-containing protein	NA	NA	NA	NA
WP_000812275.1\|1115962_1116505_-	transcription repressor NadR	NA	NA	NA	NA
WP_000973777.1\|1116504_1117647_-	IscS subfamily cysteine desulfurase	A0A1X7QGF3	Faustovirus	5.0e-30	29.2
WP_001138531.1\|1117799_1119329_+	L-aspartate oxidase	NA	NA	NA	NA
WP_001092226.1\|1119348_1120182_+	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_000025342.1\|1120211_1121318_+	quinolinate synthase NadA	NA	NA	NA	NA
WP_060851698.1\|1121543_1123436_+\|coat	spore coat assembly protein ExsA	NA	NA	NA	NA
WP_001093536.1\|1123614_1124259_+	YhcN/YlaJ family sporulation lipoprotein	NA	NA	NA	NA
WP_000721223.1\|1124292_1124727_-	hypothetical protein	NA	NA	NA	NA
WP_000871193.1\|1125156_1125687_+	BofC C-terminal domain-containing protein	NA	NA	NA	NA
WP_000823611.1\|1125700_1126645_-	iron-hydroxamate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000464511.1\|1126833_1127451_+	Holliday junction DNA helicase RuvA	NA	NA	NA	NA
WP_000344449.1\|1127456_1128458_+	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	6.8e-07	26.3
WP_000138162.1\|1128454_1128655_+	DUF2905 domain-containing protein	NA	NA	NA	NA
WP_000354014.1\|1128674_1129727_+\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_000125365.1\|1129739_1130879_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.1e-82	42.3

DBSCAN-SWA_8

1275480 : 1389317

152

Bacillus_phage(82.29%)

transposase,head,capsid,plate,integrase,holin,protease,terminase,tail,portal

attL 1283925:1283942|attR 1384417:1384434

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001053969.1\|1275480_1276917_-\|transposase	IS4-like element IS231C family transposase	NA	NA	NA	NA
WP_081097528.1\|1277228_1278452_+	phosphoglucomutase	NA	NA	NA	NA
WP_001265616.1\|1278521_1278671_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_000642750.1\|1278775_1279354_+	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_000253699.1\|1279457_1279658_+	YqgQ family protein	NA	NA	NA	NA
WP_000391704.1\|1279677_1280661_+	glucokinase	NA	NA	NA	NA
WP_000524852.1\|1280741_1280915_-	DUF2759 domain-containing protein	NA	NA	NA	NA
WP_000871231.1\|1281087_1281717_+	MBL fold metallo-hydrolase	A0A1X9I5D3	Streptococcus_phage	4.1e-34	38.7
WP_000525154.1\|1281726_1282839_+	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_000894377.1\|1282981_1283272_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000379156.1\|1283705_1284218_-	cysteine hydrolase	NA	NA	NA	NA
1283925:1283942	attL	NA	NA	NA	NA
WP_060851709.1\|1284385_1285549_-	cystathionine beta-lyase	NA	NA	NA	NA
WP_000103897.1\|1285545_1286658_-	cystathionine gamma-synthase/O-acetylhomoserine thiolyase	A0A0B5JD48	Pandoravirus	5.8e-15	28.2
WP_000770352.1\|1287246_1289079_+	bifunctional homocysteine S-methyltransferase/methylenetetrahydrofolate reductase	NA	NA	NA	NA
WP_000649675.1\|1289078_1292477_+	methionine synthase	A0A140XBC7	Dickeya_phage	4.8e-12	51.7
WP_000724776.1\|1292495_1293554_+	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
WP_001250699.1\|1293748_1294009_+	DUF3966 domain-containing protein	NA	NA	NA	NA
WP_001012342.1\|1294104_1294479_+	nucleoside 2-deoxyribosyltransferase	NA	NA	NA	NA
WP_000764267.1\|1294558_1295047_+	hypothetical protein	NA	NA	NA	NA
WP_001093239.1\|1295081_1295393_-	hypothetical protein	NA	NA	NA	NA
WP_001008327.1\|1295645_1295861_+	DUF3912 family protein	NA	NA	NA	NA
WP_000875395.1\|1295948_1296341_+	hypothetical protein	NA	NA	NA	NA
WP_145977397.1\|1296442_1297638_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.6e-26	31.3
WP_001094345.1\|1297739_1299134_-	L-cystine transporter	NA	NA	NA	NA
WP_000440716.1\|1299241_1299484_-	DUF2626 domain-containing protein	NA	NA	NA	NA
WP_000434125.1\|1299609_1300305_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_081097529.1\|1300510_1300963_+	Flp pilus assembly complex ATPase component TadA	NA	NA	NA	NA
WP_060851710.1\|1300975_1302397_-	recombinase family protein	A0A1L2JY12	Aeribacillus_phage	3.1e-106	44.4
WP_042595834.1\|1302410_1302713_-	DUF1827 family protein	NA	NA	NA	NA
WP_160292204.1\|1302754_1303159_-	ImmA/IrrE family metallo-endopeptidase	A0A0K2CZC9	Paenibacillus_phage	9.1e-27	46.2
WP_042595830.1\|1303222_1303618_-	helix-turn-helix transcriptional regulator	Q38327	Lactococcus_phage	6.4e-09	46.2
WP_171840939.1\|1303800_1304034_+	helix-turn-helix transcriptional regulator	U3PDM7	Lactobacillus_phage	1.7e-06	43.5
WP_153598418.1\|1304997_1305165_+	hypothetical protein	NA	NA	NA	NA
WP_171840940.1\|1305611_1305770_+	hypothetical protein	NA	NA	NA	NA
WP_042595826.1\|1306042_1306237_+	hypothetical protein	NA	NA	NA	NA
WP_060851711.1\|1306416_1306629_+	hypothetical protein	NA	NA	NA	NA
WP_171840941.1\|1306630_1306807_+	hypothetical protein	NA	NA	NA	NA
WP_042595820.1\|1306987_1307470_+	siphovirus Gp157 family protein	E5DV79	Deep-sea_thermophilic_phage	1.2e-28	45.0
WP_052497230.1\|1307466_1308192_+	ERF family protein	W8CYS2	Bacillus_phage	1.8e-41	66.1
WP_171840942.1\|1308193_1308361_+	hypothetical protein	A0A0M4R389	Bacillus_phage	2.9e-11	62.7
WP_042595819.1\|1308357_1309203_+	phage replisome organizer N-terminal domain-containing protein	A8ASN4	Listeria_phage	8.0e-41	50.3
WP_042595817.1\|1309195_1309534_+	hypothetical protein	W8EIZ4	Geobacillus_phage	2.7e-08	37.9
WP_060851712.1\|1309530_1310874_+	replicative DNA helicase	D2XR44	Bacillus_phage	4.1e-108	47.1
WP_060851713.1\|1310870_1311089_+	hypothetical protein	NA	NA	NA	NA
WP_060851714.1\|1311175_1311796_+	hypothetical protein	Q5YA91	Bacillus_phage	4.3e-28	33.3
WP_081097530.1\|1311826_1312369_+	hypothetical protein	A0A0S2MVC3	Bacillus_phage	2.0e-82	83.3
WP_060851716.1\|1312407_1312755_+	hypothetical protein	NA	NA	NA	NA
WP_060851717.1\|1312852_1313512_+	hypothetical protein	A0A1I9S6E4	Bacillus_phage	8.2e-102	75.4
WP_060851718.1\|1313674_1313965_+	hypothetical protein	A0A290GDV5	Caldibacillus_phage	5.3e-37	77.9
WP_060851719.1\|1313971_1314400_+	ArpU family transcriptional regulator	NA	NA	NA	NA
WP_060851720.1\|1314778_1315252_+\|terminase	terminase small subunit	A0A0M4RU19	Bacillus_phage	6.2e-35	51.0
WP_060851721.1\|1315238_1316543_+\|terminase	PBSX family phage terminase large subunit	A0A0M4R5F3	Bacillus_phage	3.0e-228	85.0
WP_060851722.1\|1316554_1316758_+	hypothetical protein	NA	NA	NA	NA
WP_060851723.1\|1316757_1318104_+\|portal	phage portal protein	A0A0M4S669	Bacillus_phage	1.7e-207	80.1
WP_060851724.1\|1318090_1319116_+\|capsid	minor capsid protein	A0A0M5M7Z2	Bacillus_phage	1.3e-154	84.4
WP_060851725.1\|1319188_1319848_+	DUF4355 domain-containing protein	A0A0M3ULE7	Bacillus_phage	4.6e-20	46.5
WP_060851726.1\|1319861_1320713_+	hypothetical protein	A0A0M5M1L4	Bacillus_phage	7.8e-113	74.6
WP_060851727.1\|1320752_1321091_+\|head,tail	phage head-tail connector protein	W8CYS9	Bacillus_phage	2.2e-10	40.5
WP_060851728.1\|1321072_1321432_+	hypothetical protein	A0A0M4S6Z9	Bacillus_phage	2.3e-42	73.5
WP_060851729.1\|1321415_1321832_+	hypothetical protein	A0A0M4S6Z2	Bacillus_phage	1.5e-64	86.2
WP_060851730.1\|1321828_1322209_+	hypothetical protein	A0A0M4RD75	Bacillus_phage	4.3e-55	81.0
WP_060851731.1\|1322227_1322860_+	hypothetical protein	A0A0M4R5F9	Bacillus_phage	7.0e-74	75.7
WP_060851732.1\|1322904_1323342_+	hypothetical protein	NA	NA	NA	NA
WP_016098868.1\|1323377_1323644_+	hypothetical protein	A0A0M4S6X7	Bacillus_phage	1.6e-19	55.7
WP_060851733.1\|1323649_1326247_+\|tail	phage tail tape measure protein	A0A0M3ULL5	Bacillus_phage	1.0e-107	48.4
WP_081097531.1\|1326256_1327726_+\|tail	phage tail family protein	A0A0A7AQV1	Bacillus_phage	1.3e-192	64.6
WP_042595780.1\|1327722_1329882_+\|tail	phage tail protein	H0USX5	Bacillus_phage	5.7e-168	71.1
WP_042595778.1\|1329897_1330260_+	hypothetical protein	A0A0S2MVE0	Bacillus_phage	4.2e-31	62.6
WP_042595776.1\|1330256_1331411_+\|plate	BppU family phage baseplate upper protein	A0A1C8E978	Bacillus_phage	4.1e-96	48.8
WP_042595773.1\|1331451_1331871_+\|holin	phage holin family protein	H0USX7	Bacillus_phage	9.3e-59	82.2
WP_042598441.1\|1331870_1332827_+	N-acetylmuramoyl-L-alanine amidase	A0A0S2MVR5	Bacillus_phage	3.0e-113	77.6
WP_042595771.1\|1333025_1334063_-	DUF418 domain-containing protein	NA	NA	NA	NA
WP_042595770.1\|1334545_1334746_-	hypothetical protein	NA	NA	NA	NA
WP_042595767.1\|1335460_1336297_-	arylamine N-acetyltransferase	NA	NA	NA	NA
WP_042598439.1\|1336822_1337014_+	hypothetical protein	NA	NA	NA	NA
WP_042595765.1\|1338067_1339159_+	recombinase RecA	A0A0S2MVG1	Bacillus_phage	4.9e-168	87.1
WP_000475176.1\|1339874_1340906_+	type II secretion system F family protein	NA	NA	NA	NA
WP_001178687.1\|1340917_1341217_+	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
WP_000813141.1\|1341213_1341669_+	type II secretion system protein	NA	NA	NA	NA
WP_000829469.1\|1341661_1341964_+	hypothetical protein	NA	NA	NA	NA
WP_021727637.1\|1341933_1342122_+	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
WP_060851734.1\|1342263_1343433_-\|integrase	site-specific integrase	A0A0M5M609	Bacillus_phage	1.2e-63	38.0
WP_060852521.1\|1343635_1343980_-	helix-turn-helix transcriptional regulator	A0A1B1P888	Bacillus_phage	3.1e-20	45.5
WP_060851735.1\|1344476_1345607_+	hypothetical protein	A0A1B0T6A5	Bacillus_phage	3.5e-68	38.7
WP_171840943.1\|1345647_1345800_+	hypothetical protein	NA	NA	NA	NA
WP_060851736.1\|1346119_1346461_-	helix-turn-helix transcriptional regulator	A0A1B0T6A7	Bacillus_phage	2.7e-16	41.2
WP_060851737.1\|1346635_1346857_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_060851738.1\|1346880_1347612_+	ORF6C domain-containing protein	A0A1B1P7T7	Bacillus_phage	1.9e-123	90.1
WP_060851739.1\|1347650_1347911_+	group-specific protein	A0A1B1P7U4	Bacillus_phage	2.2e-42	94.2
WP_081097534.1\|1347923_1348088_+	hypothetical protein	A0A0U3B230	Bacillus_phage	9.0e-18	79.6
WP_000364160.1\|1348117_1348294_+	hypothetical protein	A0A1B1P7U0	Bacillus_phage	2.6e-23	87.9
WP_049107944.1\|1348299_1349145_+	phage replisome organizer N-terminal domain-containing protein	V5UQV4	Oenococcus_phage	1.8e-37	59.3
WP_060851740.1\|1349113_1349911_+	ATP-binding protein	A0A1B1P7U2	Bacillus_phage	2.1e-144	98.5
WP_060851741.1\|1349931_1350126_+	hypothetical protein	A0A0U3K3J8	Bacillus_phage	3.6e-21	78.1
WP_060851742.1\|1350142_1350421_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	9.7e-12	57.6
WP_060851743.1\|1350413_1350773_+	hypothetical protein	A0A1B1P7A1	Bacillus_phage	1.7e-32	55.0
WP_000717829.1\|1350791_1350959_+	DUF3954 domain-containing protein	A0A1B0T6B8	Bacillus_phage	9.5e-15	64.2
WP_000109543.1\|1350984_1351236_+	hypothetical protein	A0A0K2CNP4	Brevibacillus_phage	2.2e-07	42.2
WP_001054607.1\|1351255_1351765_+	dUTP diphosphatase	A0A1L2JY27	Aeribacillus_phage	1.4e-27	44.9
WP_002134037.1\|1351809_1351995_+	hypothetical protein	NA	NA	NA	NA
WP_000387671.1\|1352046_1352445_+	hypothetical protein	A0A068ELY9	Bacillus_phage	2.8e-57	79.1
WP_000805074.1\|1352469_1352892_+	hypothetical protein	A0A1B1P7B4	Bacillus_phage	2.3e-65	82.9
WP_000433730.1\|1352926_1353064_+	hypothetical protein	NA	NA	NA	NA
WP_000397931.1\|1353067_1353334_+	hypothetical protein	D2XR50	Bacillus_phage	2.2e-13	42.7
WP_000404182.1\|1353371_1353770_+	hypothetical protein	W8CYU3	Bacillus_phage	1.2e-52	75.0
WP_000872736.1\|1353807_1353957_+	hypothetical protein	NA	NA	NA	NA
WP_000365653.1\|1354056_1354275_+	hypothetical protein	NA	NA	NA	NA
WP_060851744.1\|1354314_1354719_+	hypothetical protein	L0L8J8	Bacillus_phage	6.5e-09	48.5
WP_060852522.1\|1354976_1355429_+	hypothetical protein	A0A0A7AQW7	Bacillus_phage	9.1e-60	72.0
WP_060851745.1\|1355469_1355652_+	hypothetical protein	A0A218KC21	Bacillus_phage	2.9e-17	72.4
WP_060851746.1\|1355684_1356005_+	hypothetical protein	A0A0S2MVI8	Bacillus_phage	8.2e-15	49.5
WP_060851747.1\|1356001_1356199_+	hypothetical protein	NA	NA	NA	NA
WP_060851748.1\|1356227_1356464_+	hypothetical protein	A0A0A7AQI9	Bacillus_phage	1.1e-21	98.7
WP_024086075.1\|1356580_1356751_+	hypothetical protein	A0A0A7AQ99	Bacillus_phage	5.5e-26	100.0
WP_060851749.1\|1356793_1357075_+	hypothetical protein	NA	NA	NA	NA
WP_000645536.1\|1357189_1357360_+	hypothetical protein	NA	NA	NA	NA
WP_046945209.1\|1357383_1357857_+	ArpU family transcriptional regulator	A0A1B1P7X5	Bacillus_phage	4.9e-80	98.1
WP_046945210.1\|1357853_1358396_+\|integrase	tyrosine-type recombinase/integrase	A0A1B1P7Y2	Bacillus_phage	8.0e-95	98.9
WP_171840944.1\|1358596_1358734_+	hypothetical protein	NA	NA	NA	NA
WP_060852523.1\|1359140_1359443_+	hypothetical protein	A0A0S2MVB8	Bacillus_phage	4.4e-18	52.0
WP_060851750.1\|1359429_1359642_+	hypothetical protein	H0USV9	Bacillus_phage	2.3e-29	95.7
WP_060852524.1\|1359966_1360164_+	hypothetical protein	A0A1B1P8J7	Bacillus_phage	8.3e-18	78.6
WP_060851751.1\|1360156_1360519_+	HNH endonuclease	A0A1B1P8D2	Bacillus_phage	6.0e-62	94.2
WP_060851752.1\|1360680_1361061_+\|terminase	phage terminase small subunit P27 family	A0A1B1P7R2	Bacillus_phage	1.3e-64	96.8
WP_060851753.1\|1361041_1362814_+\|terminase	terminase large subunit	A0A1B1P7R3	Bacillus_phage	0.0e+00	95.1
WP_060851754.1\|1362829_1364044_+\|portal	phage portal protein	A0A0U3SQF0	Bacillus_phage	3.3e-213	88.6
WP_059303836.1\|1364021_1364777_+\|protease	Clp protease ClpP	A0A0U3U021	Bacillus_phage	1.2e-136	98.4
WP_060851755.1\|1364773_1365952_+\|capsid	phage major capsid protein	A0A1B1P7R4	Bacillus_phage	1.9e-205	94.9
WP_002180393.1\|1365926_1366229_+	fibronectin type III domain-containing protein	NA	NA	NA	NA
WP_000891191.1\|1366237_1366513_+\|head,tail	phage gp6-like head-tail connector protein	A0A1B1P7Q8	Bacillus_phage	8.0e-43	98.9
WP_001069938.1\|1366499_1366847_+\|head	phage head closure protein	A0A1B1P7T4	Bacillus_phage	1.6e-59	96.5
WP_000852721.1\|1366834_1367272_+	HK97 gp10 family phage protein	A0A1B1P7R6	Bacillus_phage	7.4e-75	96.6
WP_001211430.1\|1367268_1367628_+	hypothetical protein	A0A1B1P7S7	Bacillus_phage	8.0e-59	92.4
WP_000952022.1\|1367641_1368226_+\|tail	tail protein	A0A1B1P7S4	Bacillus_phage	1.7e-106	98.5
WP_060851756.1\|1368285_1368681_+	hypothetical protein	A0A1B1P7S9	Bacillus_phage	2.6e-55	88.5
WP_000938713.1\|1368698_1368839_+	hypothetical protein	A0A1B1P7R9	Bacillus_phage	1.3e-17	95.7
WP_060851757.1\|1368854_1373870_+\|tail	phage tail tape measure protein	A0A1B1P7S6	Bacillus_phage	0.0e+00	88.3
WP_060851758.1\|1373911_1375387_+\|tail	phage tail family protein	A0A0S2MV63	Bacillus_phage	2.6e-241	81.5
WP_060851759.1\|1375383_1380294_+\|tail	phage tail protein	W8CYT7	Bacillus_phage	0.0e+00	53.0
WP_060851760.1\|1380395_1381355_+\|integrase	site-specific integrase	A0A0S2GLC8	Bacillus_phage	1.6e-175	95.9
WP_060851761.1\|1381370_1381796_+\|holin	phage holin family protein	A0A0S2MVC4	Bacillus_phage	5.3e-70	95.0
WP_060851762.1\|1381795_1382731_+	N-acetylmuramoyl-L-alanine amidase	A0A0S2MVR5	Bacillus_phage	2.1e-183	97.4
WP_085961003.1\|1382833_1384187_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	7.3e-129	85.5
WP_060851763.1\|1384242_1384446_-	helix-turn-helix domain-containing protein	A0A1B1P7S8	Bacillus_phage	5.0e-10	54.4
1384417:1384434	attR	NA	NA	NA	NA
WP_060851764.1\|1384585_1384894_+	hypothetical protein	A0A288WG38	Bacillus_phage	8.7e-46	86.3
WP_060851765.1\|1384890_1385073_+	hypothetical protein	Q2I8E2	Bacillus_phage	3.9e-22	88.3
WP_060851766.1\|1385188_1386370_+	cell division protein FtsK	H0USY1	Bacillus_phage	5.5e-189	82.7
WP_060851767.1\|1386311_1386935_+	replication-relaxation family protein	H0USY2	Bacillus_phage	4.0e-98	83.4
WP_060851768.1\|1386969_1387563_-	hypothetical protein	A0A0U3TZ58	Bacillus_phage	1.4e-87	90.2
WP_060851769.1\|1387812_1388124_+	ComGF family competence protein	NA	NA	NA	NA
WP_001231317.1\|1388120_1388492_+	competence protein ComG	NA	NA	NA	NA
WP_000183856.1\|1388666_1389317_+	2OG-Fe(II) oxygenase	A0A1V0SIE1	Klosneuvirus	2.8e-17	30.1

DBSCAN-SWA_9

1900343 : 1994847

112

Bacillus_phage(62.69%)

transposase,head,capsid,integrase,holin,protease,terminase,tRNA,tail,portal,bacteriocin

attL 1890798:1890816|attR 1971173:1971191

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1890798:1890816	attL	NA	NA	NA	NA
WP_060851554.1\|1900343_1901555_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	4.4e-69	37.9
WP_001179093.1\|1901823_1902987_+	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_000957279.1\|1903146_1903899_+	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_000640859.1\|1903895_1904807_+	1-phosphofructokinase	NA	NA	NA	NA
WP_000704605.1\|1904820_1906677_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_000734640.1\|1907026_1907977_+	SH3 domain-containing protein	A0A0S2SXZ8	Bacillus_phage	1.4e-33	70.3
WP_000814429.1\|1908039_1908285_-	hypothetical protein	NA	NA	NA	NA
WP_000504929.1\|1908465_1909419_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_000813896.1\|1909440_1909665_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_085961003.1\|1909757_1911111_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	7.3e-129	85.5
WP_060851808.1\|1911195_1913163_-	Gly-Xaa-Xaa repeat protein	NA	NA	NA	NA
WP_000450326.1\|1913276_1914242_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_000438178.1\|1914355_1915312_+	stage V sporulation protein K	G3MAX6	Bacillus_virus	3.5e-53	42.3
WP_000181500.1\|1915343_1915481_-	hypothetical protein	NA	NA	NA	NA
WP_000312267.1\|1915580_1916204_-	trimeric intracellular cation channel family protein	NA	NA	NA	NA
WP_000391393.1\|1916296_1917571_+	GTPase HflX	NA	NA	NA	NA
WP_000460302.1\|1917563_1918835_+	methionine gamma-lyase family protein	NA	NA	NA	NA
WP_000656783.1\|1919008_1919398_+	transcriptional repressor GlnR	NA	NA	NA	NA
WP_000092763.1\|1919446_1920781_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_060851809.1\|1920881_1921988_-\|integrase	site-specific integrase	A0A0U3U8Y8	Bacillus_phage	6.9e-101	57.5
WP_081097545.1\|1922330_1923479_+	hypothetical protein	H0UST6	Bacillus_phage	9.7e-82	40.4
WP_153602161.1\|1923482_1923638_+	hypothetical protein	NA	NA	NA	NA
WP_060851810.1\|1923841_1924183_+	hypothetical protein	NA	NA	NA	NA
WP_060851811.1\|1924215_1924878_+	hypothetical protein	A0A0A7AR45	Bacillus_phage	7.1e-45	43.5
WP_171840945.1\|1925029_1925179_+	hypothetical protein	NA	NA	NA	NA
WP_060851812.1\|1925184_1925535_-	helix-turn-helix transcriptional regulator	A0A1B1P8C2	Bacillus_phage	7.1e-36	66.1
WP_060851813.1\|1925743_1925944_+	helix-turn-helix transcriptional regulator	A0A1B1P7V5	Bacillus_phage	1.3e-26	90.9
WP_060851814.1\|1926006_1926795_+	phage antirepressor KilAC domain-containing protein	A0A0B5A507	Paenibacillus_phage	1.4e-68	53.4
WP_060851815.1\|1926809_1927085_+	helix-turn-helix domain-containing protein	A0A0U3ULL9	Bacillus_phage	3.6e-35	85.4
WP_081097546.1\|1927121_1927268_+	hypothetical protein	A0A1B1P8G4	Bacillus_phage	4.9e-15	83.3
WP_081097547.1\|1927313_1927490_+	hypothetical protein	A0A0U3SQC4	Bacillus_phage	3.8e-22	89.7
WP_060851816.1\|1927496_1928384_+	DnaD domain protein	W8CYG5	Bacillus_phage	5.8e-42	42.9
WP_060851817.1\|1928322_1929198_+	ATP-binding protein	Q2I8C8	Bacillus_phage	5.3e-64	46.5
WP_016123365.1\|1929214_1929418_+	hypothetical protein	NA	NA	NA	NA
WP_016123364.1\|1929414_1929639_-	hypothetical protein	Q9T1I9	Lactobacillus_phage	8.9e-16	61.4
WP_000337986.1\|1929719_1929914_+	hypothetical protein	A0A0U3K3J8	Bacillus_phage	1.0e-20	76.6
WP_000805170.1\|1929939_1930113_+	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	2.6e-23	91.2
WP_000811696.1\|1930127_1930382_+	hypothetical protein	A0A1B0T6B9	Bacillus_phage	1.4e-36	88.1
WP_060851818.1\|1930390_1930855_+	hypothetical protein	A0A2H4J8I5	uncultured_Caudovirales_phage	9.8e-17	35.5
WP_060851819.1\|1930881_1931073_+	hypothetical protein	A0A1B0T6B5	Bacillus_phage	6.8e-25	90.5
WP_060851820.1\|1931134_1931326_+	hypothetical protein	NA	NA	NA	NA
WP_000387671.1\|1931366_1931765_+	hypothetical protein	A0A068ELY9	Bacillus_phage	2.8e-57	79.1
WP_000805074.1\|1931789_1932212_+	hypothetical protein	A0A1B1P7B4	Bacillus_phage	2.3e-65	82.9
WP_042597315.1\|1932241_1932676_+	hypothetical protein	A0A1B1P7W5	Bacillus_phage	4.7e-45	63.3
WP_000404182.1\|1932705_1933104_+	hypothetical protein	W8CYU3	Bacillus_phage	1.2e-52	75.0
WP_000872736.1\|1933141_1933291_+	hypothetical protein	NA	NA	NA	NA
WP_000365653.1\|1933390_1933609_+	hypothetical protein	NA	NA	NA	NA
WP_060851821.1\|1933645_1933891_+	hypothetical protein	A0A0S2MVC7	Bacillus_phage	1.3e-33	97.5
WP_060851822.1\|1933938_1934262_+	hypothetical protein	D2XR52	Bacillus_phage	3.3e-48	96.9
WP_081097548.1\|1934320_1934569_+	helix-turn-helix transcriptional regulator	A0A0S2MV80	Bacillus_phage	1.2e-37	96.3
WP_021728831.1\|1934586_1934769_+	hypothetical protein	A0A0S2MV77	Bacillus_phage	3.7e-28	100.0
WP_000525861.1\|1934807_1935089_+	hypothetical protein	NA	NA	NA	NA
WP_000866156.1\|1935204_1935375_+	hypothetical protein	A0A1B0T6D0	Bacillus_phage	5.0e-11	80.4
WP_000166182.1\|1935402_1935885_+	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	1.9e-71	82.5
WP_001012113.1\|1935884_1936427_+\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	1.3e-89	92.2
WP_000124642.1\|1937102_1937363_+	hypothetical protein	NA	NA	NA	NA
WP_000336221.1\|1937504_1937909_+	hypothetical protein	Q2I8B8	Bacillus_phage	2.7e-47	75.0
WP_000666403.1\|1937905_1938241_+	HNH endonuclease	D2XR61	Bacillus_phage	1.0e-52	91.9
WP_000124848.1\|1938391_1938727_+	hypothetical protein	A0A1B1P762	Bacillus_phage	2.3e-07	31.2
WP_000615714.1\|1938723_1940382_+\|terminase	terminase large subunit	A0A2H4JHE9	uncultured_Caudovirales_phage	1.0e-257	79.3
WP_044157418.1\|1940447_1941554_+\|portal	phage portal protein	A0A2H4JAJ1	uncultured_Caudovirales_phage	2.4e-186	89.9
WP_000216402.1\|1941537_1942314_+\|protease	Clp protease ClpP	A0A0A7RWX3	Clostridium_phage	2.5e-57	57.7
WP_000234863.1\|1942334_1943498_+\|capsid	phage major capsid protein	A0A2H4JH29	uncultured_Caudovirales_phage	1.7e-211	96.9
WP_001243199.1\|1943510_1943807_+	hypothetical protein	A0A2H4JF26	uncultured_Caudovirales_phage	1.6e-41	87.8
WP_001182260.1\|1943808_1944183_+\|head	phage head closure protein	A0A2H4JHA9	uncultured_Caudovirales_phage	1.1e-58	90.3
WP_000818829.1\|1944170_1944608_+	HK97 gp10 family phage protein	A0A2H4JBV5	uncultured_Caudovirales_phage	7.4e-75	93.1
WP_000793436.1\|1944604_1944967_+	DUF3168 domain-containing protein	A0A2H4JBW1	uncultured_Caudovirales_phage	1.4e-55	85.0
WP_001251821.1\|1944982_1945567_+\|tail	tail protein	A0A2H4JET9	uncultured_Caudovirales_phage	2.9e-98	93.3
WP_015382157.1\|1945623_1945998_+	hypothetical protein	A0A2H4JBU8	uncultured_Caudovirales_phage	1.8e-53	86.8
WP_001173498.1\|1946162_1951160_+\|tail	phage tail tape measure protein	A0A2H4JI37	uncultured_Caudovirales_phage	0.0e+00	80.5
WP_000093847.1\|1951199_1952669_+\|tail	phage tail family protein	A0A0S2MV63	Bacillus_phage	1.1e-231	78.3
WP_015382146.1\|1952665_1958230_+	hypothetical protein	A0A0S2MVB4	Bacillus_phage	0.0e+00	64.1
WP_015382147.1\|1958246_1958612_+	hypothetical protein	A0A0S2MVE0	Bacillus_phage	3.7e-35	59.0
WP_000390477.1\|1958738_1958963_+	hypothetical protein	A0A1B1P780	Bacillus_phage	1.1e-26	89.2
WP_000373855.1\|1959038_1959464_+\|holin	phage holin family protein	A0A1B1P787	Bacillus_phage	4.8e-71	97.2
WP_000403436.1\|1959463_1960402_+	N-acetylmuramoyl-L-alanine amidase	A0A0S2MV84	Bacillus_phage	3.3e-136	94.7
WP_042883360.1\|1961267_1961927_-	helix-turn-helix domain-containing protein	A0A2H4J441	uncultured_Caudovirales_phage	2.5e-34	41.0
WP_000283431.1\|1962129_1962342_+	hypothetical protein	A6M975	Geobacillus_virus	1.6e-11	63.0
WP_000531225.1\|1962544_1963303_+	ORF6C domain-containing protein	A0A2H4JBC7	uncultured_Caudovirales_phage	9.2e-97	69.0
WP_001189065.1\|1963314_1963509_+	hypothetical protein	A0A1C8E9A1	Bacillus_phage	1.7e-15	71.0
WP_000511420.1\|1963661_1964534_+	DnaD domain protein	A0A2H4J394	uncultured_Caudovirales_phage	6.8e-96	65.3
WP_000883316.1\|1964540_1964678_+	hypothetical protein	NA	NA	NA	NA
WP_000464425.1\|1964652_1965039_+	DUF1492 domain-containing protein	A0A288WG73	Bacillus_phage	2.6e-47	71.4
WP_033692154.1\|1965277_1966264_+	lysozyme family protein	A0A223LKM8	Bacillus_phage	1.7e-34	43.9
WP_000116992.1\|1967218_1968649_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_000364215.1\|1968797_1969208_-	DUF1878 family protein	NA	NA	NA	NA
WP_000405767.1\|1969808_1970705_+	N-acetylmuramoyl-L-alanine amidase family protein	A0A0S2MVR5	Bacillus_phage	4.1e-80	52.4
WP_000392442.1\|1970766_1970997_+\|bacteriocin	bacteriocin biosynthesis protein	A0A1B1P7Q9	Bacillus_phage	3.1e-24	77.6
WP_001102628.1\|1971368_1971692_+	PadR family transcriptional regulator	NA	NA	NA	NA
1971173:1971191	attR	NA	NA	NA	NA
WP_000031382.1\|1971684_1972227_+	DUF1700 domain-containing protein	NA	NA	NA	NA
WP_002164461.1\|1972227_1973031_+	DUF4097 family beta strand repeat protein	NA	NA	NA	NA
WP_000413738.1\|1973121_1973742_-	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	8.2e-19	62.2
WP_000991469.1\|1973883_1974540_+	recombinase family protein	NA	NA	NA	NA
WP_000607015.1\|1974585_1974825_+	DUF896 domain-containing protein	NA	NA	NA	NA
WP_001053969.1\|1976082_1977519_+\|transposase	IS4-like element IS231C family transposase	NA	NA	NA	NA
WP_000915065.1\|1978299_1979238_+	phosphate/phosphite/phosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000569241.1\|1979321_1980095_+	phosphonate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.6e-22	34.9
WP_001000763.1\|1980091_1980886_+	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_000047896.1\|1980885_1981689_+	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_000019766.1\|1981985_1983986_+	transketolase	NA	NA	NA	NA
WP_000860632.1\|1984142_1984583_+	sporulation inhibitor of replication protein SirA	NA	NA	NA	NA
WP_001123317.1\|1984661_1984883_+	YneF family protein	NA	NA	NA	NA
WP_000862455.1\|1985005_1986757_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	7.4e-49	29.4
WP_060851824.1\|1986756_1988520_+	ABC transporter ATP-binding protein	A0A076FI99	Aureococcus_anophage	1.2e-25	26.2
WP_001181399.1\|1988650_1989697_+	SH3 domain-containing protein	A0A1U9WQS3	Geobacillus_phage	3.4e-33	40.4
WP_001110279.1\|1989837_1990857_+	NERD domain-containing protein	A0A1L2JY40	Aeribacillus_phage	1.8e-26	28.7
WP_000644411.1\|1991670_1991817_+	BC1881 family protein	NA	NA	NA	NA
WP_000974659.1\|1991915_1992671_+	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_000625222.1\|1993032_1993239_-	DUF3903 domain-containing protein	NA	NA	NA	NA
WP_000442981.1\|1993381_1993795_+	NUDIX hydrolase	NA	NA	NA	NA
WP_000578954.1\|1993807_1994485_-	LrgB family protein	NA	NA	NA	NA
WP_000872365.1\|1994481_1994847_-\|holin	CidA/LrgA family holin-like protein	NA	NA	NA	NA

DBSCAN-SWA_10

2067059 : 2135169

Bacillus_phage(94.0%)

transposase,head,capsid,integrase,holin,protease,terminase,tail,portal

attL 2093600:2093617|attR 2135507:2135524

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_145977397.1\|2067059_2068254_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.6e-26	31.3
WP_000864729.1\|2068477_2069011_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_000368253.1\|2069023_2070022_+	hypothetical protein	NA	NA	NA	NA
WP_000526730.1\|2070039_2071077_+	LCP family protein	NA	NA	NA	NA
WP_060851831.1\|2071281_2072544_+	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_000730151.1\|2072890_2074588_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000823467.1\|2074886_2076602_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000823438.1\|2077043_2078738_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000828249.1\|2078820_2079540_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_000554997.1\|2079580_2079976_-	hypothetical protein	NA	NA	NA	NA
WP_000842902.1\|2080110_2080458_+	hypothetical protein	NA	NA	NA	NA
WP_000511515.1\|2080517_2080856_+	VOC family protein	NA	NA	NA	NA
WP_048538095.1\|2081112_2083212_+	VWA domain-containing protein	NA	NA	NA	NA
WP_000175104.1\|2083291_2086654_+	tubulin-like doman-containing protein	NA	NA	NA	NA
WP_001116195.1\|2086711_2086852_+	hypothetical protein	NA	NA	NA	NA
WP_000051657.1\|2087350_2088733_+	amino acid permease	NA	NA	NA	NA
WP_001252213.1\|2088807_2089944_-	spore germination protein GerSC	NA	NA	NA	NA
WP_000166517.1\|2089944_2091042_-	endospore germination permease	NA	NA	NA	NA
WP_000534525.1\|2091038_2092577_-	spore germination protein	NA	NA	NA	NA
WP_060851832.1\|2092943_2093669_+	(2Fe-2S)-binding protein	NA	NA	NA	NA
2093600:2093617	attL	NA	NA	NA	NA
WP_060851833.1\|2093642_2094734_-\|integrase	site-specific integrase	A0A0S2GLI2	Bacillus_phage	9.6e-164	79.8
WP_060851834.1\|2095555_2096776_+	hypothetical protein	A0A0U3TNF6	Bacillus_phage	9.2e-107	48.6
WP_171840946.1\|2097035_2097188_+	hypothetical protein	NA	NA	NA	NA
WP_060851835.1\|2097194_2097530_-	helix-turn-helix domain-containing protein	H0UST7	Bacillus_phage	8.6e-15	40.6
WP_060851836.1\|2097703_2097910_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_060852527.1\|2097985_2098174_+	helix-turn-helix domain-containing protein	A0A0S2GLE9	Bacillus_phage	4.6e-26	95.2
WP_171840947.1\|2098197_2098353_+	hypothetical protein	I7J4K2	Bacillus_phage	4.0e-23	96.1
WP_060851837.1\|2098391_2099216_+	ORF6C domain-containing protein	A0A0S2MV65	Bacillus_phage	8.7e-117	77.7
WP_000176230.1\|2099377_2099686_+	hypothetical protein	W8CYU1	Bacillus_phage	2.2e-41	92.6
WP_060851838.1\|2099711_2100359_+	sigma-70 family RNA polymerase sigma factor	A0A0S2GLJ1	Bacillus_phage	3.5e-113	96.7
WP_060851839.1\|2100602_2101619_+	hypothetical protein	A0A0S2GLI6	Bacillus_phage	1.8e-188	99.4
WP_060851840.1\|2101581_2102394_+	ATP-binding protein	W8CZ50	Bacillus_phage	3.0e-154	98.9
WP_060851841.1\|2102433_2102700_+	hypothetical protein	A0A0S2GLK4	Bacillus_phage	2.2e-37	92.0
WP_016098383.1\|2102771_2102936_+	DUF3954 domain-containing protein	A0A0S2GLF5	Bacillus_phage	2.9e-24	98.1
WP_060851842.1\|2102971_2103208_+	hypothetical protein	NA	NA	NA	NA
WP_060851843.1\|2103567_2103966_+	hypothetical protein	W8CYU3	Bacillus_phage	1.5e-69	98.5
WP_000965620.1\|2105374_2105656_+	hypothetical protein	A0A0S2GLD3	Bacillus_phage	1.9e-44	98.9
WP_002162928.1\|2105839_2105980_+	hypothetical protein	NA	NA	NA	NA
WP_060851844.1\|2106005_2106491_+	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	1.7e-83	97.5
WP_001012128.1\|2106487_2107030_+\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	3.3e-96	99.4
WP_060851845.1\|2107245_2107491_+	hypothetical protein	H0USV5	Bacillus_phage	3.0e-33	95.9
WP_060851846.1\|2107899_2108187_+	hypothetical protein	H0USV6	Bacillus_phage	2.8e-46	97.9
WP_060851848.1\|2108496_2108682_+	hypothetical protein	A0A0S2GLH7	Bacillus_phage	1.1e-24	98.4
WP_060851849.1\|2108710_2108950_+	hypothetical protein	A0A0S2GLE8	Bacillus_phage	4.4e-21	97.5
WP_060851850.1\|2108966_2109179_+	hypothetical protein	H0USV9	Bacillus_phage	1.0e-29	97.1
WP_042596524.1\|2109567_2109792_+	hypothetical protein	A0A0M4REP0	Bacillus_phage	2.4e-05	40.3
WP_060851852.1\|2109798_2110200_+	hypothetical protein	Q2I8B8	Bacillus_phage	4.5e-18	46.5
WP_060851853.1\|2110205_2110583_+	HNH endonuclease	H0USW1	Bacillus_phage	2.4e-66	95.2
WP_081097549.1\|2110712_2111216_+\|terminase	phage terminase small subunit P27 family	A0A0S2GLF2	Bacillus_phage	6.7e-88	99.4
WP_015382179.1\|2111217_2112912_+\|terminase	terminase large subunit	A0A0S2GLF0	Bacillus_phage	0.0e+00	100.0
WP_015382180.1\|2113100_2114354_+\|portal	phage portal protein	A0A0S2GLJ4	Bacillus_phage	3.5e-242	99.8
WP_045350343.1\|2114340_2115051_+\|protease	Clp protease ClpP	H0USW5	Bacillus_phage	9.4e-128	99.6
WP_060851854.1\|2115088_2116255_+\|capsid	phage major capsid protein	W8CYN2	Bacillus_phage	4.7e-209	99.5
WP_060851855.1\|2116275_2116563_+\|head,tail	phage gp6-like head-tail connector protein	A0A0S2GLH6	Bacillus_phage	6.8e-45	100.0
WP_060851856.1\|2116549_2116873_+\|head	phage head closure protein	H0USW8	Bacillus_phage	8.2e-55	96.3
WP_060851857.1\|2116865_2117300_+	HK97 gp10 family phage protein	H0USW9	Bacillus_phage	9.6e-75	96.5
WP_000981497.1\|2117296_2117656_+	DUF3168 domain-containing protein	A0A0S2GLE3	Bacillus_phage	1.4e-58	95.0
WP_060851858.1\|2117656_2118262_+\|tail	phage tail protein	A0A0S2GLI0	Bacillus_phage	1.7e-98	99.0
WP_060851859.1\|2118308_2118626_+	hypothetical protein	A0A0S2GLH2	Bacillus_phage	5.8e-53	99.0
WP_000344048.1\|2118655_2118832_+	hypothetical protein	I3WTY5	Bacillus_phage	1.1e-26	100.0
WP_060851860.1\|2118846_2122695_+\|tail	phage tail tape measure protein	A0A2H4J380	uncultured_Caudovirales_phage	0.0e+00	91.7
WP_081097550.1\|2122709_2124191_+\|tail	phage tail family protein	H0USX4	Bacillus_phage	2.4e-282	93.7
WP_060851861.1\|2124187_2128276_+\|tail	tail fiber domain-containing protein	H0USX5	Bacillus_phage	0.0e+00	79.8
WP_081097551.1\|2128368_2129337_+\|integrase	site-specific integrase	A0A0S2MVF5	Bacillus_phage	6.9e-182	98.4
WP_000373869.1\|2129353_2129779_+\|holin	phage holin family protein	A0A1B1P787	Bacillus_phage	9.7e-72	99.3
WP_060851863.1\|2129778_2130714_+	N-acetylmuramoyl-L-alanine amidase	A0A0S2MVR5	Bacillus_phage	1.4e-184	98.1
WP_060851864.1\|2130790_2131594_-	hypothetical protein	A6M971	Geobacillus_virus	7.1e-23	41.3
WP_060851865.1\|2131593_2131800_-	helix-turn-helix transcriptional regulator	A0A288WG80	Bacillus_phage	1.1e-07	43.1
WP_060851866.1\|2131988_2132291_+	hypothetical protein	H0USY0	Bacillus_phage	2.4e-48	100.0
WP_060851867.1\|2132293_2132476_+	hypothetical protein	Q2I8E2	Bacillus_phage	3.6e-23	91.7
WP_060851868.1\|2132591_2133773_+	cell division protein FtsK	H0USY1	Bacillus_phage	6.4e-214	93.1
WP_060851869.1\|2133714_2134335_+	replication-relaxation family protein	H0USY2	Bacillus_phage	7.7e-110	95.1
WP_060851870.1\|2134344_2135169_-	helix-turn-helix domain-containing protein	A0A1C8EA76	Bacillus_phage	2.5e-103	71.0
2135507:2135524	attR	NA	NA	NA	NA

DBSCAN-SWA_11

2484376 : 2556980

Bacillus_phage(50.0%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000275829.1\|2484376_2485000_-\|protease	protease synthase/sporulation negative transcriptional regulator PaiB	NA	NA	NA	NA
WP_000207068.1\|2485022_2485541_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000658990.1\|2485566_2486019_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_060851919.1\|2486134_2486803_+	YitT family protein	NA	NA	NA	NA
WP_000781961.1\|2486883_2487561_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.0e-62	53.0
WP_060851920.1\|2487562_2488939_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	9.9e-57	40.6
WP_000820996.1\|2489140_2489611_+	DinB family protein	NA	NA	NA	NA
WP_060851921.1\|2489720_2490980_-	MFS transporter	NA	NA	NA	NA
WP_048538247.1\|2491049_2491673_-	ArsR family transcriptional regulator	NA	NA	NA	NA
WP_006922800.1\|2491857_2492922_+	ABC transporter permease	NA	NA	NA	NA
WP_000202606.1\|2492921_2493593_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-36	38.6
WP_060851922.1\|2493657_2494770_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_060851923.1\|2494910_2495501_-	AAA family ATPase	NA	NA	NA	NA
WP_081097557.1\|2495715_2496648_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_000916240.1\|2496785_2497004_+	RtcB family protein	A0A223LGY9	Bacillus_phage	1.2e-28	84.7
WP_060851925.1\|2497286_2498246_+	RtcB family protein	A0A222Z820	Bacillus_phage	2.2e-143	78.6
WP_060851926.1\|2498574_2499807_+	DUF4073 domain-containing protein	NA	NA	NA	NA
WP_044307402.1\|2500164_2501160_+	D-cysteine desulfhydrase	NA	NA	NA	NA
WP_000554419.1\|2501244_2501841_-	hypothetical protein	NA	NA	NA	NA
WP_000005108.1\|2502268_2503747_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_048519423.1\|2504316_2507514_+	bifunctional P-450/NADPH--P450 reductase	V5UQK0	Mycobacterium_phage	1.5e-79	38.1
WP_060851927.1\|2507725_2509837_-	TerD family protein	A0A1I9SAC2	Rhodococcus_phage	1.5e-67	31.7
WP_000022543.1\|2510387_2510816_+	DUF5412 domain-containing protein	NA	NA	NA	NA
WP_000636463.1\|2511124_2512066_+	class A beta-lactamase	A0A1B0VBP7	Salmonella_phage	5.4e-54	44.2
WP_000444089.1\|2512256_2512943_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.4e-40	40.0
WP_000800285.1\|2512939_2514016_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.4e-18	29.5
WP_000595170.1\|2514261_2515023_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.0e-35	40.5
WP_000897821.1\|2515039_2516869_+	ABC transporter permease	NA	NA	NA	NA
WP_060851928.1\|2517032_2518820_-	response regulator	Q6XM27	Feldmannia_irregularis_virus	6.0e-06	34.5
WP_060851929.1\|2518935_2519514_-	sensor domain-containing protein	NA	NA	NA	NA
WP_060851554.1\|2520863_2522075_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	4.4e-69	37.9
WP_002183718.1\|2523157_2524036_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_060851930.1\|2524673_2526119_+	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_001104104.1\|2526465_2526681_+	hypothetical protein	NA	NA	NA	NA
WP_060851931.1\|2526872_2528246_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.2e-25	27.8
WP_001264525.1\|2528242_2528917_-	response regulator transcription factor	W8CYM9	Bacillus_phage	2.4e-32	33.9
WP_060851932.1\|2529184_2529655_+	hypothetical protein	NA	NA	NA	NA
WP_025686869.1\|2529675_2529999_+	hypothetical protein	NA	NA	NA	NA
WP_000655287.1\|2530612_2531857_+	MFS transporter	NA	NA	NA	NA
WP_000549725.1\|2531871_2533131_+	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_000499523.1\|2533374_2534568_-\|transposase	IS110-like element ISBth13 family transposase	A0A0U3ULR1	Bacillus_phage	1.1e-24	26.1
WP_000441009.1\|2534866_2535028_+	hypothetical protein	NA	NA	NA	NA
WP_002204749.1\|2535445_2535832_+	DUF1259 domain-containing protein	NA	NA	NA	NA
WP_001048567.1\|2536337_2536757_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_033690982.1\|2537086_2537437_+	DoxX family protein	NA	NA	NA	NA
WP_000323764.1\|2537633_2537939_+	monooxygenase	NA	NA	NA	NA
WP_000802592.1\|2538180_2539050_-	DMT family transporter	NA	NA	NA	NA
WP_000059810.1\|2539170_2540043_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_001014149.1\|2540451_2541771_-	septum formation initiator	NA	NA	NA	NA
WP_059304306.1\|2542935_2544102_+	serine hydrolase	A0A1D8EXR7	Mycobacterium_phage	2.2e-20	26.2
WP_059304307.1\|2544195_2546280_+	serine hydrolase	NA	NA	NA	NA
WP_000169655.1\|2547631_2548222_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_060851933.1\|2548814_2549624_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_002164503.1\|2550228_2550663_+	hypothetical protein	NA	NA	NA	NA
WP_060851934.1\|2550900_2551680_+	DUF1510 family protein	NA	NA	NA	NA
WP_000833211.1\|2554169_2554523_+	YxeA family protein	A0A0K2CYS5	Paenibacillus_phage	2.2e-13	38.0
WP_000364215.1\|2554990_2555401_+	DUF1878 family protein	NA	NA	NA	NA
WP_000116992.1\|2555549_2556980_+\|transposase	IS4 family transposase	NA	NA	NA	NA

DBSCAN-SWA_12

3712257 : 3760927

Bacillus_phage(27.27%)

protease,coat,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000340527.1\|3712257_3712716_-\|coat	spore coat protein	NA	NA	NA	NA
WP_002023919.1\|3712747_3713932_-	cardiolipin synthase	NA	NA	NA	NA
WP_000505094.1\|3714092_3714179_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_000141164.1\|3714305_3714812_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_001053969.1\|3714914_3716351_+\|transposase	IS4-like element IS231C family transposase	NA	NA	NA	NA
WP_000488043.1\|3716597_3717467_-	TIGR03943 family protein	NA	NA	NA	NA
WP_000418716.1\|3717470_3718367_-	permease	NA	NA	NA	NA
WP_000932389.1\|3718564_3719506_-	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_000678845.1\|3719838_3721218_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_000880691.1\|3721315_3721918_-	DedA family protein	NA	NA	NA	NA
WP_000153584.1\|3722022_3722640_-	NUDIX hydrolase	NA	NA	NA	NA
WP_017656823.1\|3722744_3723821_-\|coat	spore coat protein CotH	NA	NA	NA	NA
WP_000817498.1\|3724002_3724581_+	exosporium protein ExsB	NA	NA	NA	NA
WP_000858827.1\|3724626_3725238_-	phosphoserine phosphatase 1	NA	NA	NA	NA
WP_000543107.1\|3725251_3725797_-	short-chain dehydrogenase	NA	NA	NA	NA
WP_000943775.1\|3725810_3726227_-	FosB/FosD family fosfomycin resistance bacillithiol transferase	Q2LI91	Bacillus_phage	1.8e-38	64.0
WP_000824276.1\|3726286_3727948_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002164561.1\|3728032_3729019_-	DUF2628 domain-containing protein	NA	NA	NA	NA
WP_000283910.1\|3729044_3729497_-	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	1.1e-25	41.0
WP_001086168.1\|3729630_3730668_+	NADPH dehydrogenase NamA	NA	NA	NA	NA
WP_001042735.1\|3730697_3731357_-	oxidoreductase	NA	NA	NA	NA
WP_001053969.1\|3731562_3732999_+\|transposase	IS4-like element IS231C family transposase	NA	NA	NA	NA
WP_053512689.1\|3733081_3733234_-	hypothetical protein	NA	NA	NA	NA
WP_001126148.1\|3733499_3734450_+	zinc ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_001048677.1\|3734588_3735059_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000613422.1\|3735171_3736122_-	GTP-binding protein	NA	NA	NA	NA
WP_060852188.1\|3736287_3737190_+	aldo/keto reductase	A0A1V0SDE7	Indivirus	1.5e-08	25.1
WP_001068750.1\|3737214_3737799_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_001168130.1\|3737883_3739347_-	flavin monoamine oxidase family protein	A0A2K9L022	Tupanvirus	2.6e-15	21.6
WP_000683368.1\|3739525_3739717_+	DUF3896 domain-containing protein	NA	NA	NA	NA
WP_000594045.1\|3739821_3740823_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_000798324.1\|3740867_3741812_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_000488210.1\|3742025_3742481_-	DUF3939 domain-containing protein	NA	NA	NA	NA
WP_000105199.1\|3742584_3743028_-	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	6.2e-45	62.1
WP_000370204.1\|3743268_3744309_+	membrane protein	NA	NA	NA	NA
WP_000965068.1\|3744343_3744709_-	DUF3979 family protein	NA	NA	NA	NA
WP_000539569.1\|3745031_3745337_-	hypothetical protein	NA	NA	NA	NA
WP_000517290.1\|3745533_3747516_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.1e-29	34.2
WP_001073045.1\|3747716_3748766_-	ribosome small subunit-dependent GTPase A	NA	NA	NA	NA
WP_000687340.1\|3748948_3749476_-	DUF664 domain-containing protein	NA	NA	NA	NA
WP_000426317.1\|3749672_3750020_+	DUF4257 domain-containing protein	NA	NA	NA	NA
WP_000162602.1\|3750104_3750329_+	hypothetical protein	NA	NA	NA	NA
WP_001198796.1\|3750528_3750891_-	DUF805 domain-containing protein	NA	NA	NA	NA
WP_002197676.1\|3751289_3751553_-	hypothetical protein	NA	NA	NA	NA
WP_060852189.1\|3751678_3752626_-\|protease	serine protease	A0A127AWU5	Bacillus_phage	1.7e-95	57.8
WP_000648324.1\|3752901_3753189_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	7.6e-12	55.7
WP_017656811.1\|3753305_3755186_-	ABC transporter permease	NA	NA	NA	NA
WP_000174904.1\|3755456_3756275_+	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	3.9e-93	63.0
WP_000024992.1\|3756324_3756786_-	NUDIX hydrolase	A0A2I6PFL2	Proteus_phage	6.5e-05	35.1
WP_002183486.1\|3756817_3757015_-	DUF4083 domain-containing protein	NA	NA	NA	NA
WP_000520862.1\|3757119_3758280_-	peptidase	NA	NA	NA	NA
WP_001034844.1\|3758430_3759183_-	DUF1963 domain-containing protein	NA	NA	NA	NA
WP_000540425.1\|3759406_3759553_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_000499523.1\|3759733_3760927_-\|transposase	IS110-like element ISBth13 family transposase	A0A0U3ULR1	Bacillus_phage	1.1e-24	26.1

DBSCAN-SWA_13

3774563 : 3839251

Bacillus_phage(88.52%)

transposase,capsid,tail,terminase,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085961003.1\|3774563_3775918_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	7.3e-129	85.5
WP_000119510.1\|3775999_3776680_-	MgtC/SapB family protein	G3MA03	Bacillus_virus	2.2e-17	41.0
WP_000873566.1\|3776839_3777496_-	YkyA family protein	NA	NA	NA	NA
WP_000409484.1\|3777510_3778332_-	polysaccharide deacetylase	NA	NA	NA	NA
WP_000824535.1\|3778433_3779792_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	6.4e-40	31.3
WP_000036068.1\|3779788_3780478_-	response regulator transcription factor	W8CYM9	Bacillus_phage	6.1e-31	33.6
WP_001174859.1\|3780490_3781738_-	hypothetical protein	NA	NA	NA	NA
WP_002182662.1\|3781902_3782904_-	LCP family protein	NA	NA	NA	NA
WP_048538790.1\|3783224_3785540_-	glycoside hydrolase	NA	NA	NA	NA
WP_001031479.1\|3785747_3785957_-	hypothetical protein	NA	NA	NA	NA
WP_000612682.1\|3786090_3786984_-	homoserine kinase	NA	NA	NA	NA
WP_000276434.1\|3786980_3788039_-	threonine synthase	NA	NA	NA	NA
WP_048538791.1\|3788031_3789327_-	homoserine dehydrogenase	NA	NA	NA	NA
WP_000510730.1\|3790445_3791084_-	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_000141352.1\|3791165_3791774_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_031312782.1\|3791821_3792160_-	SdpI family protein	NA	NA	NA	NA
WP_000291201.1\|3792232_3793060_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_001258504.1\|3793178_3794051_-	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	1.2e-63	44.7
WP_000818985.1\|3794341_3795061_-	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_048538792.1\|3795279_3795846_+	DUF3139 domain-containing protein	NA	NA	NA	NA
WP_001231621.1\|3795870_3796944_-	HAMP domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	6.1e-187	98.0
WP_000612414.1\|3796940_3797618_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.1e-122	99.1
WP_016124454.1\|3797704_3797962_-	hypothetical protein	W8CYT2	Bacillus_phage	2.9e-26	98.3
WP_060852191.1\|3797992_3798784_-	N-acetylmuramoyl-L-alanine amidase	A0A1B1P7K2	Bacillus_phage	3.2e-153	98.5
WP_000427019.1\|3798842_3799130_-	hypothetical protein	W8CZ40	Bacillus_phage	6.2e-46	100.0
WP_060852192.1\|3799139_3804479_-	hypothetical protein	K4LNZ9	Bacillus_virus	0.0e+00	92.8
WP_060852193.1\|3804482_3805997_-\|tail	phage tail family protein	W8CYX4	Bacillus_phage	1.3e-299	99.2
WP_060852194.1\|3806008_3808852_-\|tail	phage tail tape measure protein	K4LRV6	Bacillus_virus	0.0e+00	96.7
WP_060852195.1\|3808854_3809127_-	hypothetical protein	W8CYM7	Bacillus_phage	8.5e-45	97.8
WP_060852196.1\|3809147_3809567_-	hypothetical protein	W8CYT0	Bacillus_phage	2.9e-68	96.4
WP_000561467.1\|3809632_3810298_-	hypothetical protein	A0A1B1P7K6	Bacillus_phage	2.2e-126	100.0
WP_060852197.1\|3810316_3810718_-	hypothetical protein	A0A1B1P7K0	Bacillus_phage	2.3e-70	98.5
WP_060852198.1\|3810714_3811131_-	hypothetical protein	W8CYF3	Bacillus_phage	4.4e-69	97.8
WP_060852199.1\|3811130_3811463_-	hypothetical protein	W8CYM6	Bacillus_phage	1.3e-55	98.2
WP_060852200.1\|3811466_3811832_-	hypothetical protein	W8CYS9	Bacillus_phage	4.6e-62	99.2
WP_060852201.1\|3811868_3812705_-	hypothetical protein	A0A1B1P7J5	Bacillus_phage	6.0e-150	96.8
WP_060852202.1\|3812781_3813393_-	DUF4355 domain-containing protein	A0A1B1P7J6	Bacillus_phage	7.4e-81	86.2
WP_000677148.1\|3813493_3813694_-	hypothetical protein	W8CYM5	Bacillus_phage	2.2e-26	97.0
WP_060852203.1\|3813702_3814728_-\|capsid	minor capsid protein	K4LP29	Bacillus_virus	1.2e-189	98.8
WP_060852204.1\|3814731_3816204_-\|portal	phage portal protein	A0A1B1P7K9	Bacillus_phage	1.1e-279	99.2
WP_060852205.1\|3816217_3817537_-\|terminase	PBSX family phage terminase large subunit	W8CZ36	Bacillus_phage	6.2e-258	97.9
WP_145977411.1\|3817631_3817853_-	hypothetical protein	NA	NA	NA	NA
WP_060852207.1\|3817852_3818332_-\|terminase	terminase small subunit	W8CYF1	Bacillus_phage	9.3e-87	99.4
WP_000432374.1\|3818426_3818696_-	hypothetical protein	W8CYM4	Bacillus_phage	4.6e-43	100.0
WP_016064726.1\|3818695_3818959_-	hypothetical protein	W8CYS7	Bacillus_phage	2.2e-45	100.0
WP_060852208.1\|3818930_3819215_-	hypothetical protein	W8CYW3	Bacillus_phage	2.2e-48	98.9
WP_060852210.1\|3820671_3820914_-	hypothetical protein	W8CYF0	Bacillus_phage	7.5e-37	96.2
WP_060852211.1\|3821217_3821487_-	hypothetical protein	K4LPB5	Bacillus_virus	3.8e-29	68.1
WP_016064723.1\|3821604_3821769_-	hypothetical protein	W8CYS6	Bacillus_phage	8.4e-24	100.0
WP_002162844.1\|3822121_3822274_-	hypothetical protein	W8CZ34	Bacillus_phage	1.8e-20	98.0
WP_171840932.1\|3822273_3822441_-	hypothetical protein	A0A1B1P7H5	Bacillus_phage	3.1e-21	96.4
WP_060852212.1\|3822425_3823025_-	DUF1064 domain-containing protein	A0A1B1P7H7	Bacillus_phage	1.5e-110	98.5
WP_016064719.1\|3822996_3823143_-	hypothetical protein	W8CYM2	Bacillus_phage	6.8e-17	100.0
WP_060852213.1\|3823139_3823370_-	hypothetical protein	A0A1B1P7I3	Bacillus_phage	8.8e-35	97.4
WP_060852214.1\|3823366_3823582_-	hypothetical protein	A0A1B1P7I9	Bacillus_phage	2.0e-09	54.9
WP_060852542.1\|3823775_3825110_-	hypothetical protein	W8CYE8	Bacillus_phage	7.7e-256	99.8
WP_015994862.1\|3825147_3825348_-	NINE protein	A0A1B1P7I0	Bacillus_phage	1.6e-32	100.0
WP_060852216.1\|3825471_3825972_-	hypothetical protein	A0A1B1P7G1	Bacillus_phage	1.0e-88	97.0
WP_153598354.1\|3826102_3826249_-	hypothetical protein	A0A1B1P7F9	Bacillus_phage	1.1e-06	46.9
WP_060852217.1\|3826248_3826455_-	hypothetical protein	W8CYE7	Bacillus_phage	3.4e-30	88.2
WP_060852218.1\|3826447_3826729_-	hypothetical protein	W8CYM0	Bacillus_phage	1.3e-19	51.0
WP_060852219.1\|3826728_3827079_-	hypothetical protein	NA	NA	NA	NA
WP_081097588.1\|3827247_3828126_-	Rha family transcriptional regulator	W8CYS3	Bacillus_phage	2.3e-91	74.2
WP_000571723.1\|3828122_3828302_-	hypothetical protein	NA	NA	NA	NA
WP_060852220.1\|3828314_3829127_-	hypothetical protein	W8CYV0	Bacillus_phage	6.3e-152	96.3
WP_060852221.1\|3829144_3829732_-	hypothetical protein	W8CZ31	Bacillus_phage	3.9e-103	96.4
WP_060852222.1\|3830296_3830611_-	hypothetical protein	W8CYL9	Bacillus_phage	5.0e-49	93.3
WP_060852223.1\|3830615_3831308_-	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	1.3e-118	91.3
WP_060852224.1\|3831288_3831498_-	hypothetical protein	A0A1B1P7F7	Bacillus_phage	4.7e-19	71.2
WP_060852225.1\|3831509_3831995_-	siphovirus Gp157 family protein	W8CYU7	Bacillus_phage	2.4e-74	91.3
WP_016064702.1\|3832007_3832181_-	hypothetical protein	W8CZ30	Bacillus_phage	1.2e-23	100.0
WP_060852226.1\|3832180_3832450_-	hypothetical protein	W8CYE5	Bacillus_phage	1.2e-46	98.9
WP_060852227.1\|3832421_3832679_-	hypothetical protein	A0A1B1P7G5	Bacillus_phage	1.8e-33	94.1
WP_016064699.1\|3832794_3833043_-	helix-turn-helix transcriptional regulator	W8CYU5	Bacillus_phage	8.3e-39	100.0
WP_060852228.1\|3833293_3833926_+	helix-turn-helix domain-containing protein	A0A1B1P7E9	Bacillus_phage	2.7e-110	99.5
WP_060852229.1\|3833925_3835308_+	recombinase family protein	B8R885	Bacillus_phage	1.4e-265	99.8
WP_060852230.1\|3835285_3836860_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.5e-282	98.9
WP_001194306.1\|3837100_3837865_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_000755507.1\|3837964_3839251_-	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	3.4e-11	31.5

DBSCAN-SWA_14

4009962 : 4019346

Brevibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000277551.1\|4009962_4010553_+	helix-turn-helix domain-containing protein	A0A0K2CNS5	Brevibacillus_phage	2.3e-26	43.4
WP_001005178.1\|4010611_4011382_+	ATP-binding protein	A0A0K2CNX1	Brevibacillus_phage	2.0e-62	48.8
WP_001139155.1\|4011861_4013154_+	DNA helicase	A0A0K2CP24	Brevibacillus_phage	2.0e-139	57.9
WP_001167933.1\|4013178_4014255_+	toprim domain-containing protein	A0A0K2CNW6	Brevibacillus_phage	5.8e-105	54.3
WP_060852242.1\|4014282_4014840_+	sigma-70 family RNA polymerase sigma factor	A0A0K2CPD2	Brevibacillus_phage	1.2e-24	40.5
WP_000207534.1\|4015301_4015961_+	hypothetical protein	A0A0K2CPH8	Brevibacillus_phage	4.7e-57	56.9
WP_060852243.1\|4016047_4017442_+	hypothetical protein	A0A0K2CP19	Brevibacillus_phage	3.2e-103	45.6
WP_000781409.1\|4018065_4018470_+	hypothetical protein	NA	NA	NA	NA
WP_000177372.1\|4018638_4019346_+	DNA polymerase I	A0A0K2CNW2	Brevibacillus_phage	7.3e-64	53.5

DBSCAN-SWA_15

4033338 : 4044218

Brevibacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060852245.1\|4033338_4037694_-	DNRLRE domain-containing protein	A0A0K2CP88	Brevibacillus_phage	5.4e-32	23.7
WP_000350104.1\|4037736_4040628_-	hypothetical protein	A0A127AW61	Bacillus_phage	4.8e-13	33.0
WP_000602965.1\|4040612_4041224_-	hypothetical protein	A0A127AW14	Bacillus_phage	2.2e-48	51.6
WP_001111326.1\|4041264_4041756_-	hypothetical protein	A0A0K2CNZ3	Brevibacillus_phage	2.4e-37	55.2
WP_000345536.1\|4041831_4042275_-	hypothetical protein	A0A0K2CPK2	Brevibacillus_phage	3.0e-23	40.6
WP_000537240.1\|4042353_4043085_-	hypothetical protein	NA	NA	NA	NA
WP_000022193.1\|4043096_4044218_-	hypothetical protein	A0A0K2CPP1	Brevibacillus_phage	7.3e-66	37.0

DBSCAN-SWA_16

4057131 : 4073990

Brevibacillus_phage(100.0%)

tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001145940.1\|4057131_4059717_-	hypothetical protein	A0A0K2CPJ7	Brevibacillus_phage	1.6e-31	43.5
WP_000007798.1\|4059732_4060173_-	hypothetical protein	NA	NA	NA	NA
WP_000057630.1\|4060187_4060904_-	hypothetical protein	NA	NA	NA	NA
WP_001134181.1\|4060982_4064174_-	M23 family metallopeptidase	A0A0K2CNY2	Brevibacillus_phage	3.7e-06	50.0
WP_001126624.1\|4064186_4065260_-	hypothetical protein	A0A0K2CP35	Brevibacillus_phage	4.1e-74	40.3
WP_000068595.1\|4065262_4065880_-	S-layer homology domain-containing protein	A0A0K2CPJ2	Brevibacillus_phage	8.3e-72	60.7
WP_060852250.1\|4065938_4071278_-\|tail	phage tail tape measure protein	A0A0K2CPN3	Brevibacillus_phage	2.3e-141	26.8
WP_000743719.1\|4071350_4071593_-	hypothetical protein	A0A0K2CP74	Brevibacillus_phage	2.1e-18	55.0
WP_000004090.1\|4071679_4072150_-	hypothetical protein	A0A0K2CPC8	Brevibacillus_phage	9.9e-33	70.3
WP_000077128.1\|4072383_4073472_-	hypothetical protein	A0A0K2CNX7	Brevibacillus_phage	1.2e-94	55.8
WP_002062978.1\|4073471_4073990_-	hypothetical protein	A0A0K2CP30	Brevibacillus_phage	4.4e-26	45.8

DBSCAN-SWA_17

4564555 : 4704018

170

Bacillus_phage(47.52%)

transposase,head,capsid,plate,holin,protease,tail,tRNA,terminase,portal,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_145977397.1\|4564555_4565750_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.6e-26	31.3
WP_000003349.1\|4565805_4567632_-	oligoendopeptidase F	A0A1X9I5X5	Streptococcus_phage	1.1e-63	26.7
WP_000628313.1\|4567682_4568927_-	competence protein	NA	NA	NA	NA
WP_000799194.1\|4569007_4570552_-	cardiolipin synthase	NA	NA	NA	NA
WP_060852307.1\|4570624_4571308_-	adaptor protein MecA	NA	NA	NA	NA
WP_000362607.1\|4571653_4572328_+	TerC family protein	W8EBD0	Pseudomonas_phage	3.4e-26	42.6
WP_000258267.1\|4572377_4572773_-	transcriptional regulator Spx	NA	NA	NA	NA
WP_000559971.1\|4573366_4573570_+	hypothetical protein	NA	NA	NA	NA
WP_060852308.1\|4573600_4575247_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002164600.1\|4575600_4577046_+	MATE family efflux transporter	NA	NA	NA	NA
WP_000166348.1\|4577189_4578125_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.1e-22	33.5
WP_000854346.1\|4578117_4579161_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-18	29.2
WP_000974106.1\|4579179_4580196_-	ABC transporter permease	NA	NA	NA	NA
WP_000534167.1\|4580192_4581122_-	ABC transporter permease	NA	NA	NA	NA
WP_000727217.1\|4581248_4582904_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_001044997.1\|4583223_4583604_+	DUF3899 domain-containing protein	NA	NA	NA	NA
WP_060852309.1\|4584002_4584992_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_000966127.1\|4585339_4586086_-	YjbA family protein	A0A0A0RP53	Bacillus_phage	1.8e-44	40.5
WP_000513279.1\|4586229_4587018_-	hypothetical protein	NA	NA	NA	NA
WP_000412656.1\|4587124_4588363_-	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_001100547.1\|4588394_4589327_-	beta-ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_001986215.1\|4589715_4589892_-	competence protein ComG	NA	NA	NA	NA
WP_002164601.1\|4589946_4590819_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_000028712.1\|4590848_4591583_-	hydrolase	NA	NA	NA	NA
WP_001211116.1\|4591739_4591922_+	YjzD family protein	NA	NA	NA	NA
WP_000365403.1\|4591960_4594561_-	ATP-dependent chaperone ClpB	K4FB40	Cronobacter_phage	2.4e-120	33.1
WP_000531421.1\|4594770_4594950_-	YjzC family protein	NA	NA	NA	NA
WP_060852310.1\|4595442_4596252_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_000516816.1\|4596357_4596498_+	hypothetical protein	NA	NA	NA	NA
WP_000527407.1\|4596498_4596696_+	DUF3813 domain-containing protein	NA	NA	NA	NA
WP_000364431.1\|4596721_4597579_-	YitT family protein	NA	NA	NA	NA
WP_001120851.1\|4597679_4597811_+	DUF3941 domain-containing protein	NA	NA	NA	NA
WP_001214214.1\|4597939_4598797_+	peptidylprolyl isomerase PrsA	NA	NA	NA	NA
WP_000281260.1\|4598850_4599705_-	hypothetical protein	NA	NA	NA	NA
WP_001040149.1\|4599935_4600427_+	YajQ family cyclic di-GMP-binding protein	NA	NA	NA	NA
WP_060852311.1\|4601279_4602176_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_060852312.1\|4602481_4603837_-	alpha-amylase	NA	NA	NA	NA
WP_001055849.1\|4603995_4605228_+	ammonium transporter	NA	NA	NA	NA
WP_001069176.1\|4605495_4606962_-	catalase	A0A2K9L572	Tupanvirus	1.2e-124	51.4
WP_000727377.1\|4607021_4607981_-	ferrochelatase	NA	NA	NA	NA
WP_060852313.1\|4608460_4609285_+	helix-turn-helix domain-containing protein	A0A2H4J969	uncultured_Caudovirales_phage	6.6e-133	89.7
WP_053512216.1\|4609301_4609595_-	YolD-like family protein	A0A1C8E992	Bacillus_phage	1.6e-44	90.7
WP_053512217.1\|4609618_4609837_-	hypothetical protein	A0A1C8E991	Bacillus_phage	2.1e-30	91.7
WP_000930621.1\|4609986_4610658_+	hypothetical protein	A0A1C8E993	Bacillus_phage	5.1e-115	98.7
WP_000119474.1\|4610722_4611052_+	hypothetical protein	A0A1C8E989	Bacillus_phage	2.8e-50	100.0
WP_060852314.1\|4611572_4612625_-	N-acetylmuramoyl-L-alanine amidase	A0A1B1P7Q1	Bacillus_phage	3.0e-199	97.7
WP_060852315.1\|4612621_4612852_-\|bacteriocin	bacteriocin biosynthesis protein	A0A1B1P7Q9	Bacillus_phage	2.4e-32	94.7
WP_060852316.1\|4612969_4614151_-\|plate	BppU family phage baseplate upper protein	A0A1B1P768	Bacillus_phage	1.5e-149	69.9
WP_060852317.1\|4614165_4616508_-\|tail	phage tail protein	A0A1B1P7P0	Bacillus_phage	0.0e+00	97.8
WP_060852318.1\|4616504_4617188_-\|tail	phage tail family protein	A0A1C8EA72	Bacillus_phage	1.3e-129	99.1
WP_060852319.1\|4617189_4620711_-\|tail	phage tail tape measure protein	A0A1C8E982	Bacillus_phage	3.0e-291	99.1
WP_006927278.1\|4620727_4620916_-	hypothetical protein	A0A1C8E979	Bacillus_phage	8.2e-31	98.4
WP_060852320.1\|4620954_4621341_-	hypothetical protein	A0A1B1P7Q6	Bacillus_phage	3.6e-65	99.2
WP_000215489.1\|4621352_4621988_-	hypothetical protein	A0A1B1P7Q4	Bacillus_phage	6.7e-117	100.0
WP_060852321.1\|4621999_4622377_-	HK97 gp10 family phage protein	A0A2H4JDG0	uncultured_Caudovirales_phage	5.1e-56	87.2
WP_060852322.1\|4622376_4622706_-	hypothetical protein	A0A1B1P7P2	Bacillus_phage	5.2e-57	99.1
WP_060852323.1\|4622695_4623031_-	hypothetical protein	A0A1C8E986	Bacillus_phage	7.2e-54	97.2
WP_060852324.1\|4623005_4623266_-\|head,tail	phage head-tail connector protein	A0A1C8E967	Bacillus_phage	1.2e-40	97.7
WP_060852325.1\|4623267_4624584_-\|capsid	phage major capsid protein	A0A1C8E976	Bacillus_phage	3.6e-189	88.5
WP_053512992.1\|4624585_4625167_-\|head,protease	HK97 family phage prohead protease	A0A1C8EA63	Bacillus_phage	1.1e-97	96.9
WP_053512993.1\|4625156_4626341_-\|portal	phage portal protein	A0A1B1P7N5	Bacillus_phage	2.3e-219	98.0
WP_060852326.1\|4626379_4626595_-	hypothetical protein	A0A1C8E977	Bacillus_phage	6.7e-29	90.1
WP_053512998.1\|4626594_4626807_-	hypothetical protein	A0A1C8E971	Bacillus_phage	6.8e-34	95.7
WP_060852327.1\|4626821_4628543_-\|terminase	terminase large subunit	A0A1B2AQ28	Phage_Wrath	0.0e+00	93.6
WP_060852328.1\|4629094_4629460_-	HNH endonuclease	A0A2H4JA38	uncultured_Caudovirales_phage	1.5e-41	65.3
WP_060852329.1\|4629456_4629771_-	hypothetical protein	A0A1B0T6C6	Bacillus_phage	2.2e-44	85.6
WP_060852545.1\|4629767_4630106_-	hypothetical protein	A0A1C8E9B7	Bacillus_phage	2.6e-27	57.5
WP_060852330.1\|4630435_4630828_-	hypothetical protein	A0A288WG73	Bacillus_phage	1.6e-44	65.4
WP_060852331.1\|4631011_4631203_-	hypothetical protein	NA	NA	NA	NA
WP_016097914.1\|4631275_4631713_-	hypothetical protein	A0A2H4JBP0	uncultured_Caudovirales_phage	1.3e-71	95.2
WP_001273080.1\|4631746_4632286_-	ERCC4 domain-containing protein	A0A2H4J819	uncultured_Caudovirales_phage	1.1e-88	91.1
WP_001206918.1\|4632288_4632657_-	hypothetical protein	B4XYT8	Lactobacillus_phage	1.4e-13	41.7
WP_060852332.1\|4632659_4633094_-	hypothetical protein	A0A2H4J832	uncultured_Caudovirales_phage	1.1e-54	73.9
WP_060852333.1\|4633095_4633470_-	hypothetical protein	NA	NA	NA	NA
WP_060852334.1\|4633760_4636148_-	DNA primase	A0A2H4JEX8	uncultured_Caudovirales_phage	0.0e+00	94.5
WP_060851531.1\|4636217_4636652_-	DUF669 domain-containing protein	Q9ZXC5	Bacillus_phage	5.3e-49	64.1
WP_060852335.1\|4636651_4637581_-	AAA family ATPase	A0A2H4JFH2	uncultured_Caudovirales_phage	1.2e-90	54.2
WP_060852336.1\|4637583_4638132_-	host-nuclease inhibitor Gam family protein	A0A2H4JFP8	uncultured_Caudovirales_phage	2.3e-89	92.3
WP_060852337.1\|4638109_4638397_-	hypothetical protein	A0A2H4J830	uncultured_Caudovirales_phage	1.3e-16	48.9
WP_170951711.1\|4638416_4638572_-	hypothetical protein	A0A2H4J977	uncultured_Caudovirales_phage	3.2e-17	82.0
WP_016097904.1\|4638632_4639277_-	sigma-70 family RNA polymerase sigma factor	W8CYN8	Bacillus_phage	3.0e-88	79.8
WP_060852338.1\|4639301_4639652_-	hypothetical protein	A0A2H4JGP5	uncultured_Caudovirales_phage	2.8e-40	74.1
WP_060852339.1\|4639652_4639880_-	hypothetical protein	NA	NA	NA	NA
WP_171840954.1\|4639880_4640048_-	hypothetical protein	A0A1B2APZ0	Phage_Wrath	2.1e-14	78.2
WP_000014073.1\|4640116_4640281_-	hypothetical protein	NA	NA	NA	NA
WP_000385075.1\|4640346_4640619_-	helix-turn-helix transcriptional regulator	A0A141E0W0	Streptococcus_phage	2.3e-10	50.0
WP_060852340.1\|4640769_4641453_+	LexA family transcriptional regulator	A0A2I6PF08	Staphylococcus_phage	5.9e-18	30.7
WP_000289676.1\|4641468_4641687_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_060852341.1\|4641799_4643203_+	recombinase family protein	A0A2I7SDG6	Paenibacillus_phage	3.1e-114	44.8
WP_060852342.1\|4643233_4645012_-	asparagine synthase (glutamine-hydrolyzing)	A0A1V0SGM7	Hokovirus	2.7e-22	27.3
WP_000616046.1\|4645251_4645806_+	DUF2777 domain-containing protein	NA	NA	NA	NA
WP_000233494.1\|4645936_4646302_-	YisL family protein	NA	NA	NA	NA
WP_000616658.1\|4646452_4647643_+	ornithine aminotransferase	A0A1V0SKB7	Klosneuvirus	1.4e-27	27.7
WP_000926857.1\|4647753_4648035_+	hypothetical protein	NA	NA	NA	NA
WP_001213071.1\|4648071_4648971_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_000462841.1\|4649218_4649398_+	aspartyl-phosphate phosphatase Spo0E family protein	NA	NA	NA	NA
WP_001111187.1\|4649494_4649716_+	spore germination protein GerPA	NA	NA	NA	NA
WP_001012508.1\|4649730_4649937_+	spore germination protein GerPB	NA	NA	NA	NA
WP_001070760.1\|4650004_4650619_+	spore germination protein GerPC	NA	NA	NA	NA
WP_001052807.1\|4650625_4650820_+	spore germination protein GerPD	NA	NA	NA	NA
WP_000902324.1\|4650835_4651222_+	spore germination protein GerPE	NA	NA	NA	NA
WP_001141566.1\|4651264_4651480_+	spore germination protein GerPF	A0A2H4J3A3	uncultured_Caudovirales_phage	3.4e-25	80.9
WP_000255728.1\|4651617_4651905_-	hypothetical protein	NA	NA	NA	NA
WP_060852343.1\|4651917_4655643_-	helicase-exonuclease AddAB subunit AddA	G3MA40	Bacillus_virus	5.8e-19	25.1
WP_060852344.1\|4655639_4659155_-	helicase-exonuclease AddAB subunit AddB	NA	NA	NA	NA
WP_000751919.1\|4659271_4659835_-	signal peptidase I	NA	NA	NA	NA
WP_000347517.1\|4659891_4660485_-	TVP38/TMEM64 family protein	NA	NA	NA	NA
WP_042597373.1\|4661440_4662274_+	cytosolic protein	A0A2H4J6G7	uncultured_Caudovirales_phage	4.1e-122	82.7
WP_042597371.1\|4662290_4662584_-	YolD-like family protein	A0A1C8E992	Bacillus_phage	1.0e-40	85.6
WP_042597369.1\|4662598_4662817_-	hypothetical protein	A0A1C8E991	Bacillus_phage	1.1e-31	94.4
WP_042597368.1\|4662954_4663284_+	hypothetical protein	NA	NA	NA	NA
WP_042597366.1\|4663512_4664451_-	N-acetylmuramoyl-L-alanine amidase	A0A0S2MVR5	Bacillus_phage	1.5e-173	92.9
WP_060852345.1\|4664440_4664875_-\|holin	phage holin family protein	A0A0S2MVC4	Bacillus_phage	2.9e-63	89.1
WP_060851554.1\|4665140_4666352_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	4.4e-69	37.9
WP_042597362.1\|4666513_4666888_-	hypothetical protein	A0A0S2MVE0	Bacillus_phage	4.3e-63	93.5
WP_060852346.1\|4666903_4671769_-	hypothetical protein	A0A0S2MVB4	Bacillus_phage	0.0e+00	82.0
WP_145977426.1\|4671765_4673229_-\|tail	phage tail family protein	A0A0S2MV63	Bacillus_phage	2.0e-201	74.4
WP_080775463.1\|4673262_4675989_-\|tail	phage tail tape measure protein	A0A2H4J957	uncultured_Caudovirales_phage	1.1e-94	62.6
WP_042597357.1\|4675988_4676264_-	hypothetical protein	NA	NA	NA	NA
WP_042597355.1\|4676287_4676698_-	hypothetical protein	NA	NA	NA	NA
WP_042597354.1\|4676700_4677228_-\|tail	tail protein	A0A097PBF4	Streptococcus_pyogenes_phage	2.2e-09	35.6
WP_042597352.1\|4677229_4677655_-	hypothetical protein	NA	NA	NA	NA
WP_042597350.1\|4677647_4678076_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_042597348.1\|4678059_4678377_-	hypothetical protein	NA	NA	NA	NA
WP_042597346.1\|4678373_4678715_-\|head,tail	phage head-tail connector protein	NA	NA	NA	NA
WP_042597344.1\|4678717_4678906_-	hypothetical protein	NA	NA	NA	NA
WP_042597343.1\|4678923_4679862_-	DUF5309 family protein	D6PFH7	uncultured_phage	3.6e-18	28.1
WP_042597341.1\|4679876_4680518_-	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_042597339.1\|4680603_4680786_-	DNA-binding protein	NA	NA	NA	NA
WP_042598603.1\|4680769_4681585_-\|capsid	minor capsid protein	Q6SE81	Lactobacillus_prophage	1.2e-20	36.4
WP_042597338.1\|4681703_4683185_-\|portal	phage portal protein	E5DV51	Deep-sea_thermophilic_phage	6.9e-48	36.0
WP_042597336.1\|4683197_4684418_-\|terminase	PBSX family phage terminase large subunit	A0A059T7K2	Staphylococcus_phage	4.7e-151	65.4
WP_042597334.1\|4684414_4685182_-	hypothetical protein	A0A2P1JTW4	Anoxybacillus_phage	5.3e-52	46.4
WP_060852348.1\|4685862_4686156_-	hypothetical protein	A0A0K2D0F2	Bacillus_phage	8.3e-30	70.1
WP_042597329.1\|4686201_4686399_-	hypothetical protein	A0A1C8E9B9	Bacillus_phage	1.5e-22	81.5
WP_000834382.1\|4686569_4686761_+	type II toxin-antitoxin system HicA family toxin	NA	NA	NA	NA
WP_060852349.1\|4686838_4687264_+	type II toxin-antitoxin system HicB family antitoxin	A0A090DBV2	Clostridium_phage	1.1e-25	50.0
WP_060852350.1\|4687329_4688205_-	hypothetical protein	NA	NA	NA	NA
WP_016109416.1\|4688271_4688460_-	hypothetical protein	NA	NA	NA	NA
WP_060852351.1\|4688877_4689387_-	sigma-70 family RNA polymerase sigma factor	A0A2H4J8J4	uncultured_Caudovirales_phage	1.3e-59	83.4
WP_042597321.1\|4689522_4689846_-	zinc-finger domain-containing protein	A0A2H4JAV2	uncultured_Caudovirales_phage	1.6e-50	86.0
WP_033699649.1\|4689842_4690370_-	Holliday junction resolvase RecU	A0A2H4J3A4	uncultured_Caudovirales_phage	1.5e-90	93.7
WP_052497242.1\|4690404_4690878_-	hypothetical protein	A0A0K2FL91	Brevibacillus_phage	1.1e-23	38.6
WP_042597319.1\|4690912_4691221_-	hypothetical protein	NA	NA	NA	NA
WP_042597317.1\|4691260_4691659_-	hypothetical protein	A0A0U3SQD7	Bacillus_phage	1.1e-69	96.2
WP_060852352.1\|4691697_4692093_-	hypothetical protein	H0USU9	Bacillus_phage	1.2e-68	91.6
WP_060852353.1\|4692108_4692294_-	hypothetical protein	J9PRR8	Bacillus_phage	1.8e-14	61.7
WP_060852354.1\|4692315_4692861_-	hypothetical protein	A0A1Z1DA37	Bacillus_phage	8.5e-36	47.3
WP_060852355.1\|4692901_4693081_-	hypothetical protein	NA	NA	NA	NA
WP_060852356.1\|4693123_4693660_-	dUTP diphosphatase	A0A2H4J4W9	uncultured_Caudovirales_phage	1.7e-89	90.4
WP_042597308.1\|4693784_4694219_-	hypothetical protein	A0A2H4JBD8	uncultured_Caudovirales_phage	2.3e-76	95.1
WP_042597306.1\|4694257_4694815_-	hypothetical protein	A0A1B1P7A6	Bacillus_phage	2.0e-61	67.9
WP_042597305.1\|4694838_4695069_-	hypothetical protein	A0A1C8E9C2	Bacillus_phage	9.7e-34	98.7
WP_060852357.1\|4695061_4695541_-	hypothetical protein	A0A1C8E9A8	Bacillus_phage	9.3e-79	92.5
WP_060852358.1\|4695552_4696488_-	DnaD domain protein	A0A2H4J394	uncultured_Caudovirales_phage	8.3e-132	95.8
WP_060852359.1\|4696582_4696921_-	hypothetical protein	A0A2H4J6H7	uncultured_Caudovirales_phage	2.3e-52	98.2
WP_014894867.1\|4696853_4697069_-	hypothetical protein	A0A2H4J3B2	uncultured_Caudovirales_phage	2.0e-28	90.1
WP_042597301.1\|4697068_4697782_-	hypothetical protein	A0A1C8EA84	Bacillus_phage	3.0e-126	97.9
WP_042597300.1\|4697800_4698235_-	hypothetical protein	A0A1C8E9A2	Bacillus_phage	1.4e-73	98.6
WP_001187283.1\|4698261_4698450_-	hypothetical protein	A0A2H4J4V8	uncultured_Caudovirales_phage	2.6e-13	62.9
WP_060852360.1\|4698461_4699217_-	ORF6C domain-containing protein	A0A2H4JBC7	uncultured_Caudovirales_phage	1.1e-113	86.6
WP_171840955.1\|4699231_4699387_-	hypothetical protein	A0A1C8E9A0	Bacillus_phage	5.3e-20	92.0
WP_171840956.1\|4699413_4699560_-	hypothetical protein	NA	NA	NA	NA
WP_042597296.1\|4699556_4699757_-	helix-turn-helix transcriptional regulator	A0A0F6N3M9	Staphylococcus_phage	1.2e-08	54.5
WP_042597294.1\|4700037_4700445_+	helix-turn-helix transcriptional regulator	A0A0M4QX29	Bacillus_phage	4.2e-24	46.4
WP_042597293.1\|4700467_4700902_+	ImmA/IrrE family metallo-endopeptidase	Q9T201	Bacillus_phage	1.1e-33	54.4
WP_042597292.1\|4700933_4702367_+	recombinase family protein	A0A2P1JU08	Anoxybacillus_phage	4.7e-110	47.5
WP_000391373.1\|4702878_4703064_+	hypothetical protein	NA	NA	NA	NA
WP_000356916.1\|4703413_4703617_+	hypothetical protein	NA	NA	NA	NA
WP_000301522.1\|4703814_4704018_-	RNA chaperone/antiterminator CspA	Q9AZD3	Lactococcus_phage	8.0e-16	62.9

DBSCAN-SWA_18

4827210 : 4867049

Acinetobacter_phage(22.22%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_145977416.1\|4827210_4827882_+\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	4.6e-07	49.2
WP_000275580.1\|4827961_4829257_+\|transposase	IS21-like element IS232 family transposase	A0A2L1IVA1	Escherichia_phage	5.3e-12	28.8
WP_000798699.1\|4829246_4829999_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	7.0e-57	47.3
WP_145977417.1\|4830045_4830306_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	8.7e-07	40.0
WP_002164614.1\|4830549_4831161_-	DUF2812 domain-containing protein	NA	NA	NA	NA
WP_001078066.1\|4831174_4831489_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_001035207.1\|4831629_4832274_-	hypothetical protein	NA	NA	NA	NA
WP_000288218.1\|4832399_4834133_-	S-layer homology domain-containing protein	NA	NA	NA	NA
WP_060852375.1\|4835266_4835548_-	hypothetical protein	NA	NA	NA	NA
WP_000395467.1\|4835916_4836810_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000940664.1\|4837430_4837820_-	hypothetical protein	NA	NA	NA	NA
WP_000106150.1\|4838216_4839326_-	hypothetical protein	A0A2H4J8G3	uncultured_Caudovirales_phage	2.6e-92	49.3
WP_000464477.1\|4840145_4840604_+	hypothetical protein	NA	NA	NA	NA
WP_113732247.1\|4840798_4841011_-	DUF3967 domain-containing protein	NA	NA	NA	NA
WP_011109878.1\|4841049_4841241_-	hypothetical protein	NA	NA	NA	NA
WP_060852376.1\|4841519_4841822_+	hypothetical protein	NA	NA	NA	NA
WP_081097597.1\|4841986_4843738_-	dihydroxyacetone kinase subunit DhaK	NA	NA	NA	NA
WP_000204220.1\|4843916_4844483_+	dihydroxyacetone kinase transcriptional activator DhaS	NA	NA	NA	NA
WP_000723364.1\|4844502_4845501_+	DhaKLM operon coactivator DhaQ	NA	NA	NA	NA
WP_000556719.1\|4845600_4846236_-	VanZ family protein	NA	NA	NA	NA
WP_000169374.1\|4846909_4848217_-	group II intron reverse transcriptase/maturase	H7BV92	unidentified_phage	1.7e-10	23.8
WP_060852377.1\|4850540_4851848_-	group II intron reverse transcriptase/maturase	H7BV92	unidentified_phage	1.7e-10	23.8
WP_003286404.1\|4853559_4853922_-	DUF1878 family protein	NA	NA	NA	NA
WP_000566919.1\|4854216_4854609_-	hypothetical protein	NA	NA	NA	NA
WP_000249013.1\|4854620_4854878_-	type IV secretion protein Rhs	NA	NA	NA	NA
WP_001060032.1\|4855053_4855509_-	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_000694778.1\|4856191_4856662_-	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_060852378.1\|4856987_4857248_-	hypothetical protein	NA	NA	NA	NA
WP_000877046.1\|4857356_4857710_-	type II toxin-antitoxin system toxin	NA	NA	NA	NA
WP_000056044.1\|4857743_4859381_-	EndoU domain-containing protein	A0A0A7RVN1	Clostridium_phage	1.4e-25	46.6
WP_000076120.1\|4859377_4859740_-	DUF3958 family protein	NA	NA	NA	NA
WP_000529655.1\|4859781_4860057_-	TIGR04197 family type VII secretion effector	NA	NA	NA	NA
WP_000918591.1\|4860243_4860540_-	WXG100 family type VII secretion target	NA	NA	NA	NA
WP_145977427.1\|4860666_4860825_-	ornithine cyclodeaminase	NA	NA	NA	NA
WP_000272480.1\|4860934_4861081_-	DUF4176 domain-containing protein	NA	NA	NA	NA
WP_001053955.1\|4861324_4862761_-\|transposase	IS4-like element IS231A family transposase	NA	NA	NA	NA
WP_000116992.1\|4862991_4864422_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_000364215.1\|4864570_4864981_-	DUF1878 family protein	NA	NA	NA	NA
WP_145977397.1\|4865853_4867049_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.6e-26	31.3

DBSCAN-SWA_19

4925262 : 4983040

Bacillus_phage(30.0%)

coat,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060852384.1\|4925262_4926456_-\|transposase	IS110-like element ISBth13 family transposase	A0A0U3ULR1	Bacillus_phage	1.5e-24	26.1
WP_000953783.1\|4928590_4930351_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	2.0e-46	27.9
WP_000213625.1\|4930947_4932387_+	NADP-dependent glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_000423681.1\|4932465_4933551_-	DUF3626 domain-containing protein	A0A2H4UV60	Bodo_saltans_virus	2.5e-07	23.9
WP_060852385.1\|4933661_4934417_-	glutamate racemase	NA	NA	NA	NA
WP_001053969.1\|4934531_4935968_+\|transposase	IS4-like element IS231C family transposase	NA	NA	NA	NA
WP_001186301.1\|4936688_4938113_+	amino acid permease	NA	NA	NA	NA
WP_000021361.1\|4938173_4939373_+	ABC transporter permease	NA	NA	NA	NA
WP_060852386.1\|4939565_4941563_+	catalase	A0A2K9L572	Tupanvirus	1.7e-150	51.3
WP_000037548.1\|4941586_4942102_+	type 1 glutamine amidotransferase	NA	NA	NA	NA
WP_162900581.1\|4942164_4942314_-	hypothetical protein	NA	NA	NA	NA
WP_001063856.1\|4942412_4942616_+	hypothetical protein	NA	NA	NA	NA
WP_000508206.1\|4942667_4943930_-	MFS transporter	NA	NA	NA	NA
WP_000699823.1\|4944036_4945776_+	SgrR family transcriptional regulator	NA	NA	NA	NA
WP_000789173.1\|4945848_4946397_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_000511552.1\|4946420_4946960_-	ester cyclase	NA	NA	NA	NA
WP_001059470.1\|4947129_4947468_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000742953.1\|4947501_4948704_-	tetracycline resistance MFS efflux pump	NA	NA	NA	NA
WP_002025356.1\|4948916_4949495_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_000539671.1\|4949646_4949961_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_000796022.1\|4949963_4950308_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_000288065.1\|4950727_4951087_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_000878068.1\|4951221_4951992_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_000686663.1\|4952072_4952528_-	N-acetyltransferase	NA	NA	NA	NA
WP_000446097.1\|4952656_4953151_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_001146231.1\|4953356_4954268_+	DMT family transporter	NA	NA	NA	NA
WP_000897997.1\|4954302_4954788_-	PRK06770 family protein	G3MB13	Bacillus_virus	1.2e-09	29.1
WP_001126699.1\|4954787_4955189_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_001077751.1\|4955342_4955747_-	DoxX family protein	NA	NA	NA	NA
WP_000580626.1\|4955899_4956973_-	DUF871 domain-containing protein	NA	NA	NA	NA
WP_000711293.1\|4957021_4958386_-	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_000892350.1\|4958410_4959295_-	N-acetylmuramic acid 6-phosphate etherase	NA	NA	NA	NA
WP_000648168.1\|4959450_4960314_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_000704958.1\|4960343_4960658_-	hypothetical protein	NA	NA	NA	NA
WP_113732246.1\|4960782_4961994_-	cation:proton antiporter	NA	NA	NA	NA
WP_000838703.1\|4962168_4963572_+	amino acid permease	NA	NA	NA	NA
WP_001174838.1\|4963600_4963771_-	hypothetical protein	NA	NA	NA	NA
WP_000435797.1\|4963783_4963987_-	hypothetical protein	NA	NA	NA	NA
WP_000375674.1\|4964066_4966526_-	metallophosphoesterase	NA	NA	NA	NA
WP_002164628.1\|4966878_4967304_+	DUF3992 domain-containing protein	NA	NA	NA	NA
WP_000525819.1\|4967360_4967705_-	DUF3992 domain-containing protein	NA	NA	NA	NA
WP_060852388.1\|4967725_4968094_-	DUF3992 domain-containing protein	NA	NA	NA	NA
WP_000435017.1\|4968192_4968798_-	DedA family protein	NA	NA	NA	NA
WP_000733844.1\|4968815_4969097_-	DUF1232 domain-containing protein	NA	NA	NA	NA
WP_000557738.1\|4969448_4970261_+	Ku protein	A0A249XRB2	Mycobacterium_phage	3.3e-28	30.8
WP_000440994.1\|4970279_4971059_-	DUF2935 domain-containing protein	A0A2I2L551	Orpheovirus	1.8e-39	35.6
WP_162837398.1\|4971073_4971502_-	lactoylglutathione lyase	NA	NA	NA	NA
WP_000362188.1\|4971536_4971752_+\|coat	spore coat associated protein CotJA	NA	NA	NA	NA
WP_002157501.1\|4971748_4972024_+\|coat	spore coat protein CotJB	NA	NA	NA	NA
WP_000265278.1\|4972036_4972606_+\|coat	spore coat protein CotJC	NA	NA	NA	NA
WP_001260934.1\|4972823_4974140_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_000269962.1\|4974184_4975189_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_000239670.1\|4975190_4976057_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_000388712.1\|4976146_4976881_-	TIGR02206 family membrane protein	NA	NA	NA	NA
WP_000728844.1\|4977092_4978196_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_000609104.1\|4978192_4978867_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.1e-36	39.5
WP_060852389.1\|4978869_4979988_+	ABC transporter permease	NA	NA	NA	NA
WP_060852390.1\|4980445_4981819_+	SH3 domain-containing protein	J9PQW7	Bacillus_phage	3.6e-35	71.8
WP_085963705.1\|4981880_4983040_-\|transposase	IS3-like element ISBth8 family transposase	A0A0C5AEA5	Paenibacillus_phage	8.7e-38	42.0

DBSCAN-SWA_20

5087982 : 5157068

Bacillus_phage(87.1%)

transposase,head,capsid,integrase,protease,tail,terminase,portal

attL 5107104:5107124|attR 5158883:5158903

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042884452.1\|5087982_5089140_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q331V1	Clostridium_botulinum_C_phage	9.3e-125	60.9
WP_000816203.1\|5089136_5089400_-	MerR family transcriptional regulator	Q331V0	Clostridium_botulinum_C_phage	5.5e-17	31.5
WP_060852396.1\|5089578_5090871_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	5.8e-43	31.4
WP_001164897.1\|5091152_5092544_+	amino acid permease	NA	NA	NA	NA
WP_000791509.1\|5092725_5094273_+	DNA-binding protein	NA	NA	NA	NA
WP_060852397.1\|5094308_5096030_-	DUF2339 domain-containing protein	NA	NA	NA	NA
WP_000771694.1\|5096170_5097472_-	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_000443143.1\|5097724_5099110_+	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	6.4e-64	32.7
WP_001249814.1\|5099140_5100220_-	YHYH domain-containing protein	NA	NA	NA	NA
WP_085963705.1\|5100377_5101537_-\|transposase	IS3-like element ISBth8 family transposase	A0A0C5AEA5	Paenibacillus_phage	8.7e-38	42.0
WP_001041726.1\|5101650_5102283_-	class A sortase	NA	NA	NA	NA
WP_001080043.1\|5102400_5102874_-	hypothetical protein	NA	NA	NA	NA
WP_000154019.1\|5102866_5103085_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_001105777.1\|5103197_5104490_-	cell wall-binding protein	A0A143FNS3	Bacillus_phage	1.8e-31	65.5
WP_000495037.1\|5104710_5105652_+	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	7.3e-11	32.4
WP_000434794.1\|5105788_5106601_+	undecaprenyl-diphosphate phosphatase	NA	NA	NA	NA
WP_000471238.1\|5106780_5107068_+	hypothetical protein	NA	NA	NA	NA
5107104:5107124	attL	NA	NA	NA	NA
WP_001268332.1\|5107198_5107402_-	hypothetical protein	NA	NA	NA	NA
WP_000128025.1\|5107573_5108725_+	VanZ family protein	NA	NA	NA	NA
WP_000948959.1\|5108778_5110095_-	FAD-binding protein	NA	NA	NA	NA
WP_000373754.1\|5110082_5111255_-	amino acid deaminase/aldolase	NA	NA	NA	NA
WP_000730127.1\|5111752_5112634_+	helix-turn-helix domain-containing protein	I7ILW0	Bacillus_phage	1.5e-159	100.0
WP_000842173.1\|5112638_5113247_-	replication-relaxation family protein	A0A0S2GLL8	Bacillus_phage	3.3e-113	100.0
WP_000511371.1\|5113236_5114403_-	DNA translocase FtsK	A0A0S2GLG9	Bacillus_phage	9.4e-226	100.0
WP_000495118.1\|5114413_5114734_-	hypothetical protein	A0A0S2GLK1	Bacillus_phage	1.9e-51	100.0
WP_000467327.1\|5115196_5115418_+	helix-turn-helix transcriptional regulator	A0A0S2GLH4	Bacillus_phage	2.9e-35	100.0
WP_000423300.1\|5115486_5115816_+	hypothetical protein	A0A0S2GLG3	Bacillus_phage	2.4e-54	100.0
WP_000542506.1\|5115856_5116675_-	N-acetylmuramoyl-L-alanine amidase	A0A0S2GLD4	Bacillus_phage	3.2e-164	100.0
WP_001076454.1\|5116674_5116887_-	hypothetical protein	A0A0S2GM50	Bacillus_phage	1.4e-34	100.0
WP_000151530.1\|5116889_5117171_-	hypothetical protein	A0A0S2GM64	Bacillus_phage	9.1e-42	100.0
WP_000822820.1\|5117184_5118144_-\|integrase	site-specific integrase	A0A0S2GLC8	Bacillus_phage	3.1e-182	99.7
WP_060852398.1\|5118240_5122266_-\|tail	tail fiber domain-containing protein	A0A0S2GLH1	Bacillus_phage	0.0e+00	99.9
WP_000232880.1\|5122262_5123747_-\|tail	phage tail family protein	A0A0S2GLF9	Bacillus_phage	9.9e-297	100.0
WP_038413316.1\|5123758_5127685_-\|tail	phage tail tape measure protein	A0A0S2GLG8	Bacillus_phage	0.0e+00	100.0
WP_000344048.1\|5127699_5127876_-	hypothetical protein	I3WTY5	Bacillus_phage	1.1e-26	100.0
WP_000779042.1\|5127905_5128223_-	hypothetical protein	A0A0S2GLH2	Bacillus_phage	8.9e-54	100.0
WP_000896661.1\|5128269_5128875_-\|tail	tail protein	A0A0S2GLI0	Bacillus_phage	9.2e-100	100.0
WP_060852399.1\|5128875_5129235_-	DUF3168 domain-containing protein	A0A0S2GLE3	Bacillus_phage	1.7e-61	98.3
WP_000763223.1\|5129231_5129669_-	HK97 gp10 family phage protein	A0A0S2GLH3	Bacillus_phage	7.9e-77	100.0
WP_001068030.1\|5129661_5129985_-\|head	phage head closure protein	H0USW8	Bacillus_phage	1.1e-56	100.0
WP_000244586.1\|5129971_5130259_-\|head,tail	phage gp6-like head-tail connector protein	A0A0S2GLH6	Bacillus_phage	1.8e-45	100.0
WP_015382182.1\|5130279_5131446_-\|capsid	phage major capsid protein	A0A0S2GLG0	Bacillus_phage	3.3e-210	100.0
WP_015382181.1\|5131483_5132194_-\|protease	Clp protease ClpP	A0A0S2GLD5	Bacillus_phage	5.5e-128	100.0
WP_015382180.1\|5132180_5133434_-\|portal	phage portal protein	A0A0S2GLJ4	Bacillus_phage	3.5e-242	99.8
WP_015382179.1\|5133622_5135317_-\|terminase	terminase large subunit	A0A0S2GLF0	Bacillus_phage	0.0e+00	100.0
WP_000233388.1\|5135318_5135822_-\|terminase	phage terminase small subunit P27 family	A0A0S2GLF2	Bacillus_phage	8.0e-89	100.0
WP_001139459.1\|5135950_5136328_-	HNH endonuclease	A0A0S2GLI5	Bacillus_phage	6.8e-69	100.0
WP_001198493.1\|5136317_5136572_-	hypothetical protein	A0A0S2GLL6	Bacillus_phage	3.9e-44	100.0
WP_000778983.1\|5136707_5136920_-	hypothetical protein	A0A0S2GM40	Bacillus_phage	2.7e-30	100.0
WP_000002720.1\|5136936_5137176_-	hypothetical protein	A0A0S2GLE8	Bacillus_phage	5.2e-22	98.7
WP_000443964.1\|5137204_5137390_-	hypothetical protein	A0A0S2GLH7	Bacillus_phage	8.6e-25	100.0
WP_001050326.1\|5137438_5138305_-	hypothetical protein	A0A0S2GLF7	Bacillus_phage	2.8e-166	100.0
WP_000792998.1\|5138386_5138569_-	hypothetical protein	A0A0S2GLH0	Bacillus_phage	3.1e-27	100.0
WP_015382178.1\|5138940_5139186_-	hypothetical protein	A0A0S2GLK0	Bacillus_phage	9.0e-38	100.0
WP_001012176.1\|5139392_5139935_-\|integrase	site-specific integrase	A0A0S2GLG4	Bacillus_phage	3.3e-96	100.0
WP_015382492.1\|5139931_5140417_-	transcription regulator	A0A0S2GLJ9	Bacillus_phage	7.9e-86	100.0
WP_015382275.1\|5140444_5140609_-	hypothetical protein	A0A0S2GLH8	Bacillus_phage	6.5e-16	100.0
WP_000965619.1\|5140774_5141056_-	hypothetical protein	A0A0S2GLD3	Bacillus_phage	8.7e-45	100.0
WP_000404184.1\|5142464_5142872_-	hypothetical protein	A0A0S2GLF8	Bacillus_phage	4.9e-73	100.0
WP_001098845.1\|5143225_5143525_-	hypothetical protein	A0A0S2GLL5	Bacillus_phage	2.7e-52	100.0
WP_000705118.1\|5143675_5143975_+	hypothetical protein	A0A0S2GLD6	Bacillus_phage	1.9e-50	100.0
WP_001025406.1\|5143971_5144187_-	hypothetical protein	A0A0S2GLC6	Bacillus_phage	8.7e-37	100.0
WP_000817807.1\|5144204_5144369_-	DUF3954 domain-containing protein	A0A0S2GLF5	Bacillus_phage	1.0e-24	100.0
WP_000436951.1\|5144440_5144707_-	hypothetical protein	A0A0S2GLK4	Bacillus_phage	7.7e-43	100.0
WP_002133989.1\|5144748_5145561_-	ATP-binding protein	A0A0S2GLK2	Bacillus_phage	1.2e-155	100.0
WP_060852400.1\|5145523_5146552_-	hypothetical protein	A0A0S2GLI6	Bacillus_phage	9.6e-182	95.9
WP_000123128.1\|5146775_5147423_-	sigma-70 family RNA polymerase sigma factor	A0A0S2GLJ1	Bacillus_phage	1.8e-117	100.0
WP_000218620.1\|5147697_5148012_-	hypothetical protein	A0A0S2GLB6	Bacillus_phage	1.1e-51	100.0
WP_015382175.1\|5148173_5148953_-	phage regulatory protein	A0A0S2GLP8	Bacillus_phage	1.6e-141	100.0
WP_000549466.1\|5149178_5149367_-	helix-turn-helix transcriptional regulator	A0A0S2GLE9	Bacillus_phage	3.2e-27	100.0
WP_000813892.1\|5149399_5149636_-	helix-turn-helix transcriptional regulator	A0A0S2GLE0	Bacillus_phage	8.7e-38	100.0
WP_000511082.1\|5149784_5150129_+	helix-turn-helix transcriptional regulator	I7J6V3	Bacillus_phage	4.2e-57	100.0
WP_000466636.1\|5150528_5151767_-	hypothetical protein	I7J4K0	Bacillus_phage	8.2e-236	100.0
WP_000262047.1\|5152284_5153385_+\|integrase	site-specific integrase	A0A0S2GLI2	Bacillus_phage	8.6e-205	100.0
WP_060852401.1\|5153323_5154370_-	sphingomyelin phosphodiesterase	A0A1P8L6H7	Staphylococcus_phage	5.3e-87	59.0
WP_000730997.1\|5154446_5155298_-	phospholipase C	NA	NA	NA	NA
WP_000948210.1\|5155551_5155896_-	two pore domain potassium channel family protein	NA	NA	NA	NA
WP_000645827.1\|5156015_5157068_-	(R,R)-butanediol dehydrogenase	E3SJ82	Synechococcus_phage	3.9e-21	27.6
5158883:5158903	attR	NA	NA	NA	NA

DBSCAN-SWA_21

5475643 : 5553156

Bacillus_phage(81.63%)

coat,capsid,plate,integrase,protease,tail,tRNA,terminase,portal

attL 5516647:5516679|attR 5554944:5554976

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000432509.1\|5475643_5476093_-\|coat	spore coat protein B	NA	NA	NA	NA
WP_000051525.1\|5476113_5476629_-\|coat	spore coat protein B	NA	NA	NA	NA
WP_002025240.1\|5476864_5477104_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_000235476.1\|5477290_5477659_+	hypothetical protein	NA	NA	NA	NA
WP_001078299.1\|5477854_5478904_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_000732597.1\|5479237_5480158_+	iron-hydroxamate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002025239.1\|5480206_5481247_+	iron ABC transporter permease	NA	NA	NA	NA
WP_000983753.1\|5481243_5482251_+	iron ABC transporter permease	NA	NA	NA	NA
WP_000926554.1\|5482295_5482937_-	L-fuculose-phosphate aldolase	NA	NA	NA	NA
WP_042884389.1\|5482990_5484037_-	S-methyl-5-thioribose-1-phosphate isomerase	NA	NA	NA	NA
WP_000033076.1\|5484046_5485276_-	S-methyl-5-thioribose kinase	NA	NA	NA	NA
WP_000924420.1\|5485866_5486430_+	peroxiredoxin	NA	NA	NA	NA
WP_000599501.1\|5486444_5487971_+	alkyl hydroperoxide reductase subunit F	A0A1W6JNB4	Lactococcus_phage	1.2e-18	30.8
WP_060852430.1\|5488011_5488758_-	hypothetical protein	NA	NA	NA	NA
WP_001005624.1\|5488761_5489370_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_000853516.1\|5489645_5490761_-	M20 peptidase aminoacylase family protein	NA	NA	NA	NA
WP_060852431.1\|5490943_5492365_+	Na+/H+ antiporter NhaC	NA	NA	NA	NA
WP_000972800.1\|5492353_5493625_-	hypothetical protein	NA	NA	NA	NA
WP_000704479.1\|5493718_5494828_+	dipeptide epimerase	Q6A202	Oenococcus_phage	3.3e-18	25.1
WP_000217548.1\|5494842_5495538_+	hypothetical protein	NA	NA	NA	NA
WP_000233754.1\|5495757_5496465_-	M48 family metallopeptidase	NA	NA	NA	NA
WP_001251703.1\|5496560_5497079_-	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	5.6e-21	36.5
WP_000566708.1\|5497430_5498420_-\|tRNA	tRNA-dihydrouridine synthase	NA	NA	NA	NA
WP_000105024.1\|5498581_5499958_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	6.5e-117	46.7
WP_060852432.1\|5500383_5501580_+	pyrimidine nucleoside transporter NupC	NA	NA	NA	NA
WP_000875591.1\|5501626_5502334_-	hypothetical protein	NA	NA	NA	NA
WP_001233731.1\|5502871_5503954_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_000007349.1\|5504070_5505300_+	aminopeptidase	NA	NA	NA	NA
WP_000915109.1\|5505345_5505837_-	DUF4352 domain-containing protein	NA	NA	NA	NA
WP_000263262.1\|5505969_5506293_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_060852433.1\|5506340_5507792_-	NADP-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_000225136.1\|5507784_5509152_-	sigma 54-interacting transcriptional regulator	NA	NA	NA	NA
WP_001093019.1\|5509267_5510632_-	4-aminobutyrate--2-oxoglutarate transaminase	NA	NA	NA	NA
WP_060852434.1\|5510786_5511530_-	HAD family hydrolase	NA	NA	NA	NA
WP_060852435.1\|5511670_5512576_-	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	1.2e-26	30.5
WP_001047685.1\|5513133_5514561_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_000051433.1\|5514575_5516033_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_000086999.1\|5516048_5516339_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
5516647:5516679	attL	NA	NA	NA	NA
WP_060852436.1\|5517017_5517893_+	cytosolic protein	I7ILW0	Bacillus_phage	2.1e-105	73.5
WP_060852437.1\|5517895_5518504_-	replication-relaxation family protein	A0A0S2GLL8	Bacillus_phage	1.2e-91	80.1
WP_060852438.1\|5518493_5519660_-	DNA translocase FtsK	W8CYG2	Bacillus_phage	1.2e-183	80.7
WP_060852439.1\|5519670_5519991_-	hypothetical protein	A0A0S2GLK1	Bacillus_phage	6.1e-34	67.9
WP_060852440.1\|5520456_5520681_+	helix-turn-helix transcriptional regulator	A0A1B1P883	Bacillus_phage	7.7e-28	78.4
WP_060852441.1\|5521271_5521469_+	hypothetical protein	A0A1B0T6A3	Bacillus_phage	4.9e-18	86.2
WP_060852442.1\|5521561_5522260_-	N-acetylmuramoyl-L-alanine amidase	A0A0S2MVR5	Bacillus_phage	1.4e-107	63.5
WP_060852549.1\|5522259_5522466_-	hypothetical protein	D2XR32	Bacillus_phage	9.3e-28	86.4
WP_060852443.1\|5522474_5522756_-	hypothetical protein	D2XR31	Bacillus_phage	6.5e-32	75.8
WP_060852444.1\|5522827_5524009_-\|plate	BppU family phage baseplate upper protein	A0A1B1P768	Bacillus_phage	5.3e-152	70.9
WP_060852445.1\|5524023_5526366_-\|tail	phage tail protein	A0A1C8E983	Bacillus_phage	0.0e+00	88.8
WP_060852446.1\|5526362_5527046_-\|tail	phage tail family protein	A0A1C8EA72	Bacillus_phage	6.1e-108	80.1
WP_081097603.1\|5527047_5531058_-	hypothetical protein	Q0H230	Geobacillus_phage	4.1e-127	54.3
WP_060852447.1\|5531225_5531693_-	hypothetical protein	A0A1B1P772	Bacillus_phage	1.1e-18	35.3
WP_060852448.1\|5531713_5532298_-	hypothetical protein	A0A1B1P778	Bacillus_phage	1.8e-55	56.0
WP_060852449.1\|5532303_5532726_-	hypothetical protein	R4IBU7	Listeria_phage	1.1e-19	37.7
WP_060852450.1\|5532715_5533102_-	hypothetical protein	NA	NA	NA	NA
WP_060852451.1\|5533091_5533442_-	hypothetical protein	A0A1B1P760	Bacillus_phage	2.4e-31	63.4
WP_060852452.1\|5533422_5533719_-	hypothetical protein	A0A1B1P751	Bacillus_phage	5.8e-47	96.9
WP_088025150.1\|5533711_5533807_-	hypothetical protein	NA	NA	NA	NA
WP_060852453.1\|5533859_5535023_-\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	8.0e-84	42.2
WP_060852454.1\|5535064_5535775_-\|protease	Clp protease ClpP	A0A2H4JC91	uncultured_Caudovirales_phage	1.2e-53	50.2
WP_060852455.1\|5535761_5536928_-\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	3.3e-186	82.9
WP_060852456.1\|5536942_5538598_-\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	1.2e-271	81.1
WP_060852457.1\|5538590_5538905_-	hypothetical protein	A0A1B1P762	Bacillus_phage	2.2e-20	57.7
WP_060852458.1\|5539011_5539317_-	hypothetical protein	A0A1B1P767	Bacillus_phage	3.6e-44	89.4
WP_060852550.1\|5539319_5539667_-	HNH endonuclease	A0A1B1P757	Bacillus_phage	1.4e-23	51.3
WP_060852459.1\|5539672_5539897_-	hypothetical protein	NA	NA	NA	NA
WP_046648212.1\|5539903_5540128_-	hypothetical protein	A0A1B1P745	Bacillus_phage	9.2e-21	70.3
WP_060852460.1\|5540117_5540546_-	hypothetical protein	Q2I8B8	Bacillus_phage	8.5e-07	53.3
WP_060852461.1\|5540586_5540805_-	cell division protein FtsK	A0A1B1P7C1	Bacillus_phage	5.1e-08	40.0
WP_001028515.1\|5541419_5541962_-\|integrase	tyrosine-type recombinase/integrase	A0A1B1P746	Bacillus_phage	1.5e-96	100.0
WP_001041469.1\|5541958_5542429_-	hypothetical protein	A0A1B1P744	Bacillus_phage	5.5e-84	99.4
WP_000866143.1\|5542449_5542620_-	hypothetical protein	A0A1B1P735	Bacillus_phage	2.5e-10	100.0
WP_171840933.1\|5543516_5543666_-	hypothetical protein	W8CYP0	Bacillus_phage	4.2e-14	83.3
WP_060852462.1\|5544284_5544887_-	hypothetical protein	A0A0F6SJ62	Sinorhizobium_phage	2.1e-19	31.5
WP_060852463.1\|5544925_5545324_-	hypothetical protein	A0A0E3D9K2	Bacillus_phage	7.5e-66	94.7
WP_000817805.1\|5545551_5545716_-	DUF3954 domain-containing protein	A0A0S2GLF5	Bacillus_phage	9.6e-20	85.2
WP_060852464.1\|5545766_5546033_-	hypothetical protein	A0A0S2GLK4	Bacillus_phage	6.6e-42	98.9
WP_060852465.1\|5546074_5546887_-	ATP-binding protein	W8CZ50	Bacillus_phage	3.3e-153	98.1
WP_060852466.1\|5546849_5547866_-	hypothetical protein	A0A0S2GLI6	Bacillus_phage	2.4e-185	97.6
WP_060852468.1\|5548108_5548756_-	sigma-70 family RNA polymerase sigma factor	A0A0S2GLJ1	Bacillus_phage	3.0e-112	96.3
WP_060852470.1\|5549506_5550286_-	ORF6C domain-containing protein	A0A0S2GLP8	Bacillus_phage	6.9e-140	99.2
WP_000788399.1\|5550331_5550487_-	hypothetical protein	I7J4K2	Bacillus_phage	2.6e-22	96.1
WP_060852471.1\|5550511_5550700_-	helix-turn-helix transcriptional regulator	A0A0S2GLE9	Bacillus_phage	8.5e-20	82.3
WP_060852551.1\|5550721_5550952_-	hypothetical protein	NA	NA	NA	NA
WP_060852472.1\|5551173_5551503_+	helix-turn-helix transcriptional regulator	H0UST7	Bacillus_phage	1.3e-47	89.9
WP_171840958.1\|5551786_5551936_-	hypothetical protein	NA	NA	NA	NA
WP_081097605.1\|5551935_5553156_-	hypothetical protein	H0UST6	Bacillus_phage	2.1e-135	67.0
5554944:5554976	attR	NA	NA	NA	NA

DBSCAN-SWA_22

5557939 : 5689862

105

Bacillus_phage(13.95%)

transposase,head,capsid,integrase,protease,tail,terminase,tRNA,portal

attL 5624906:5624923|attR 5637702:5637719

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060851554.1\|5557939_5559151_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	4.4e-69	37.9
WP_000721599.1\|5559468_5560323_-	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_001261870.1\|5560344_5561010_-	ABC transporter permease	NA	NA	NA	NA
WP_060852474.1\|5560999_5562019_-	methionine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.1e-32	34.2
WP_000844925.1\|5562491_5563037_+	cysteine hydrolase	NA	NA	NA	NA
WP_000259555.1\|5563307_5564855_-	L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_060852475.1\|5565009_5565780_-	TSUP family transporter	NA	NA	NA	NA
WP_000717030.1\|5565876_5567073_-	CamS family sex pheromone protein	NA	NA	NA	NA
WP_000031450.1\|5567089_5569099_-	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	1.5e-125	40.7
WP_060852553.1\|5569113_5571363_-	DNA helicase PcrA	A7KV33	Bacillus_phage	6.0e-136	41.2
WP_000272098.1\|5571375_5572065_-	heptaprenylglyceryl phosphate synthase	NA	NA	NA	NA
WP_000812346.1\|5572402_5572780_+	DUF2892 domain-containing protein	NA	NA	NA	NA
WP_000660669.1\|5572999_5573845_+	SPFH domain-containing protein	NA	NA	NA	NA
WP_001085171.1\|5573860_5574025_+	toxin-antitoxin system HicB family antitoxin	NA	NA	NA	NA
WP_001101965.1\|5574061_5575333_-	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
WP_000745438.1\|5575598_5577134_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	5.1e-78	53.3
WP_000088589.1\|5577158_5577746_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	9.1e-28	37.4
WP_001262439.1\|5577742_5578783_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.2e-67	45.9
WP_000879025.1\|5578888_5580304_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.3e-55	35.4
WP_000055544.1\|5580288_5582508_-	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	6.7e-164	41.3
WP_000666786.1\|5582491_5583175_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_000278823.1\|5583171_5583426_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_001170544.1\|5583418_5584138_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	4.0e-49	44.3
WP_000625682.1\|5584226_5585534_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.9e-21	25.3
WP_000196814.1\|5585530_5586682_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_000839365.1\|5586678_5587164_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	6.6e-24	44.9
WP_060852476.1\|5593240_5595172_+	glycosyltransferase	NA	NA	NA	NA
WP_000275580.1\|5595287_5596583_+\|transposase	IS21-like element IS232 family transposase	A0A2L1IVA1	Escherichia_phage	5.3e-12	28.8
WP_000798699.1\|5596572_5597325_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	7.0e-57	47.3
WP_000651231.1\|5597427_5598204_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_001230820.1\|5598242_5599187_-	GDP-mannose 4,6-dehydratase	L7RCI0	Acanthamoeba_polyphaga_moumouvirus	2.1e-26	31.3
WP_000790044.1\|5599479_5600274_+	sulfotransferase family 2 domain-containing protein	A0A288WG17	Bacillus_phage	1.4e-66	50.8
WP_000405122.1\|5600492_5601215_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_001031897.1\|5601242_5602115_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_000690976.1\|5602338_5603415_+	glycoside hydrolase family 99-like domain-containing protein	NA	NA	NA	NA
WP_000651997.1\|5608691_5609405_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.3e-36	37.6
WP_000845331.1\|5609394_5610408_+	HAMP domain-containing histidine kinase	A0A2K9L4R6	Tupanvirus	2.1e-08	23.4
WP_000074581.1\|5610476_5611406_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.0e-41	43.8
WP_000247711.1\|5611398_5612136_+	ABC transporter permease	NA	NA	NA	NA
WP_060852477.1\|5612153_5612951_+	undecaprenyl-diphosphate phosphatase UppP	NA	NA	NA	NA
WP_060852478.1\|5613305_5613764_+	ASCH domain-containing protein	NA	NA	NA	NA
WP_000719204.1\|5618915_5620421_-	aminopeptidase AmpS	W8CYF6	Bacillus_phage	9.2e-32	30.3
WP_000929885.1\|5620404_5621106_-	response regulator transcription factor	W8CYM9	Bacillus_phage	7.3e-40	36.9
WP_000833082.1\|5621250_5622576_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	6.4e-45	30.1
5624906:5624923	attL	NA	NA	NA	NA
WP_060852479.1\|5625217_5625427_-	hypothetical protein	NA	NA	NA	NA
WP_060852480.1\|5625439_5625769_-\|head	phage head closure protein	NA	NA	NA	NA
WP_060852481.1\|5625785_5627426_-\|terminase	terminase large subunit	A0A290GJW3	Caldibacillus_phage	1.4e-158	51.9
WP_060852482.1\|5627430_5627778_-	hypothetical protein	A0A290GJQ7	Caldibacillus_phage	7.3e-17	41.2
WP_060852483.1\|5627902_5628193_-	HNH endonuclease	R9TNN2	Paenibacillus_phage	1.4e-24	51.1
WP_060852484.1\|5628185_5628473_-\|head,tail	phage gp6-like head-tail connector protein	A0A0A7RWM0	Clostridium_phage	3.7e-06	31.9
WP_060852485.1\|5628540_5629803_-\|capsid	phage major capsid protein	NA	NA	NA	NA
WP_060852486.1\|5629807_5630386_-\|head,protease	HK97 family phage prohead protease	Q8SBP9	Clostridium_phage	2.6e-11	30.2
WP_060852487.1\|5630382_5631582_-\|portal	phage portal protein	A0A1L2BY94	Clostridium_phage	1.8e-67	38.9
WP_060852488.1\|5631631_5631862_-	hypothetical protein	NA	NA	NA	NA
WP_060852489.1\|5632194_5634624_-	DUF927 domain-containing protein	Q4ZE73	Staphylococcus_phage	2.6e-84	32.7
WP_060852490.1\|5634725_5635031_-	hypothetical protein	NA	NA	NA	NA
WP_171840959.1\|5635037_5635184_-	hypothetical protein	A0A1B2APZ0	Phage_Wrath	6.8e-09	71.1
WP_060852491.1\|5635320_5635590_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_060852492.1\|5635811_5636396_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_060852493.1\|5636444_5637623_+\|integrase	site-specific integrase	S6C485	Thermus_phage	2.6e-138	62.4
WP_001029993.1\|5637701_5639336_-	chaperonin GroEL	A0A219YK78	uncultured_virus	1.5e-157	58.0
5637702:5637719	attR	NA	NA	NA	NA
WP_000917311.1\|5639374_5639659_-	co-chaperone GroES	A0A221S3C8	uncultured_virus	1.2e-20	54.8
WP_000745324.1\|5640048_5640798_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_001246201.1\|5640794_5640986_+	YdiK family protein	NA	NA	NA	NA
WP_000372699.1\|5641015_5641645_-	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_002040561.1\|5641778_5643758_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	2.8e-52	29.9
WP_000414585.1\|5644238_5645255_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.9e-68	43.4
WP_000367190.1\|5645254_5645698_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_000865740.1\|5645711_5646404_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_000049642.1\|5646384_5646858_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_000344234.1\|5653352_5653811_-	SprT family protein	NA	NA	NA	NA
WP_001143642.1\|5654006_5654123_+	cortex morphogenetic protein CmpA	NA	NA	NA	NA
WP_000426244.1\|5654180_5656349_-	RNA-binding transcriptional accessory protein	NA	NA	NA	NA
WP_000635963.1\|5656416_5656767_-	type II toxin-antitoxin system endoribonuclease NdoA	A0A2P0ZKX3	Lactobacillus_phage	4.9e-13	37.7
WP_000004570.1\|5656771_5657059_-	antitoxin EndoAI	NA	NA	NA	NA
WP_000390615.1\|5657367_5658537_-	alanine racemase	NA	NA	NA	NA
WP_002004297.1\|5658654_5659605_-	outer membrane lipoprotein carrier protein LolA	NA	NA	NA	NA
WP_000583416.1\|5659761_5660121_-	holo-ACP synthase	NA	NA	NA	NA
WP_000586917.1\|5660214_5660787_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_000961164.1\|5660779_5661742_-	UV DNA damage repair endonuclease UvsE	NA	NA	NA	NA
WP_085963705.1\|5661852_5663012_-\|transposase	IS3-like element ISBth8 family transposase	A0A0C5AEA5	Paenibacillus_phage	8.7e-38	42.0
WP_000206592.1\|5663128_5664730_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.7e-68	37.2
WP_000595959.1\|5665035_5666412_-	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase	NA	NA	NA	NA
WP_000161427.1\|5666474_5667560_-	D-alanine--D-alanine ligase	NA	NA	NA	NA
WP_060852494.1\|5667788_5669060_-	MFS transporter	A0A2H4PQR6	Staphylococcus_phage	9.6e-14	24.5
WP_000809361.1\|5669168_5670584_-	amino acid permease	NA	NA	NA	NA
WP_013141710.1\|5670815_5671988_-	homogentisate 1,2-dioxygenase	NA	NA	NA	NA
WP_000674004.1\|5671953_5672910_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_000810922.1\|5672976_5674095_-	4-hydroxyphenylpyruvate dioxygenase	NA	NA	NA	NA
WP_001083689.1\|5674488_5674599_-	DUF3948 family protein	NA	NA	NA	NA
WP_000654250.1\|5674642_5674759_-	DUF3948 family protein	NA	NA	NA	NA
WP_000654250.1\|5674793_5674910_-	DUF3948 family protein	NA	NA	NA	NA
WP_000664237.1\|5674944_5675052_-	DUF3948 family protein	NA	NA	NA	NA
WP_025988984.1\|5675096_5675213_-	DUF3948 family protein	NA	NA	NA	NA
WP_060852495.1\|5675645_5676518_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_001294518.1\|5676552_5677518_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.5e-19	30.2
WP_000030789.1\|5677514_5678495_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.1e-17	29.1
WP_000451077.1\|5678505_5679426_-	ABC transporter permease	NA	NA	NA	NA
WP_060852496.1\|5679936_5681373_-\|transposase	IS4-like element IS231C family transposase	NA	NA	NA	NA
WP_060852497.1\|5682164_5683892_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000369254.1\|5684261_5684459_+	hypothetical protein	NA	NA	NA	NA
WP_145977420.1\|5684850_5686782_-	ABC-F type ribosomal protection protein	Q6DMX7	Streptococcus_phage	3.8e-46	32.9
WP_002023099.1\|5687411_5687540_+	hypothetical protein	NA	NA	NA	NA
WP_060852499.1\|5687675_5688437_+	DUF4931 domain-containing protein	NA	NA	NA	NA
WP_085961003.1\|5688507_5689862_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	7.3e-129	85.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

6. NZ_AP014869

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

9064 : 23499

Bacillus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000538375.1\|9064_12028_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	4.1e-201	39.2
WP_000721624.1\|12374_12515_-	hypothetical protein	NA	NA	NA	NA
WP_016099414.1\|12561_13719_-	hypothetical protein	NA	NA	NA	NA
WP_002084061.1\|14212_14533_+	helix-turn-helix transcriptional regulator	A0A139ZPI6	Marinitoga_camini_virus	3.1e-06	57.1
WP_060852786.1\|14710_15307_+	DUF4236 domain-containing protein	F6K8R9	Clostridium_phage	2.2e-05	43.7
WP_000377660.1\|15592_15754_-	hypothetical protein	NA	NA	NA	NA
WP_060852787.1\|15890_16151_-	RNA chaperone Hfq	D2XQ08	Bacillus_virus	4.2e-33	78.0
WP_145977397.1\|16237_17433_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	3.4e-37	36.7
WP_060852788.1\|17841_18804_+	helix-turn-helix domain-containing protein	A0A2H4J2N5	uncultured_Caudovirales_phage	1.0e-12	43.2
WP_060852789.1\|18818_19496_+	hypothetical protein	A0A0A7AR45	Bacillus_phage	1.2e-47	44.7
WP_153598626.1\|19525_20119_+	plasmid stabilization protein	NA	NA	NA	NA
WP_001246648.1\|20184_20463_+	hypothetical protein	A0A0A7AQY6	Bacillus_phage	5.8e-33	72.5
WP_060852790.1\|21165_21375_-	preprotein translocase	NA	NA	NA	NA
WP_060852791.1\|21679_22294_+	DUF3967 domain-containing protein	NA	NA	NA	NA
WP_060852792.1\|22488_23499_+	plasmid segregation protein ParM	A0A2H4IZP5	uncultured_Caudovirales_phage	9.2e-28	28.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage