CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP014013	Bordetella bronchiseptica strain FDAARGOS_176 chromosome, complete genome	8 crisprs	csa3,DEDDh,DinG,cas3	1	0	5	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP014013_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP014013_1

1332533-1332617

Orphan

Consensus_repeat	Method
GGTGCCTGTCCCCGCGGGGACAG	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of NZ_CP014013_1

>merge|NZ_CP014013|1|1332533-1332617|CRISPRCasFinder
GGTGCCTGTCCCCGCGGGGACAGATACCGTCTTGGCAGGCTAGTGTTCATGGCGTATGACAGTGTGCCTGTCCCCGCGGGGACAG

>NZ_CP014013|1|1|1332533-1332617|CRISPRCasFinder
GGTGCCTGTCCCCGCGGGGACAG	ATACCGTCTTGGCAGGCTAGTGTTCATGGCGTATGACAG
TGTGCCTGTCCCCGCGGGGACAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP014013.1\|WP_003808566.1\|1323922_1326442_+\|AsmA-family-protein	unknown	unknown	gnl\|CDD\|236772
NZ_CP014013.1\|WP_003808591.1\|1335141_1336149_-\|phosphate/phosphite/phosphonate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270291
NZ_CP014013.1\|WP_003808574.1\|1328352_1328862_-\|pantetheine-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|234674
NZ_CP014013.1\|WP_042143348.1\|1340319_1341318_+\|thiamine-phosphate-kinase	unknown	unknown	gnl\|CDD\|235583
NZ_CP014013.1\|WP_003808589.1\|1334368_1335139_-\|phosphonate-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213223
NZ_CP014013.1\|WP_003808563.1\|1323146_1323485_-\|helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|223713
NZ_CP014013.1\|WP_003808577.1\|1328882_1329503_-\|16S-rRNA-(guanine(966)-N(2))-methyltransferase-RsmD	unknown	unknown	gnl\|CDD\|223813
NZ_CP014013.1\|WP_003808568.1\|1326832_1328050_-\|benzoate/H(+)-symporter-BenE-family-transporter	unknown	unknown	gnl\|CDD\|281578
NZ_CP014013.1\|WP_003808584.1\|1332663_1333485_-\|phosphonate-ABC-transporter,-permease-protein-PhnE	unknown	unknown	gnl\|CDD\|273441
NZ_CP014013.1\|WP_003808587.1\|1333481_1334372_-\|phosphonate-ABC-transporter,-permease-protein-PhnE	unknown	unknown	gnl\|CDD\|273441
NZ_CP014013.1\|WP_033446134.1\|1339761_1340262_+\|transcription-antitermination-factor-NusB	unknown	unknown	gnl\|CDD\|234686
NZ_CP014013.1\|WP_003808570.1\|1328046_1328298_-\|YfhL-family-4Fe-4S-dicluster-ferredoxin	unknown	unknown	gnl\|CDD\|319871
NZ_CP014013.1\|WP_010925999.1\|1330824_1332423_-\|CYTH-and-CHAD-domain-containing-protein	unknown	unknown	gnl\|CDD\|143624
NZ_CP014013.1\|WP_003808598.1\|1339262_1339790_+\|6,7-dimethyl-8-ribityllumazine-synthase	unknown	unknown	gnl\|CDD\|234606
NZ_CP014013.1\|WP_033451655.1\|1329578_1330778_+\|signal-recognition-particle-docking-protein-FtsY	unknown	unknown	gnl\|CDD\|236686
NZ_CP014013.1\|WP_003808594.1\|1336297_1337125_-\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_CP014013.1\|WP_003808597.1\|1338073_1339249_+\|3,4-dihydroxy-2-butanone-4-phosphate-synthase	unknown	unknown	gnl\|CDD\|237587
NZ_CP014013.1\|WP_003808567.1\|1326438_1326825_+\|MOSC-N-terminal-beta-barrel-domain-containing-protein	unknown	unknown	gnl\|CDD\|281474
NZ_CP014013.1\|WP_010927717.1\|1337130_1337928_-\|HAD-IIB-family-hydrolase	unknown	unknown	gnl\|CDD\|273651
NZ_CP014013.1\|WP_003808562.1\|1322643_1323150_-\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176905

Protein	Function_ID	Function_description	E-value
NZ_CP014013.1\|WP_003808566.1\|1323922_1326442_+\|AsmA-family-protein	gnl\|CDD\|236772	PRK10833, PRK10833, putative assembly protein; Provisional.	2.80816e-30
NZ_CP014013.1\|WP_003808591.1\|1335141_1336149_-\|phosphate/phosphite/phosphonate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270291	cd13573, PBP2_PnhD_3, Substrate binding domain of uncharacterized ABC-type phosphonate-like transporter; contains the type 2 periplasmic binding fold. This subfamily includes putative periplasmic binding component of an ABC transport system similar to alkylphosphonate binding domain PnhD. These domains are found in PnhD-like proteins that are predicted to function as initial receptors in hypophosphite, phosphonate, or phosphate ABC transport in archaea and eubacteria. They belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	3.92107e-151
NZ_CP014013.1\|WP_003808574.1\|1328352_1328862_-\|pantetheine-phosphate-adenylyltransferase	gnl\|CDD\|234674	PRK00168, coaD, phosphopantetheine adenylyltransferase; Provisional.	3.03384e-101
NZ_CP014013.1\|WP_042143348.1\|1340319_1341318_+\|thiamine-phosphate-kinase	gnl\|CDD\|235583	PRK05731, PRK05731, thiamine monophosphate kinase; Provisional.	1.12252e-133
NZ_CP014013.1\|WP_003808589.1\|1334368_1335139_-\|phosphonate-ABC-transporter-ATP-binding-protein	gnl\|CDD\|213223	cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system. Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond. Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only prokaryotic microorganisms are able to cleave this bond. Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	6.7095e-115
NZ_CP014013.1\|WP_003808563.1\|1323146_1323485_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|223713	COG0640, ArsR, Predicted transcriptional regulators [Transcription].	2.51065e-15
NZ_CP014013.1\|WP_003808577.1\|1328882_1329503_-\|16S-rRNA-(guanine(966)-N(2))-methyltransferase-RsmD	gnl\|CDD\|223813	COG0742, COG0742, N6-adenine-specific methylase [DNA replication, recombination, and repair].	1.53382e-57
NZ_CP014013.1\|WP_003808568.1\|1326832_1328050_-\|benzoate/H(+)-symporter-BenE-family-transporter	gnl\|CDD\|281578	pfam03594, BenE, Benzoate membrane transport protein.	3.72852e-112
NZ_CP014013.1\|WP_003808584.1\|1332663_1333485_-\|phosphonate-ABC-transporter,-permease-protein-PhnE	gnl\|CDD\|273441	TIGR01097, PhnE, phosphonate ABC transporter, permease protein PhnE. Phosphonates are a class of compound analogous to organic phosphates, but in which the C-O-P linkage is replaced by a direct, stable C-P bond. Some bacteria can utilize phosphonates as a source of phosphorus. This family consists of permease proteins of known or predicted phosphonate ABC transporters. Often this protein is found as a duplicated pair, occasionally as a fused pair. Certain "second" copies score in between the trusted and noise cutoff and should be considered true hits (by context). [Transport and binding proteins, Anions].	1.08607e-97
NZ_CP014013.1\|WP_003808587.1\|1333481_1334372_-\|phosphonate-ABC-transporter,-permease-protein-PhnE	gnl\|CDD\|273441	TIGR01097, PhnE, phosphonate ABC transporter, permease protein PhnE. Phosphonates are a class of compound analogous to organic phosphates, but in which the C-O-P linkage is replaced by a direct, stable C-P bond. Some bacteria can utilize phosphonates as a source of phosphorus. This family consists of permease proteins of known or predicted phosphonate ABC transporters. Often this protein is found as a duplicated pair, occasionally as a fused pair. Certain "second" copies score in between the trusted and noise cutoff and should be considered true hits (by context). [Transport and binding proteins, Anions].	2.14802e-90
NZ_CP014013.1\|WP_033446134.1\|1339761_1340262_+\|transcription-antitermination-factor-NusB	gnl\|CDD\|234686	PRK00202, nusB, transcription antitermination factor NusB.	1.02433e-51
NZ_CP014013.1\|WP_003808570.1\|1328046_1328298_-\|YfhL-family-4Fe-4S-dicluster-ferredoxin	gnl\|CDD\|319871	cd10549, MtMvhB_like, Uncharacterized polyferredoxin-like protein. This family contains uncharacterized polyferredoxin protein similar to Methanobacterium thermoautotrophicum MvhB. The mvhB is a gene of the methylviologen-reducing hydrogenase operon. It is predicted to contain 12 [4Fe-4S] clusters, and was therefore suggested to be a polyferredoxin. As a subfamily of the beta subunit of the DMSO Reductase (DMSOR) family, it is predicted to function as electron carrier in the reducing reaction.	1.53234e-06
NZ_CP014013.1\|WP_010925999.1\|1330824_1332423_-\|CYTH-and-CHAD-domain-containing-protein	gnl\|CDD\|143624	cd07756, CYTH-like_Pase_CHAD, Uncharacterized subgroup of the CYTH-like superfamily having an associated CHAD domain. This subgroup belongs to the CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) superfamily. Members of this superfamily hydrolyze triphosphate-containing substrates, require metal cations as cofactors, and have a unique active site located at the center of an eight-stranded antiparallel beta barrel tunnel (the triphosphate tunnel). A number of proteins in this subgroup also contain a C-terminal CHAD (Conserved Histidine Alpha-helical Domain) domain which may participate in metal chelation or act as a phosphor-acceptor. The name CYTH originated from the gene designation for bacterial class IV adenylyl cyclases (CyaB) and from thiamine triphosphatase. Class IV adenylate cyclases catalyze the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. Thiamine triphosphatase is a soluble cytosolic enzyme which converts thiamine triphosphate to thiamine diphosphate. This domain superfamily also contains RNA triphosphatases, membrane-associated polyphosphate polymerases, tripolyphosphatases, nucleoside triphosphatases, nucleoside tetraphosphatases and other proteins with unknown functions. Proteins of this subgroup have not been characterized.	5.2147e-56
NZ_CP014013.1\|WP_003808598.1\|1339262_1339790_+\|6,7-dimethyl-8-ribityllumazine-synthase	gnl\|CDD\|234606	PRK00061, ribH, 6,7-dimethyl-8-ribityllumazine synthase; Provisional.	4.04555e-65
NZ_CP014013.1\|WP_033451655.1\|1329578_1330778_+\|signal-recognition-particle-docking-protein-FtsY	gnl\|CDD\|236686	PRK10416, PRK10416, signal recognition particle-docking protein FtsY; Provisional.	6.9373e-175
NZ_CP014013.1\|WP_003808594.1\|1336297_1337125_-\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	9.15813e-52
NZ_CP014013.1\|WP_003808597.1\|1338073_1339249_+\|3,4-dihydroxy-2-butanone-4-phosphate-synthase	gnl\|CDD\|237587	PRK14019, PRK14019, bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II.	0
NZ_CP014013.1\|WP_003808567.1\|1326438_1326825_+\|MOSC-N-terminal-beta-barrel-domain-containing-protein	gnl\|CDD\|281474	pfam03476, MOSC_N, MOSC N-terminal beta barrel domain. This domain is found to the N-terminus of pfam03473. The function of this domain is unknown, however it is predicted to adopt a beta barrel fold.	7.15282e-08
NZ_CP014013.1\|WP_010927717.1\|1337130_1337928_-\|HAD-IIB-family-hydrolase	gnl\|CDD\|273651	TIGR01484, Putative_mannosyl-3-phosphoglycerate_phosphatase, HAD-superfamily hydrolase, subfamily IIB. This subfamily falls within the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. The Class II subfamilies are characterized by a domain that is located between the second and third conserved catalytic motifs of the superfamily domain. The IIB subfamily is distinguished from the IIA subfamily (TIGR01460) by homology and the predicted secondary structure of this domain by PSI-PRED. The IIB subfamily's Class II domain has the following predicted structure: Helix-Sheet-Sheet-(Helix or Sheet)-Helix-Sheet-(variable)-Helix-Sheet-Sheet. The IIB subfamily consists of Trehalose-6-phosphatase (TIGR00685), plant and cyanobacterial Sucrose-phosphatase and a closely related group of bacterial and archaeal sequences, eukaryotic phosphomannomutase (pfam03332), a large subfamily ("Cof-like hydrolases", TIGR00099) containing many closely related bacterial sequences, a hypothetical equivalog containing the E. coli YedP protein, as well as two small clusters containing OMNI\|TC0379 and OMNI\|SA2196 whose relationship to the other groups is unclear. [Unknown function, Enzymes of unknown specificity].	7.51884e-15
NZ_CP014013.1\|WP_003808562.1\|1322643_1323150_-\|SRPBCC-family-protein	gnl\|CDD\|176905	cd08896, SRPBCC_CalC_Aha1-like_3, Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins. SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of a functionally uncharacterized subgroup of CalC- and Aha1-like proteins. This group shows similarity to the SRPBCC domains of Micromonospora echinospora CalC (a protein which confers resistance to enediynes) and human Aha1 (one of several co-chaperones which regulate the dimeric chaperone Hsp90), and belongs to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands.	7.32648e-83

>NZ_CP014013.1|WP_010925999.1|1330824_1332423_-|CYTH-and-CHAD-domain-containing-protein
MSEQELKLHVPAAARAAVQQQIQQRQAARIRLHAMYFDTPGRELARARIAIRLRQEGRDWVQTLKMPGANAISRVEINHPRPGPVLDLSVYAGTEAQAALTAIKGELGLRYETDVQRLFCKVRGRHGTVELAYDTGVLRAGALELPISELEFELVSGRPAAIFAMARSWLQRHGLVLDARSKSERGDALAQLAHDLAAAPGEADDAARATRDQQAVAGFWAPRNAGAVKLDESMTPMQAMAAVAAECVDHIARNAAVLAEVDTLGVYRAGTPEHVHQLRVGVRRLRSAWRLFDGWIADPSETLAQGARTHFSAFGMARDQDVLADTIMPLLARAGMPALPAEAAPSNDNAQSLAADRAFQGWLLELLAWSLDVPPPPAPAATAEAAAASPTIIPLAPPAEAAPPALRKRLTGRLRRWHLKVIDEGLRFGALELEARHELRKRVKRLRYGLSFAESLLPAARLRTYRKQLARVQDLLGEINDLAVARDYYQAALQAHPQAWFAVGWIGARLDGLTPQAQEAFDQLAHAKPFWK
>NZ_CP014013.1|WP_033451655.1|1329578_1330778_+|signal-recognition-particle-docking-protein-FtsY
MFSFFKKKSPPPAAPAQPAPPPEAVDAGSAAPAKPQPAEPQPAPMPAPQPEPQPEPQPQQPPEPAPPAMASPPVAEPQPPVAEPQPPVAAAPEAPRKASWLSRLKQGLSRTGQNIGGLFVGVKVDENLFEELESALIMADAGIEATEKLLAALRARVKKERIDDPAQVKTALRQLLADHLRPLERSFDLGRAQPLVVMIAGVNGAGKTTSIGKLAHTFQRQGASVLLAAGDTFRAAAREQLVEWGSRNNVTVISQDGGDPAAVAFDSVNAGRARNVGVVMVDTAGRLPTQLHLMEELKKIRRVIGKAEASAPHEVLLVVDGNTGQNALAQIRAFDAAITLTGLVVTKLDGTAKGGTLAAVAAGSQGVRPIPVYWIGVGEGLEDLQPFVADEFAAALLAD
>NZ_CP014013.1|WP_003808577.1|1328882_1329503_-|16S-rRNA-(guanine(966)-N(2))-methyltransferase-RsmD
MKPSRPGSKPIRIVGGLYRRTLIPVADAPGLRPTPDRVRETLFNWLNHLWGGEFADKRVLDLFAGSGALGFEAASRGAGQVQMVERDRGAAAALRTLRDKLQAGAVRIHAGDAMQVIERMDASRFDLVLLDPPFGQGWLERLWPLLPAVLAEDGLVYVESETAPAPPAGFELLREGKAGAVHYRLFQFAAMRKSMNNPALEDGASH
>NZ_CP014013.1|WP_003808574.1|1328352_1328862_-|pantetheine-phosphate-adenylyltransferase
MIIAVYPGTFDPLTRGHEDLVRRAATLFDKVVVGIAHSRNKKPFFTIEERVDIAREVLGHYPNVEVHSFGGLLKDFVRDQNGRVIIRGLRAVSDFEYEFQMAGMNRHLLPDVETMFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVERWLQAKAKERREQSAQGGA
>NZ_CP014013.1|WP_003808570.1|1328046_1328298_-|YfhL-family-4Fe-4S-dicluster-ferredoxin
MALKITEECINCDVCEPQCPNEAISMGADYYVIDPDRCTECVGHHDEPQCKVVCPVECIELHPQWQEGQEQLMAKYRRLTGAA
>NZ_CP014013.1|WP_003808568.1|1326832_1328050_-|benzoate/H(+)-symporter-BenE-family-transporter
MNGADSASSPLAARRPVTGALSLSAIVAGLVAVLVSFGGTAVLMVQAGHAAGLDAARIGSWLGSICLALGVGGALISLRSRMPVVFAWSTPGAALLVTGLVGVPFDQAVGAFVLAAALTLACGVFGWIDPIVRRIPAELAAAMLAGVLLNFGMGIFGSIAAQPVLVLSMCAAYLLGRRWAPRFAVLAVLVVGLAAASSLDLLRLGHVQWAWTEFVWTTPSFTWQAAISLGIPLFVVAMASQNLPGLAILQAAGYRPPASRLVGLTGLAGLLAAPFGAHSVTLGAIIAALCAGPEAHADPGRRYVAAATYGLTYVLLSVAAGAVAVFFQALPGALIAALAGLALLGAIMGGMTTAMADPQRREAALVTLLATASGISFWGIGSAFWGLAAGLATHGALAWRRARSA
>NZ_CP014013.1|WP_003808567.1|1326438_1326825_+|MOSC-N-terminal-beta-barrel-domain-containing-protein
MSTTAYQPIAECGATTQSEAAAYQKRWLVANDAGQWLNRDLCPRLAEVSVELRMGYLVLKAPGMLRLDIPLDVIEDDDSVRYQMLVGEQTVDVVDEGELAAAWISNHAGVPCRILKVHPDMAEVRWPS
>NZ_CP014013.1|WP_003808566.1|1323922_1326442_+|AsmA-family-protein
MKTWFKRIVIGLVVLVVVAVVGLAIFLLTFDPNAYKYKLEEAVQARYERTLNIEGEIELSLFPRIGLAVQGVSLSEPNSPDVFASIDSMRLAVAVWPLLSNSLVVDHVTINGFKARVIRGKDGHFNFENLVGGSVQSTDVPGNAAEATAGAITGTAQAIVNGTVSTPKSMQIDIAGLDLKDGEIQLQDAMSGMAVAITKLNAATGRVTYNQPFDVSLSARVEGGNPRLDAGLTGQAQLTLDPLAKRYAAQRLDLRMEGRLPGAQAKSLAARGNVAFNGMTSSLDVAGLEILFQGDIVDTATKLTNVEASVAMPKLAVDPHKTELQIDKLAVRAKGAMPGGPFELAVDAPALNISPTNASGDALSGRVRTQELDASFGLNGISGNAGELDIKEAKLDSTLKQGERVVKSAFASPVTLNLLQRSIGLSALKGDVNITDPGLPKGSLQIPVIGSVNANLLKDQANARINAVLEGGKFDLSADIVALSAVPRVTFALAVDTLDLDKLAPPAGASAPPKPAGDGKQDESKPPAKPQPAPAPAAADDSINLSGLVGPTASGTIKIGQLVMRGLKAEQVAANIKLEKGKLDISTLTAALYGGKLGGVMSVDAVNGNQLVAKMSLAGIAIQPLLSDLAGKDTLSGTGSLAFDLKTAGANTYAMKSGLAGTMQVRLRDGAIKGINVAQTLRELKAMFRGEAHDPTVQDDQTRQTDFTSLESDLVFNKGVATVKRLDMAAPLLRVNQGNPANIDFVRSELDFVARVRVVNTSTGQDGKDLAELRNLTIPLLITGPFDKPVYTLQWREVAGEALKRGLEKQLKEALTGGEGASGSPAKNIDKALKGILGK
>NZ_CP014013.1|WP_003808563.1|1323146_1323485_-|helix-turn-helix-transcriptional-regulator
MPNQAAQLSQVFQALSDPTRRAVLERLCQGSAAMSELARPFNMALPSFSQHLDVLERCGLVRSRKSGRVRIYTLAPQPLGMAEHWMTRQRAIWERRLDQLDLYLQDLKEQKR
>NZ_CP014013.1|WP_003808562.1|1322643_1323150_-|SRPBCC-family-protein
MTRQHSTQPDPKLDLVLERTIDVPPALVWQAWTQPEHIKHWLTPAPWQTVRCDVDLRPGGRFRFVMRSPEGEEHTHDCCYLEIVEGSRLVWTNALLPGFRPAGGGGDVPAFTAVIRIEPHDQGTRYTATAMHGTQAGCRQHSDMGFHDGWGAALDQLVAHARNMQQAS
>NZ_CP014013.1|WP_003808584.1|1332663_1333485_-|phosphonate-ABC-transporter,-permease-protein-PhnE
MNTSVTSLEPGHPRTWQRYSGGQKALRFMLYLLLVAAIVQAVRSVEVIPEFLYDAPEQMADLLRRMWPIDWSYYPEGVHAALVETLHIATLGTILSVGMAVPVGLLAANNLTPSRTINMLARLILVSSRSVNSLVWALLFIAIFGPGALAGTLAIAFRSIGFVGKLVGEAIEEAQRGPIEALTATGASKAAVLWYGYWPQIRPSFWSIVLLRWDINVRESAVLGLVGAGGIGMALDTALNLFQWDRVALVLAAIFIVVVAAEIVITQARKRIL
>NZ_CP014013.1|WP_003808587.1|1333481_1334372_-|phosphonate-ABC-transporter,-permease-protein-PhnE
MTVRTANMARRPFSLSWRAKTGVLLVVLYTFYAAAQLDFSWARFETGLGHAATFLARMFPPNFEKPDTLWKGIAESLEIAVLASVLGILLSLPIGLLGARNLMPAWASWPARALVALCRALHPVIVAILFVKAVGFGALAGILALTVASIGFIGKLFTEAIEEISLKQVEAVRASGASFGNVIIFGVLPQVFARFVGFATYQFDSNLRNSTMVGIVGAGGIGGTLFSAFQRFDYDFVAAILLTLIAIIMLGEILAGFVRKVFLDNMGFERILQRRFTAARGLGSTTPLARKGEVDE
>NZ_CP014013.1|WP_003808589.1|1334368_1335139_-|phosphonate-ABC-transporter-ATP-binding-protein
MATSLRITGLVKEYRAGKPVLNGIDLDIAGQGLTAIIGPSGTGKSTLLRCINRLIEPTSGEIVLKDAEGTVDLARVRGQSLRRARRRIGMVFQEYNLVERLTVMENLLTGRLGYTSALNAWMRRFDPADIERAFQLLDTVGLAGFADQRADALSGGQRQRVGIARALMQRPQLLLADEPTSSLDPKTSVEIMELLTEQGSVNGIPVLVNIHDVELARRYANRIVGMSGGHVVYDGDGKGLDATMLKTIYGGESWLE
>NZ_CP014013.1|WP_003808591.1|1335141_1336149_-|phosphate/phosphite/phosphonate-ABC-transporter-substrate-binding-protein
MRAKRLLQAAAVTALIFGSYAAQAADAACSNRGDLDNMYCDANKDLVADTPTDKSKLKTPSTLVFTYTPVEDPAVYEDIFKPFTKHLSECTGKRVVFYQVQSNAAEIEAMRSGRLHVGGFSTGPTAFAVNIAGAVPFAVKGYADEFQGYNLIVIVKKDSPYQKLTDLKGKKLAHTAPSSNSGHMAPVALFPKEGLTPDKDYKVIFSGKHDQSVMGVNSGDYDAAAVASDVFKRMAERGQVKEEDFRVIYRSEKFPTSSFAYAHDLEPAFRDKMLKCFYDYRFPDEMKKAFDGADRFYPVTYQKDWAIVREVAESGGEKFNRAAYDRETAKSKGKQ
>NZ_CP014013.1|WP_003808594.1|1336297_1337125_-|IclR-family-transcriptional-regulator
MSAAKSTAKPAAAPGNDGRRSIQSVEVGFPLLAALVDAGRPLTLRDLAGAAGMTSAKAHPYLVSFTRVGLVQQDTVTGQYELGPFALQMGLVSLQRLDPVRVALPEVDKLQSEIGHTLGIAVLGSHGPTMIHITEASYPVHVNMRKGTVMSMLHTATGQVFAAWLPPKVAEHYIAREDGDAAVIASLTPRKTTRANLDAMLADIRVHGMARALGNPLPGVDALSVPVFDHTGGIVLALTSLGPTGLFDASFTGAIARPLLACAQEISRKLGYRGN
>NZ_CP014013.1|WP_010927717.1|1337130_1337928_-|HAD-IIB-family-hydrolase
MQALAAMPAPVAASVRIVLTDIDDTLTTEGRLPAGAYAALERLEQAGIVVVPITGRPAGWCDHIARMWPVRAVVGENGAFYYAYDRSARRMNAHYWADAATRAANRQALQAIRERVLREVPGTAVASDQDYRVADLAIDFCEDVPALPDGAVGRIVEIFHEAGAQAKVSSIHVNGWFGDYDKLTMTRTLFEREFGLNIDSALQHTLFIGDSPNDEPMFKFFPISVGVANIQSQLHRIQHRPAFVAAARGGDGFVEMAERLLANRG
>NZ_CP014013.1|WP_003808597.1|1338073_1339249_+|3,4-dihydroxy-2-butanone-4-phosphate-synthase
MSAQISSLNAGAAPESFGIASVPEIIAELRAGRIVILVDEEDRENEGDLVMAAEFVTPEAINFMVTHGRGLVCLTLTEERCRQLDLPLMASRNGTRYGTNFTQSIEAAEGVETGISAADRARTIQVAVARDAQPSDLVQPGHIFPVRAVPGGVLVRAGHTEAGCDLTAMGGLTPAAVICEILKPDGTMARLPDLVEFAREHKLKIGTIADLIQYRSEHESIIARMGERMMQTPWGDFRCIAYRDDATRSPHLALVHGNIDPERETLVRVHEPASLLDVLDTGASPHSWSVGQALHAIAASPAGVLVLMNCQSSTEHLFGQIANWAGPAERAAAQEGDRFGLRTYGIGAQILRDLNVGRMKLLARPRKMPSMAGFALTITGYDCAPPNLRND
>NZ_CP014013.1|WP_003808598.1|1339262_1339790_+|6,7-dimethyl-8-ribityllumazine-synthase
MNPYILTPDLNGEGLHIGIVRARFNEEIGQAQLQACLEELGKLGVDERDVMVVSVPGALELGVALARMAESYEFDALIALGAVIRGETYHFEVVSNESAAAISRIALETGIPVANGVLTVDTDEQAQARAAGKGADCAQVAVEMANLAAALEPEEDDEDEDDEDEDFDDEEDDGR
>NZ_CP014013.1|WP_033446134.1|1339761_1340262_+|transcription-antitermination-factor-NusB
MTTKKTTAADNAVQARANARSARRRAREFALQGVYAWLLRGGEGTQDAGEIDAHLRDAEDFSEADAQWFKTLLHGVLREAPVLRERFLPYIDRPLAELSPVEHGILLIGSFELMHHVEVPYKVAINEAVELAKSFGGTDGFKFVNGVLDKLAADVRTAEVQAAPRR
>NZ_CP014013.1|WP_042143348.1|1340319_1341318_+|thiamine-phosphate-kinase
MASEFDLIARYFTRPAPDGVLGVGDDCALFPVPPGQQVATSTDLLIEGRHFFPDVDPQALGHKALAVNLSDLAAMGARPVGCLLGLALPGVDEAWLAAFARGFQALADTHACPLIGGDTTRAPQGLLAISVTVFGAVAPGHALRRAAAQPGDDVWVSGELGAADIAYRLLDRQLPADPLRLAATRAALEWPRPRVELGMALAGLARAGIDISDGLLQDLGHILAASGVAAELRYDALPVAAALAGLPAETVRRAALGGGDVYELCFTADPAHRQAIGQAAHGAGAPVSRIGRILAGQGLRVLDADGAPLGELPGGFDHFSDATDQPAPGRRP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP014013_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP014013_2

3495526-3495684

Orphan

Consensus_repeat	Method
CACCGGCCGGGGCGGAAGCGGCTGAGCCGTTTCGACCTTCGGCCGCGGCAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP014013_2

>merge|NZ_CP014013|2|3495526-3495684|CRISPRCasFinder
CACCGGCCGGGGCGGAAGCGGCTGAGCCGTTTCGACCTTCGGCCGCGGCACGACCTCCACCTTGGCGACCTCCACCTTGGGAGGCACCACCGGCACCGCCTTGGCCGGCACCGGCCGGGGCGGAAGCGGCTGGGCCGTTTCGACCTTCGGCCGCGGCAC

>NZ_CP014013|2|2|3495526-3495684|CRISPRCasFinder
CACCGGCCGGGGCGGAAGCGGCTGAGCCGTTTCGACCTTCGGCCGCGGCAC	GACCTCCACCTTGGCGACCTCCACCTTGGGAGGCACCACCGGCACCGCCTTGGCCGG
CACCGGCCGGGGCGGAAGCGGCTGGGCCGTTTCGACCTTCGGCCGCGGCAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP014013.1\|WP_010926712.1\|3516833_3517883_-\|TRAP-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270320
NZ_CP014013.1\|WP_003811059.1\|3516103_3516724_-\|TRAP-transporter-small-permease	unknown	unknown	gnl\|CDD\|377284
NZ_CP014013.1\|WP_104442494.1\|3507047_3510764_+\|virulence-factors-two-component-system-sensor-histidine-kinase-BvgS	unknown	unknown	gnl\|CDD\|182169
NZ_CP014013.1\|WP_010926706.1\|3490241_3492863_-\|fimbrial-biogenesis-outer-membrane-usher-protein	unknown	unknown	gnl\|CDD\|376353
NZ_CP014013.1\|WP_003811089.1\|3485566_3486067_+\|TRAP-transporter-small-permease	unknown	unknown	gnl\|CDD\|377284
NZ_CP014013.1\|WP_010926711.1\|3512671_3514021_-\|amidase	unknown	unknown	gnl\|CDD\|235921
NZ_CP014013.1\|WP_010926705.1\|3489130_3490228_-\|fimbrial-protein	unknown	unknown	gnl\|CDD\|226069
NZ_CP014013.1\|WP_010930609.1\|3506409_3507039_+\|virulence-factors-two-component-system-response-regulator-BvgA	unknown	unknown	gnl\|CDD\|225107
NZ_CP014013.1\|WP_033447514.1\|3514081_3514768_-\|DUF2848-domain-containing-protein	unknown	unknown	gnl\|CDD\|371339
NZ_CP014013.1\|WP_010926704.1\|3487386_3489138_-\|filamentous-hemagglutinin-transporter-protein-FhaC	unknown	unknown	gnl\|CDD\|377148
NZ_CP014013.1\|WP_138142578.1\|3492925_3493660_-\|molecular-chaperone-FimB	unknown	unknown	gnl\|CDD\|225663
NZ_CP014013.1\|WP_010930607.1\|3511819_3512614_-\|putative-hydro-lyase	unknown	unknown	gnl\|CDD\|180100
NZ_CP014013.1\|WP_003811054.1\|3518225_3519134_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP014013.1\|WP_003811093.1\|3483023_3484322_+\|TRAP-transporter-large-permease-subunit	unknown	unknown	gnl\|CDD\|129868
NZ_CP014013.1\|WP_003811061.1\|3514823_3516107_-\|TRAP-transporter-large-permease	unknown	unknown	gnl\|CDD\|224509
NZ_CP014013.1\|WP_010926709.1\|3510810_3511686_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|376350
NZ_CP014013.1\|WP_003811078.1\|3493909_3494515_-\|fimbrial-protein	unknown	unknown	gnl\|CDD\|339870
NZ_CP014013.1\|WP_010930616.1\|3484585_3485560_+\|TRAP-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270320
NZ_CP014013.1\|WP_010926703.1\|3486059_3487361_+\|TRAP-transporter-large-permease-subunit	unknown	unknown	gnl\|CDD\|129868
NZ_CP014013.1\|WP_010926702.1\|3482539_3483031_+\|TRAP-transporter-small-permease	unknown	unknown	gnl\|CDD\|377284

Protein	Function_ID	Function_description	E-value
NZ_CP014013.1\|WP_010926712.1\|3516833_3517883_-\|TRAP-transporter-substrate-binding-protein	gnl\|CDD\|270320	cd13602, PBP2_TRAP_BpDctp6_7, Substrate-binding domain of a pyroglutamic acid binding DctP subfamily of the tripartite ATP-independent periplasmic transporters; contains the type 2 periplasmic binding protein fold. DctP6 and DctP7 groups of the TRAP transporters that involved in pyroglutamic acid transport. TRAP transporters are a large family of solute transporters ubiquitously found in bacteria and archaea. They are comprised of a periplasmic substrate-binding protein (SBP; often called the P subunit) and two unequally sized integral membrane components: a large transmembrane subunit involved in the translocation process (the M subunit) and a smaller membrane of unknown function (the Q subunit). The driving force of TRAP transporters is provided by electrochemical ion gradients (either protons or sodium ions) across the cytoplasmic membrane, rather than ATP hydrolysis. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	6.91168e-120
NZ_CP014013.1\|WP_003811059.1\|3516103_3516724_-\|TRAP-transporter-small-permease	gnl\|CDD\|377284	pfam04290, DctQ, Tripartite ATP-independent periplasmic transporters, DctQ component. The function of the members of this family is unknown, but DctQ homologs are invariably found in the tripartite ATP-independent periplasmic transporters.	1.22416e-16
NZ_CP014013.1\|WP_104442494.1\|3507047_3510764_+\|virulence-factors-two-component-system-sensor-histidine-kinase-BvgS	gnl\|CDD\|182169	PRK09959, PRK09959, acid-sensing system histidine kinase EvgS.	7.05378e-146
NZ_CP014013.1\|WP_010926706.1\|3490241_3492863_-\|fimbrial-biogenesis-outer-membrane-usher-protein	gnl\|CDD\|376353	pfam00577, Usher, Outer membrane usher protein. In Gram-negative bacteria the biogenesis of fimbriae (or pili) requires a two- component assembly and transport system which is composed of a periplasmic chaperone and an outer membrane protein which has been termed a molecular 'usher'. The usher protein is rather large (from 86 to 100 Kd) and seems to be mainly composed of membrane-spanning beta-sheets, a structure reminiscent of porins. Although the degree of sequence similarity of these proteins is not very high they share a number of characteristics. One of these is the presence of two pairs of cysteines, the first one located in the N-terminal part and the second at the C-terminal extremity that are probably involved in disulphide bonds. The best conserved region is located in the central part of these proteins.	0
NZ_CP014013.1\|WP_003811089.1\|3485566_3486067_+\|TRAP-transporter-small-permease	gnl\|CDD\|377284	pfam04290, DctQ, Tripartite ATP-independent periplasmic transporters, DctQ component. The function of the members of this family is unknown, but DctQ homologs are invariably found in the tripartite ATP-independent periplasmic transporters.	1.01797e-16
NZ_CP014013.1\|WP_010926711.1\|3512671_3514021_-\|amidase	gnl\|CDD\|235921	PRK07056, PRK07056, amidase; Provisional.	0
NZ_CP014013.1\|WP_010926705.1\|3489130_3490228_-\|fimbrial-protein	gnl\|CDD\|226069	COG3539, FimA, P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion].	3.3674e-07
NZ_CP014013.1\|WP_010930609.1\|3506409_3507039_+\|virulence-factors-two-component-system-response-regulator-BvgA	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	3.75971e-63
NZ_CP014013.1\|WP_033447514.1\|3514081_3514768_-\|DUF2848-domain-containing-protein	gnl\|CDD\|371339	pfam11010, DUF2848, Protein of unknown function (DUF2848). This bacterial family of proteins has no known function.	3.13537e-91
NZ_CP014013.1\|WP_010926704.1\|3487386_3489138_-\|filamentous-hemagglutinin-transporter-protein-FhaC	gnl\|CDD\|377148	pfam03865, ShlB, Haemolysin secretion/activation protein ShlB/FhaC/HecB. This family represents a group of sequences that are related to ShlB from Serratia marcescens. ShlB is an outer membrane protein pore involved in the Type Vb or Two-partner secretion system where it is functions to secrete and activate the haemolysin ShlA. The activation of ShlA occurs during secretion when ShlB imposes a conformational change in the inactive haemolysin to form the active protein.	4.10341e-92
NZ_CP014013.1\|WP_138142578.1\|3492925_3493660_-\|molecular-chaperone-FimB	gnl\|CDD\|225663	COG3121, FimC, P pilus assembly protein, chaperone PapD [Cell motility and secretion / Intracellular trafficking and secretion].	2.05728e-76
NZ_CP014013.1\|WP_010930607.1\|3511819_3512614_-\|putative-hydro-lyase	gnl\|CDD\|180100	PRK05463, PRK05463, putative hydro-lyase.	0
NZ_CP014013.1\|WP_003811054.1\|3518225_3519134_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	8.89176e-42
NZ_CP014013.1\|WP_003811093.1\|3483023_3484322_+\|TRAP-transporter-large-permease-subunit	gnl\|CDD\|129868	TIGR00786, TRAP_transporter_permease_protein_SiaT, TRAP transporter, DctM subunit. The Tripartite ATP-independent Periplasmic Transporter (TRAP-T) Family (TC 2.A.56)- DctM subunit TRAP-T family permeases generally consist of three components, and these systems have so far been found in Gram-negative bacteria, Gram-postive bacteria and archaea. Only one member of the family has been both sequenced and functionally characterized. This system is the DctPQM system of Rhodobacter capsulatus (Forward et al., 1997). DctP is a periplasmic dicarboxylate (malate, fumarate, succinate) binding receptor that is biochemically well-characterized. DctQ is an integral cytoplasmic membrane protein with 4 putative transmembrane a-helical spanners (TMSs). DctM is a second integral cytoplasmic membrane protein with 12 putative TMSs. These proteins have been shown to be both necessary and sufficient for the proton motive force-dependent uptake of dicarboxylates into R. capsulatus. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	3.23324e-98
NZ_CP014013.1\|WP_003811061.1\|3514823_3516107_-\|TRAP-transporter-large-permease	gnl\|CDD\|224509	COG1593, DctQ, TRAP-type C4-dicarboxylate transport system, large permease component [Carbohydrate transport and metabolism].	8.16313e-87
NZ_CP014013.1\|WP_010926709.1\|3510810_3511686_-\|EAL-domain-containing-protein	gnl\|CDD\|376350	pfam00563, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues. The EAL domain is a good candidate for a diguanylate phosphodiesterase function. The domain contains many conserved acidic residues that could participate in metal binding and might form the phosphodiesterase active site.	2.2408e-48
NZ_CP014013.1\|WP_003811078.1\|3493909_3494515_-\|fimbrial-protein	gnl\|CDD\|339870	pfam16970, FimA, Type-1 fimbrial protein, A. FimA is a family of Gram-negative fimbrial component A proteins that form part of the pili. There are usually up to 1000 copies of this subunit in one pilus that form a helically wound rod onto which the tip fibrillum (FimF.FimG, FimH) is attached. Pilus subunits are translocated from the cytoplasm to the periplasm via the general secretory pathway SecYEG.	7.01167e-69
NZ_CP014013.1\|WP_010930616.1\|3484585_3485560_+\|TRAP-transporter-substrate-binding-protein	gnl\|CDD\|270320	cd13602, PBP2_TRAP_BpDctp6_7, Substrate-binding domain of a pyroglutamic acid binding DctP subfamily of the tripartite ATP-independent periplasmic transporters; contains the type 2 periplasmic binding protein fold. DctP6 and DctP7 groups of the TRAP transporters that involved in pyroglutamic acid transport. TRAP transporters are a large family of solute transporters ubiquitously found in bacteria and archaea. They are comprised of a periplasmic substrate-binding protein (SBP; often called the P subunit) and two unequally sized integral membrane components: a large transmembrane subunit involved in the translocation process (the M subunit) and a smaller membrane of unknown function (the Q subunit). The driving force of TRAP transporters is provided by electrochemical ion gradients (either protons or sodium ions) across the cytoplasmic membrane, rather than ATP hydrolysis. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	6.1715e-122
NZ_CP014013.1\|WP_010926703.1\|3486059_3487361_+\|TRAP-transporter-large-permease-subunit	gnl\|CDD\|129868	TIGR00786, TRAP_transporter_permease_protein_SiaT, TRAP transporter, DctM subunit. The Tripartite ATP-independent Periplasmic Transporter (TRAP-T) Family (TC 2.A.56)- DctM subunit TRAP-T family permeases generally consist of three components, and these systems have so far been found in Gram-negative bacteria, Gram-postive bacteria and archaea. Only one member of the family has been both sequenced and functionally characterized. This system is the DctPQM system of Rhodobacter capsulatus (Forward et al., 1997). DctP is a periplasmic dicarboxylate (malate, fumarate, succinate) binding receptor that is biochemically well-characterized. DctQ is an integral cytoplasmic membrane protein with 4 putative transmembrane a-helical spanners (TMSs). DctM is a second integral cytoplasmic membrane protein with 12 putative TMSs. These proteins have been shown to be both necessary and sufficient for the proton motive force-dependent uptake of dicarboxylates into R. capsulatus. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	1.15177e-125
NZ_CP014013.1\|WP_010926702.1\|3482539_3483031_+\|TRAP-transporter-small-permease	gnl\|CDD\|377284	pfam04290, DctQ, Tripartite ATP-independent periplasmic transporters, DctQ component. The function of the members of this family is unknown, but DctQ homologs are invariably found in the tripartite ATP-independent periplasmic transporters.	1.09407e-16

>NZ_CP014013.1|WP_003811078.1|3493909_3494515_-|fimbrial-protein
MNLKFAGIALGLTACALTYQHQVFAADGTLVITGAITDTTCKINGAEPPTNIAVQLPTISRTALKDVGSTAGGTVFDVKLTECPQALNGQQVGLFFEPGGTVDYTSGNLFAYRADSQGVEQVPQTKADNVQFQLANLDGSAIHLGRNKGAQAAQTFLVSQTAGSSTYGTTLRYLARYIRSGAGSIVAGNLRSQVGFSVMYP
>NZ_CP014013.1|WP_138142578.1|3492925_3493660_-|molecular-chaperone-FimB
MARWRRRLGVAALGAAMLASLAPAARASLVITGTRVIYNAGSPETTVKMSNEGQAPALMQAWIDDGNAEAKPDEVQVPFFLTPPLARVDPGKGQTLRIFFNGYPDGKTLPSDRESVFWLNVLEVPPKATPEEGHGVLQLTIRSRLKLFYRPKGLPGNPLTAAADLTFKRKANGVLEVHNPTPYYVNLQKLEVGENGAHGSKTPWMLAPLSSDELRLKGTGAKSVQYWAIDDFGGVTPYQAAIAD
>NZ_CP014013.1|WP_010926706.1|3490241_3492863_-|fimbrial-biogenesis-outer-membrane-usher-protein
MKQIPLILAMSLAFAAAAKGESAPDMQAAVNFDSAMLWGGANGADLSRFNYSNALRPGNYIVDIYANNYPLIRQQVRFVAAQTSGQGLKTAPAVACFTYGQLEAMQVRLRALDPALVADLKSSGRCEVLGKLFPDSRESFDFGENRLEVSIPQAYTINRFRRDISPDEWDSGITAFRLGYQYNYADYIGGLRAGRRLDLNLYSGFNFKGWYLRNSSTLGWGQGRFTRRSQRTSLQTDIPSWRARLVFGDVFSSGEYFAPYSMRGMLVGSDTAMLPYSERLYRPTIRGVARTRANVKVYQAGVLVFQDAVPPGPFAIDDYSPASYGGDLRVVVTEANGAVQTFTVPYASAVRLILPGQTQWSFSAGRYRNYRNDGQDRPWVTQVTGRHGVADGVNLYGGLLIAQAYQAGLAGLSWNTPWGAMAADATLSRSQLSTTGNANGSSLRFSYSKTLSGTNTAIRLATLRYSSSGFWNFADAVNAGPAETNGRNGRFGLYSLLGRERPRGDFSVTLSQPLGGYGSLYVSALRRTYWGSSRVDQQTQLGYSTQVGRVGVNLDVSRTENRRSTEHQVMLNLSIPLYGATSSGVVTGSLARTGSAPVQQSVNYSGMSGERDQYTYGLGVQRAGTSAQYALNGSWSGTYGEVSGQLTHGRSYSQYQINGSGGLVAHAGGVTFGQYQAGTIGLIQAEAAAGAKVVNTRNAAVDRSGYGLVSLTPYSLNEVELSPQDLPLDVQLESTVEQVIPRAGAVVALRFPTRHDVAAMLVAEPGSEGALAFGTEVRDGAGKVVGVAGQGASALVRGVSASGTLEVTRANGSICRATYDLKSAGHAVHGLPRIALACAPQGGGERGARAAVQAVAQPAPISISGKDHEPDIR
>NZ_CP014013.1|WP_010926705.1|3489130_3490228_-|fimbrial-protein
MPARVISFCGAALAVWAGLAVQPAMAVDPPVDCGRALGLHFWSSTSLISDQTPDGTLIGKPVVGRSLLSKSCEVPDDIKDELSDKHDGEPVDIVLELGSSYKIRPQSYGHPGIVVDLPSGSTEETGIAIYIDFGSSPMQKVGERQWLYPQKGEVLFDALAINGDNAEVRYQAIKVGPLKRPRKLVLSQFPNLFTYKWVFMRGTSQERVLATGTISTDVATSTIDLKTCRYTSQTVSLPTIQRSALTGVGTTLGTTDFQMPFWCYGRPRVSVYMSAANTQTGVDGVALPATGQAAGMASGVGVQLINGKTQQPVKLGLQGKIALPEAQQTESATFSLPMKAQYYQTSTSTSAGKLSVTYAVTLNYD
>NZ_CP014013.1|WP_010926704.1|3487386_3489138_-|filamentous-hemagglutinin-transporter-protein-FhaC
MTDATNRFRPGLVVRALVRAGLLFAVAACAQAQLLPGARDLNRIDDRQRKEQLQRDIERALTRPPVELNPQSEAASPARKPDATSGHTVTVHAVDLDFGVEGRLFDPAPLVQDYLNRPLDNEQLFLLVKALSAALYDRGYATSIVTFVPPGVVDGVLKLKVEWGRIKGWLIDGKPLERTRDRMMVFSAMPGWQDKVLNVFDIDQAIYNINNGGKTGNITIVPADEYGYSYLDLQLQRRALPRVSLGMDNSGPGTPENGRYKYNASVTANDLLGLNDTLGLYIGNRYYRDAGHDAERNYDLMYSVPLGRTRLDLQTGYSTYRNLLKTRYGQYQSAGNSRSFGLKATRLLYRDTRSQFSVYGGLKLRQNKNYLAGTRLDVSSKHYSDVTVGMQYSTQRGANAYFGDLSFTRGVGINNGKYAAYDERGPQGNVSRLNGSLAWTRYMALADQPLQWTSQLGFQYSRQQLLNSYQITVGDEYTVRGYNLRTSQSGDSGAYLSNTLTVPVQFSLFGKQASMAPFAGVDVGALKSNHPDARTIRMAGLAAGVRFDLPYARLSFTYSKPVGAQPGGAPRAPVWYINAGLSF
>NZ_CP014013.1|WP_010926703.1|3486059_3487361_+|TRAP-transporter-large-permease-subunit
MNEILIVTLLVVSIFALLGCGVWVGLTLAGTAWIGMEVLSSRPAGDAMAVTIWGASSSWTLTALPLFLWMGEILFRTRLSEDLFKGLAPWLNRLPGRLLHTNVIGCAIFAAVSGSSAATCATVGKMTIPELTRRGYPEDKILGTLSGAGTLGLLIPPSIIMIVYGVAADVSIAKLFIAGIFPGLLLALLFMGYIAWWAIRHPGAVPAADPGISLMQKLKQSRHLIPVLLLIGAVLGSIYTGIATATEAAAVGVVGALILSALQGSLTRASFMTSLLGATRLYCMIALILAGAQFLTLAMGYIGLPRALAEWIGGLGLSQFGLIMALMVFFVVLGCFLDGISIVVLTMGVLLPTVQAAGIDLIWFGIFIVFVVEMAQITPPVGFNLFVLAGMSGRELPYIARASLPMFFLMIVAVLLLYYLPGIATWLPQHMTL
>NZ_CP014013.1|WP_003811089.1|3485566_3486067_+|TRAP-transporter-small-permease
MRRFLDRLYGAAGLLAGLCTIGVLVSVLAAIIARQVGLNIPGTDAYAGYFMAAAGFLALASTFKHGEHIRVTLLLNALSAPGHRRLDIFALCVGAILAAAFAWFSVKLAHDSWLFNDISTANDATPLWIPQLTMAAGTILFFIALLDELVRRVRGQGFAKSQQIHE
>NZ_CP014013.1|WP_010930616.1|3484585_3485560_+|TRAP-transporter-substrate-binding-protein
MYKKLSLLAGTIVLAFGAGAQAQTKWDLPTAYPASNLHVENLTQFVKDVDSLSGGKLKITLHNNASLYKAPEIKRAVQGNQAQIGEILLTNFANEDPVYELDGLPFLATGYDASFKLYQAQKPFLEKKLASQGMMLLYSVAWPPQGIFANRDIKQVSDMKGLKWRAYSPVTAKIAELVGAQPVTVQQAELAQAMATGVIDSYMSSGSTGFDTKTYEYIKKFYDTEAWLPKNAVLVNKKAFDALDPATQQALKKAGAQAEERGWKLSQEKNSWYKEQLAKNGMAIIAPTAELKSGLTEVGKRMLDDWLKKAGADGQAMIDAYRKQ
>NZ_CP014013.1|WP_003811093.1|3483023_3484322_+|TRAP-transporter-large-permease-subunit
MGELAQSLVLIASLLLLLAAGVWVSLALVASGLVALLLFTDAPAGIIFATKSWDASANWALTALPLFIWMGEILYRTRLAEDMFSGLGPWVRRLPGRLVHVNVLGCGIFAAVSGSSAATAATIGRISLPELKARGYDDGLAIGSLAGAGTLGLLIPPSIVMIVYGVAAQVSLIKLFIAGILPGLLLMALFSGYIGVWSLRNPARVPPREPAVPWLTMLARLRLLLPVVALIAGVIGSIYAGIATATEAATIGVIGALAIAAWGKSLNRRSFIDSLMGATRTSCMISFILLGAAYLTSAMSFTGLPANLAEWISSLGLSQYGLIAVLTVFFILMGAFLDGISIVVLTTAVLMPAIQAADIDPIWFGIYLILVVEMAQITPPVGFNLFVIQGITGRNLFELVRMAFPFFLLLVLATAIITIFPAIVTALPLAMR
>NZ_CP014013.1|WP_010926702.1|3482539_3483031_+|TRAP-transporter-small-permease
MPILDRIAVASGAVAALFLALIGAIVAAQIASRLLGMQIPAADDFAAWSMAASVFLALPYAMLRGDHIRVTLLLQFLPKTAHRPYELAATALGLALSAWAAWQAGGFVHESFAYDEVAQGMLRVPLWIPQICMPIGLALLTLMLARRLAMVARGRQPEETAHG
>NZ_CP014013.1|WP_010930609.1|3506409_3507039_+|virulence-factors-two-component-system-response-regulator-BvgA
MYNKVLIIDDHPVLRFAVRVLMEKEGFEVIGETDNGIDGLKIAREKIPNLVVLDIGIPKLDGLEVIARLQSLGLPLRVLVLTGQPPSLFARRCLNSGAAGFVCKHENLHEVINAAKAVMAGYTYFPSTTLSEMRMGDNAKSDSTLISVLSNRELTVLQLLAQGMSNKDIADSMFLSNKTVSTYKTRLLQKLNATSLVELIDLAKRNNLA
>NZ_CP014013.1|WP_104442494.1|3507047_3510764_+|virulence-factors-two-component-system-sensor-histidine-kinase-BvgS
MPAPHRLYPRSLICLAQALLAWALLAWAPAQASQELTLVGKAAVPDVEIALDGDDWRWLARKRVLTLGVYAPDIPPFDVTYDERYEGLTADYMAIIAHNLGVQAKVLRYPTREQAVGALESGQIDLIGTVNGIEGRLQSLRLSVPYAADHPVLVMPIGARRAPPADLAGQRLAVDANYLPRETLQQAYPQATLHYFPSSEQALAAVAYGQADVFIGDALTTSHLVSQSYFNDVRVVAPAQIVTGGESFGVRADNTRLLRVVNAVLEAIPASERRSLIYRWGLGSSISLDFARPAYSAREQQWMANHPVVKVAVLNLFAPFTLFRTDEQFGGISAAVLQLLQLRTGLDFQIIGVDTVEELIAKLRSGEADMAGALFVNAARESVLSFSRPYVRNGMVIVTRQDPAAPADADHLDGRTIAMVRNSAAIPLLQQRYPQAKVVTADNPTEAMLLVADGQADAVVQTQISASYYVNRYFAGKLRIASALDLPPAEIALATARGQTELISILNKALYSISNDELASIVSRWRGSDGDPRTWYAYRNEIYLLIGLGLLSALLFLSWIVYLRRQIRQRKRAERALNDQLEFMRVLIDGTPNPIYVRDKEGRMLLCNDAYLDTFGVTADAVLGKTIPEANVVGDPALAREMHEFLLTRMSAEREPRFEDRDVTLHGRTRHVYQWTVPYGDSLGELKGIIGDWIDITERAELLRELHDAKESADAANRAKTTFLATMSHEIRTPMNAIIGMLELALLRPADQEPDRQSIQVAYDSARSLLELIGDILDIAKIEAGKFDLAPVRTALRALPEGAIRVFDGLARQKGIELVLKTDIVGVDDVLIDPLRMKQVLSNLVGNAIKFTTEGQVVLTVTARPDGEAAHVQFSVSDTGCGISEADQRQLFKPFSQVGGSAEAGPAPGTGLGLSISRRLVELMGGTLVMRSAPGVGTTVSVDLRLTMVEKSAQATPPAAAAQATPSKPQVSLRVLVVDDHKPNLMLLRQQLDYLGQRVVAADSGEAALALWHEHAFDVVITDCNMPGINGYELARRIRAAEAAPGYGRTRCILFGFTASAQMDEAQRCRAAGMDDCLFKPIGVDALRQRLNEAAARAALPTPPSPQAAAPATHDATPAAFSAESILALTQNDEALIRQLLEELIRTNRADVDQLQKLHQQADWPKVSDMAHRLAGGARVVDAKAMIDTALALEKKAQGQAGPSPEIDGMVRTLAAQSAALETQLRAWLEQRPHQGQP
>NZ_CP014013.1|WP_010926709.1|3510810_3511686_-|EAL-domain-containing-protein
MIHWTNSARSSFEASLSPSRRTLRARLAPVEGPTVAELRAALKRDEFIPAFQPVVDAGTGSLFGVATTIQWAHRHWGLVPEHCYMAALVRDNLHIALAQQLLAQVFDLAAAMRRGNRHVGLFIQPEPICLMSRSYSDDVLRNLDHRGLPPFALTLAVSPSLLQSPYGQQSLHSLRRLHRAGCNLVLTVSTFDAESPPHLDALEICGIALMPELMYALRQGGRVGEACRAIAQQASAQRIPVMATGVVDEAMAQAADLLPCRYLLGDHVAPPMTGQRFLYWYYRREMPPNYP
>NZ_CP014013.1|WP_010930607.1|3511819_3512614_-|putative-hydro-lyase
MTILSLAGAGHQARLDARGGMLTGPTANLAPGHVQANLAILPQAVAGDFLRFCQRNPKPCPLLAVSEPGDPSLPELGLDIDIRTDVPRYRVWRDGKLVDEPLDVRGLWRDDLVAFLIGCSFSFEEAMLENGLPVRHIEQGCNVPMYRTNIATHPAGPFSGPLVVSMRPLKAADAIRAIQVTSRFPSVHGAPVHLGDPALIGIADLGRPDYGDAVEIRAGEIPVFWACGVTPQSVVAAVRPEFCITHAPGHMLVTDLLNSRLAAF
>NZ_CP014013.1|WP_010926711.1|3512671_3514021_-|amidase
MLPTLTQQSLALQEGRDTSSGLTQAALARAADPAGEGARVFTRVYAEQARAEARAADALRAAGVTRSAIDGLPISIKDLFDVAGETTMAGSVARQDEPAAVRDAVVVRRLRAAGAVIVGRTNMTEFAYSGLGLNPHYGTPRNPWDRATGRIPGGSSSGAAVSVTDGMASGAIGSDTGGSVRIPAALCGLAGFKPSAQRVSMQGVLPLSANLDSIGPLAPSVRCCATLDAILAGGDDADIPVPAALLGLRLAVPTTLALDGLDAHVSATFAATLAKLAEAGACIDEIAVPEFAQLADINSKGGFTAAEAWAWHRDLIERAADRYDPRVVARIRRGADMSAADYIDLLAARQAWRARVEARIAGYDALVLPTVPVVAPAIADLEASDALFGSTNLLILRNPTLINFLDGSALSLPCHEAGTAPVGLMVAAANGSDRRVLAIGMAIEDLLGG
>NZ_CP014013.1|WP_033447514.1|3514081_3514768_-|DUF2848-domain-containing-protein
MKIAFQVQADGATRTVETEIRNLVVAGWAGRDRAAIEHHIEELAELGVPRPSSVPLYYRIAENQLSQAGRVQAVGPDSSGEAETFVFSVGGELYVSLASDHTDRKLEAHSVALSKQVCVKPVASDAWRHADVAEYWDELVLRSYIVENGAEVLYQEGTLASLRTPQDLIAGYTQGQASLPEGTGMTCGTVAAIGGIRASTTFIMELHDPRRQRTLRHRYDVEVLPEIA
>NZ_CP014013.1|WP_003811061.1|3514823_3516107_-|TRAP-transporter-large-permease
MIATALILLLVLIGISIPVGAALGVLGLILDPLYSMLPLTRAIGEVTWSANNEFLLVAIPLFIMLGEVLLRAGFAERMYAAMSLWLSWLPGGLMHANIGASTLFSATSGSSVATAATVGTVAIPQIKKYGYNEPLFLGSLAAGGTLGILIPPSINLVIYGVLTNSSVPKLYLAGIIPGFAMAALFMMTVVVACVAKPSWGGHRIQASWAQRIASLVHLGPPMAIFFLVVGSIYAGLATPTEAAALGVLGALILAAWFRRLTWTMLREAIEGTMRSTAMIMLIVLAASFLNFVMSATGLTDALVQSITGLGLSPGWMLLIVVIFYLVLGCFMETLSMMITTIPIVAPIMIALGYDPIWLGILIIVLVEAALITPPVGLNLFVVQSLRKSGSMTAVINGALPFVLAMFVMLALLAFFPDLALWLPRVFG
>NZ_CP014013.1|WP_003811059.1|3516103_3516724_-|TRAP-transporter-small-permease
MTRSEHFRALGGLLRRAESLSRLAVWVGGALTIASVLLISFDVLARKFFGFTTGGADELSSYAFAISTSWALAFATLQRANVRVDVVYQYLPVRVSAVLDWIALVALGVFMVFMTYYAYEVVQTSWAQKSAANTPLATPLWIPQGLWALGLAWMCVTVALMLVRASAALVTGDLDLVKEICGVRSAQEEAEEEAAAGERMVKGASA
>NZ_CP014013.1|WP_010926712.1|3516833_3517883_-|TRAP-transporter-substrate-binding-protein
MKKPFVFAAAFAVAALTGAVHAQDLPKTKVKVVGGLSNLTAYNDYEKPFWTKTVPELSKGQVTADIKGFNEMGLKGPEILRLMSQGVIEFGTATLAYFASDNPINEAIDLAGLAPDVKTARQVTDAFEPVYAKLYGEGANVKLLGISTYPAQVLFCNAEITGLADIKGKKVRTSSRTTAEFVEALGGSSVTMAFGEVVPALQNKVVDCAITGSLSGYSAKWYEVSTHLYALPINWNQQIHAVNQKAWDKLDPKVRTFLQDNIKNLVDQIWDAAARQTQEGYDCNTGAAACPYPVKGKMVLVQPTDADRALLKKVTEEAVLPKWAARCSAQCVSDFNATIGKTLGLVAKK
>NZ_CP014013.1|WP_003811054.1|3518225_3519134_-|LysR-family-transcriptional-regulator
MIDLKHIETFFWVSTLGSFRAAAEKLNTTQPAISQRIASLEADLGVRLFERDARGVSLTGKGQELLSHAERMLQMRHDLMQAAREQNVMSGTVRIGVAETIVQTWLPALIEHVHAAYPALVLQIEVDTTHVLRGQLMARQIDVAFLMGPILEARMENIPLCAYPLAWVASPLLELGPEPLTLERIGTLPVITYPSSSEPYRQVRDMLTRAGVAAPRMYGSASLAMVVRMTKDGIGTSVIAPVFLDEELARGELRLLNVQADPLPDLSFTASWVQGPDSHAARAIALLAQRTAAEHGGAIGAG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP014013_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP014013_3

3734607-3734703

Orphan

Consensus_repeat	Method
GTGCCTGTCCCGGCGGGGACAGGCACCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP014013_3

>merge|NZ_CP014013|3|3734607-3734703|CRISPRCasFinder
GTGCCTGTCCCGGCGGGGACAGGCACCCAGCCGCAGATGTCAGTCCCCATGCCGCTGGCGCATGACGGCGTGCCTGTCCCGGCGGGGACAGGCACCC

>NZ_CP014013|3|3|3734607-3734703|CRISPRCasFinder
GTGCCTGTCCCGGCGGGGACAGGCACCC	AGCCGCAGATGTCAGTCCCCATGCCGCTGGCGCATGACGGC
GTGCCTGTCCCGGCGGGGACAGGCACCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP014013.1\|WP_003810611.1\|3741055_3742111_-\|4-hydroxythreonine-4-phosphate-dehydrogenase-PdxA	unknown	unknown	gnl\|CDD\|273137
NZ_CP014013.1\|WP_003810650.1\|3722798_3724376_-\|lipoprotein	unknown	unknown	gnl\|CDD\|274177
NZ_CP014013.1\|WP_003810615.1\|3739199_3740072_-\|MOSC-N-terminal-beta-barrel-domain-containing-protein	unknown	unknown	gnl\|CDD\|225758
NZ_CP014013.1\|WP_003818667.1\|3744597_3745524_-\|ectoine-hydroxylase	unknown	unknown	gnl\|CDD\|131461
NZ_CP014013.1\|WP_003810639.1\|3728290_3729121_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224094
NZ_CP014013.1\|WP_010926763.1\|3730135_3731710_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173867
NZ_CP014013.1\|WP_033447322.1\|3731757_3732123_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014013.1\|WP_003810604.1\|3743325_3744348_-\|2-keto-3-deoxygluconate-permease	unknown	unknown	gnl\|CDD\|235384
NZ_CP014013.1\|WP_003810619.1\|3737596_3738643_-\|CDP-6-deoxy-delta-3,4-glucoseen-reductase	unknown	unknown	gnl\|CDD\|181058
NZ_CP014013.1\|WP_003810609.1\|3742107_3743325_-\|four-carbon-acid-sugar-kinase-family-protein	unknown	unknown	gnl\|CDD\|377757
NZ_CP014013.1\|WP_010926765.1\|3740148_3741051_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225099
NZ_CP014013.1\|WP_003810643.1\|3725311_3726667_-\|amidase	unknown	unknown	gnl\|CDD\|223232
NZ_CP014013.1\|WP_010926764.1\|3733582_3734533_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176131
NZ_CP014013.1\|WP_003810621.1\|3736144_3737401_-\|D-amino-acid-dehydrogenase	unknown	unknown	gnl\|CDD\|234819
NZ_CP014013.1\|WP_003810623.1\|3734802_3736140_-\|extracellular-solute-binding-protein	unknown	unknown	gnl\|CDD\|182876
NZ_CP014013.1\|WP_003810617.1\|3738700_3739069_-\|aspartate-1-decarboxylase	unknown	unknown	gnl\|CDD\|180090
NZ_CP014013.1\|WP_004568554.1\|3732109_3733486_-\|DUF1446-domain-containing-protein	unknown	unknown	gnl\|CDD\|377804
NZ_CP014013.1\|WP_010926761.1\|3724372_3725134_-\|TcpQ-domain-containing-protein	unknown	unknown	gnl\|CDD\|132874
NZ_CP014013.1\|WP_003810637.1\|3729138_3730083_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NZ_CP014013.1\|WP_010926762.1\|3726663_3728298_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224048

Protein	Function_ID	Function_description	E-value
NZ_CP014013.1\|WP_003810611.1\|3741055_3742111_-\|4-hydroxythreonine-4-phosphate-dehydrogenase-PdxA	gnl\|CDD\|273137	TIGR00557, pdxA, 4-hydroxythreonine-4-phosphate dehydrogenase. This model represents PdxA, an NAD+-dependent 4-hydroxythreonine 4-phosphate dehydrogenase (EC 1.1.1.262) active in pyridoxal phosphate biosynthesis. [Biosynthesis of cofactors, prosthetic groups, and carriers, Pyridoxine].	4.07591e-117
NZ_CP014013.1\|WP_003810650.1\|3722798_3724376_-\|lipoprotein	gnl\|CDD\|274177	TIGR02520, putative_Type_IV_pilus_protein, type IVB pilus formation outer membrane protein, R64 PilN family. Several related protein families encode outer membrane pore proteins for type II secretion, type III secretion, and type IV pilus formation. This protein family appears to encode a secretin for pilus formation, although it is quite different from PilQ. Members include the PilN lipoprotein of the plasmid R64 thin pilus, a type IV pilus. Scoring between the trusted and noise cutoffs are examples of bundle-forming pilus B (bfpB). [Cell envelope, Surface structures, Protein fate, Protein and peptide secretion and trafficking].	2.66535e-54
NZ_CP014013.1\|WP_003810615.1\|3739199_3740072_-\|MOSC-N-terminal-beta-barrel-domain-containing-protein	gnl\|CDD\|225758	COG3217, COG3217, Uncharacterized Fe-S protein [General function prediction only].	6.93466e-61
NZ_CP014013.1\|WP_003818667.1\|3744597_3745524_-\|ectoine-hydroxylase	gnl\|CDD\|131461	TIGR02408, putative_L-proline_4-hydroxylase, ectoine hydroxylase. Both ectoine and hydroxyectoine are compatible solvents that serve as protectants against osmotic and thermal stresses. A number of genomes synthesize ectoine. This enzyme allows conversion of ectoine to hydroxyectoine, which may be more effective for some purposes, and is found in a subset of ectoine-producing organisms.	0
NZ_CP014013.1\|WP_003810639.1\|3728290_3729121_-\|ABC-transporter-permease	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.14667e-85
NZ_CP014013.1\|WP_010926763.1\|3730135_3731710_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173867	cd08502, PBP2_NikA_DppA_OppA_like_16, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP014013.1\|WP_003810604.1\|3743325_3744348_-\|2-keto-3-deoxygluconate-permease	gnl\|CDD\|235384	PRK05274, PRK05274, 2-keto-3-deoxygluconate permease; Provisional.	9.56796e-132
NZ_CP014013.1\|WP_003810637.1\|3729138_3730083_-\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.42336e-123
NZ_CP014013.1\|WP_003810609.1\|3742107_3743325_-\|four-carbon-acid-sugar-kinase-family-protein	gnl\|CDD\|377757	pfam07005, DUF1537, Putative sugar-binding N-terminal domain. This conserved region is found in proteins of unknown function in a range of Proteobacteria as well as the Gram-positive Oceanobacillus iheyensis. Structural analysis of the whole protein indicates the N- and C-termini interacting to produce an interacting surface into which a threonate-ADPcomplex is bound, suggesting that a sugar binding site is on the N-terminal domain here, and a nucleotide binding site is in the C-terminal domain (manuscript in preparation). There is a critical motif, DDXTG, at approximately residues 22-25.	1.20657e-54
NZ_CP014013.1\|WP_010926765.1\|3740148_3741051_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	2.15288e-54
NZ_CP014013.1\|WP_003810643.1\|3725311_3726667_-\|amidase	gnl\|CDD\|223232	COG0154, GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis].	6.98538e-115
NZ_CP014013.1\|WP_010926764.1\|3733582_3734533_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176131	cd08440, PBP2_LTTR_like_4, TThe C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor. The genes controlled by the LTTRs have diverse functional roles including amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to a name a few. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.05592e-67
NZ_CP014013.1\|WP_003810621.1\|3736144_3737401_-\|D-amino-acid-dehydrogenase	gnl\|CDD\|234819	PRK00711, PRK00711, D-amino acid dehydrogenase.	0
NZ_CP014013.1\|WP_003810623.1\|3734802_3736140_-\|extracellular-solute-binding-protein	gnl\|CDD\|182876	PRK10974, PRK10974, sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB.	1.31172e-74
NZ_CP014013.1\|WP_003810617.1\|3738700_3739069_-\|aspartate-1-decarboxylase	gnl\|CDD\|180090	PRK05449, PRK05449, aspartate alpha-decarboxylase; Provisional.	1.84176e-73
NZ_CP014013.1\|WP_003810619.1\|3737596_3738643_-\|CDP-6-deoxy-delta-3,4-glucoseen-reductase	gnl\|CDD\|181058	PRK07609, PRK07609, CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated.	0
NZ_CP014013.1\|WP_010926761.1\|3724372_3725134_-\|TcpQ-domain-containing-protein	gnl\|CDD\|132874	cd06911, VirB9_CagX_TrbG, VirB9/CagX/TrbG, a component of the type IV secretion system. VirB9 is a component of the type IV secretion system, which is employed by pathogenic bacteria to export virulence proteins directly from the bacterial cytoplasm into the host cell. Unlike the more common type III secretion system, type IV systems evolved from the conjugative apparatus, which is used to transfer DNA between cells. VirB9 was initially identified as an essential virulence gene on the Agrobacterium tumefaciens Ti plasmid. In the pilin-like conjugative structure, VirB9 appears to form a stabilizing complex in the outer membrane, by interacting with the lipoprotein VirB7. The heterodimer has been shown to stabilize other components of the type IV system. This alignment model spans the C-terminal domain of VirB9. CagX is a component of the Helicobacter pylori cag PAI-encoded type IV secretion system. Some other members of this family are involved in conjugal transfer to T-DNA of plant cells.	7.06997e-30
NZ_CP014013.1\|WP_004568554.1\|3732109_3733486_-\|DUF1446-domain-containing-protein	gnl\|CDD\|377804	pfam07287, AtuA, Acyclic terpene utilisation family protein AtuA. This family consists of several bacterial and plant proteins of around 400 residues in length. One member of this family has been characterized in Pseudomonas citronellolis as AtuA, a member of a gene cluster that is essential for the acyclic terpene utilisation (Atu) pathway.	2.30072e-160
NZ_CP014013.1\|WP_010926762.1\|3726663_3728298_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224048	COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only].	0

>NZ_CP014013.1|WP_010926764.1|3733582_3734533_+|LysR-family-transcriptional-regulator
MRPQADLSTRQLRAFVMLADLRHFTKAAQACHLSQPAFSALIQSLEATLAMQLFDRSTRRVVLTQEGELFEPLARRLLADLGHAMTHIASFVELRRGRVHVAALPSLAAGWLPKILHEFHAEHPDIELMLSDVLSDECIELVRSGQADFALASRGIRASDPAVLHARELCSDTFHLICRKDHPLAREPRLTLKHLAPWPFIHLTRNSSVRQTVEAALRPQVAKTILEVAQLATVAGMIEAGLGISVVPTFTLYQFERPGLLIRPISLPGLTRQIYIVRRQEERLSIAAQALYDLVVAKLGTPAAAKPRRRRTEKGR
>NZ_CP014013.1|WP_004568554.1|3732109_3733486_-|DUF1446-domain-containing-protein
MRSLPSLLIGCAAGFSGDRVDAAGPVVDTLIARLGGVPANGRAFLIFETLAERTLALAQLRKRADAQAGYEPLLEDMLGPVLARCLAHGIRIVSNFGAANPEGAARHILRMAARLGLRKPRIAVVKGDDVSGAQHAGMLAEYLGEQYDPSSIVSANAYLGSEQIRDALDHGAEIVVCGRVADPSLTVGPAMSYFGWQADDWDRIGRATMAGHLLECGAQVCGGYYADPGYKDVPGLEQVGFPVAEIDEDGHCIIGKSDGTGGLVDEATVIEQLLYEVHDPAGYLTPDVVADISQAEVRRVADNQVRLTGVRGHPRPAAYKVNVCLEGGWLAEGEISYAGPRAEARARLAAEVVCKRLADLRIRTDLIGRVSIFGDDAGRLLAGAPAGDGEDVRLRLAAHAVTRQDAMRLTREVTALYCCGPAGGGGVRTTLTPRLDMVSCLLPRDLVRAGFEMVDADV
>NZ_CP014013.1|WP_033447322.1|3731757_3732123_-|hypothetical-protein
MPMSDVLVPLFRVAHARTGDKGDRSNISVIAWDRALYPLLVEQLTPEVVLAQFAHRRPAGAQRYLLPKLGAMNFVLDAVLDGGVNGALNLDAHGKALSYLILKTEIAVPSDLVCRLAGSPG
>NZ_CP014013.1|WP_010926763.1|3730135_3731710_-|ABC-transporter-substrate-binding-protein
MRYLKSTYAAVLLAIGTAVPHATTLAQEVKVAAEAPLRLLDPVGTTAYITRNHAYMVYDTLFALDAQLKPQPQMVSTWSVSPDKLVYRFTLRDGLKFHDGSPVTAADCVASIKRWAQRDLTGLRMMAAAKEITAKDDKTFEIVLEQPFGAVIEGLSKASSLPAFIMPKRIADAPASQAITEVIGSGPFRFVASEYRPGLQVVYERNTDYVPRSEPPSGLAGGKVVNVDRVVWLSLPDIQTEANALAKGEVDYVQTVYPDVVQTLQASKDVVIQKLASTTTPTLRLNWLQPPFNNQKVRQALLHAVSQRDYMDAQVGDPKAYRVCWAMFGCDSPLASTAGVVSQDDEADLNAAKALLKESGYKNEKAVVLHATDYPPTSAIAPFTAQILRSIGMKAEVQSMDWATFLTRRGKQDPVEKGGWSVAYGSWNTLDLMSPIANLNLDGRGKEGYAGWTESAEMESLRTQYAQATEPASRQQIAAKIQQLAYDQVFYIPLGTYSNYAARRSNVTPLLDAPVTVFWGISKN
>NZ_CP014013.1|WP_003810637.1|3729138_3730083_-|ABC-transporter-permease
MQILRLLFLRLASAIPVVLVVVTVVFLLVRLTGDPATILAGDMASPEVVASVRADLGLDRPLLGQYAQWLWDLLQGNLGTSIVTKQPVATLIGERLESTLVLSLSALVVTVLLAVPLGVLAAWRHNTLVDRVVMIYAVIGFSLPSFVVGYLLILMFSVWLGWLPVQGYVSITDDIWLAAQHLVLPTLALAIFYMSLISRVTRASVLEVLNEDFVRTAKAKGVPPLRILSQHVLRNAAIPIVTVIGIGLAFLISGVVITESVFNLPGLGRLTIDAVLSRDYPVVQGVILFFACVYILVNLLIDMLYVVIDPRIRY
>NZ_CP014013.1|WP_003810639.1|3728290_3729121_-|ABC-transporter-permease
MTSILRHNRLALLGGGVLLLMVAISVAASWIASMDPAMMQPRMRLTPPGEAFLLGTDALGRDVYSRVVHGSRMSLAIGALVVVITIAIGTLIGLVAGASRIMDRVLMRIMDGVMAIPGILLAVALVSLFGASLASVVIAIAVPEIPRVVRLVRSVVLSVREEPYVEAAVGLGVPYPKVVWRHILPNCFAPLIVQASYVFAAAILLEAVLGFLGVGFPPEIPTFGNILAEARPVFQRAPWATVAPGLLLAVTVLAVNLLGDGLRDSLDPKLARRAND
>NZ_CP014013.1|WP_010926762.1|3726663_3728298_-|ABC-transporter-ATP-binding-protein
MIENTPKQRVLEVSGLAIRAGARTLVQDVTLSLAQGEILCLVGESGSGKSLTASAVMGLLPGNLGVSAGSIRLDGEDLTAASPARMQALRGDRMAMVFQEPMTSLNPLMRVGRQIAEVLQVHRPDLGAGQVRARVLELMGDVRLPTPEALMDAFPHQLSGGQRQRIMIAMALALEPALIIADEPTTALDVTTQAQVLKLFRQLLAKHSSAVLFITHDFDVVRDIADHVAVMQLGRIVEQGPAGQVLDAPRHDYTRKLLAAVPSGVPKTQQNASSDELLSVSGLNLVYESRGLLGPARRTHAVADVGFTLKKGETLGVVGESGSGKSTLGRCITRAHAPTSGRIVFDGVDIAGLSGKALRAVRRRVQMVFQDPYRSLNPRRRILHALIEGPIESGVDRKAACARAAELMALVGLPADGLQRYPHQFSGGQRQRICIARALAMEPDLIVADEAVSALDVSVQAQVLELFEDLQKRLGFAMIFITHDLRVAAQVCDRIGVMQKGRLLELGPVRQVIHAPQHPYTRHLFDSLPGRVGQAAEPAMELQA
>NZ_CP014013.1|WP_003810643.1|3725311_3726667_-|amidase
MTSTDQHIARAGVAELARGIARGAFTPAEVTDVFLRRIQDLNPAIGAFVAVYEDEARHAARQATQALAQGQRLSPLHGIPFAVKDIVDVAGRFTTYGSRTGAGRQAGATAEYVRALLDAGMILLGKTHTVEFAFGGWGTNQRMGTPRNPLRADVPCATGGSSSGSGAAVGAQMVPFAVGTDTGGSIRIPSAFCGLTGMRPSMGRHSGAGVMSLSHTLDTIGPLARTVEDVQMLDDLLTGKTATDTAQPGSQAVARVRDARIGVLGAQWLGAIEPEVAHAYAQSLRAFEAMGATLVELALPFDREAFAQLTSTLIACEGLQFAGKYVHDPLSGMDEDVRARFLVGDRYDAAAYAELLGRRSAMIDTFTQAMAGVKALLMPTTPCVAQPLAGLEQSPYNPAVYTRMPAWLGCCALAVPNGSGAHGLPTSLQIVGLPESDRLVMSLGRAYQEYA
>NZ_CP014013.1|WP_010926761.1|3724372_3725134_-|TcpQ-domain-containing-protein
MVRSLSIVCLLAVLQACAGPRPAAVAAAWDEAPAGQYRFDWQLSGDPAVAPLQVFDDARRIWLQFAPGQPIPAIFAHGAGGERPVPYLRRDPYIVVDGAWPALSLRGGRYVARIQRSGAPIPAGAPVVRAEGPAPVPATPSAVAPAEAAEAAPPAPRFRAAPPDLTLRAVLARWARAAGWTFEAEHWALDVDIPLAGKAELPGDFKTAVRALLAATELSERPAQPCFYANRVLRVVPLAQACDRTRAAAPGLT
>NZ_CP014013.1|WP_003810650.1|3722798_3724376_-|lipoprotein
MKARRLAMAGLSLALGGCSLSQQMQAMRDAATSLRARLLEGQQAVGRAGERPAREAAQDVARPWLAGRAQPLAREVLLPPALRADVDTTLLFAGKATLPVLAERLHRATGIAVRVHPDALLPRAAFLPRLAGPAELAAEPPAQAELRAGPRPLADTLDALAAQLYVHWRYHRGAIEFYRTETRVFDVRTLALAASAQARLGRAGSGETGSFDHASSTVLSADAGKALQAVRDRVAAFLTRAGVIAEIEAGGSTLAVTDTPEALARIEKYLQGENRALTRRVRLVFEELTVRTTAAAEGGIDWQAVYASARAAASYAMPGGAGAAGALGARVLAGPWRDARALIAALSTMGAVLRHRSIPMLTLNRRAVTHAVRTTFSYVDQVQRLSPTAAAPGGRDAVPGLAVQQKRETVGTFLTLLPEARDDGRILLSISYDNTIAQPLRTLTFGEGGQQVSLQQIAIDGSGIVQQVELLPGQPVILSGFDHSEDQYERHRLFPDAPLAAGGHDRTARERVTTVVMVTAQIDEG
>NZ_CP014013.1|WP_003810623.1|3734802_3736140_-|extracellular-solute-binding-protein
MKKLQMTGFARAMRASRRACVLGLAMAAMGVAQAADSVEIQVWHTLSGPNKAEFEKLAKQFNKEQGDVVVKLRDFGNQDDLKKEAVSAVKSKKGPNLVQLADNHSPEVVAEHKSILPLHQLLAKYPVKDLNWFLPSTTSFTRDGKGRLLAFPWMAEVPVMFYNTAYYKKAGLDPNKPARTWADLQAELLKLRDVANIDCPYATSDQVTVHLENLAPVNNQLYATLNNGLDVAKKGSPSMQFDTLYMRHVSLMVSWKRSLLLTAYSDDNKSDQLFAKGECAVLTTSSSALGQFLNTRSLSFGVAPLPYYDQVTKTGGRPFVSGSALWAMEGHPQAEEKATAKFLAWLSKPVIAAEWHQRTGYLPLTEAAFRASDVSFYNKVPGAQQLVELMRNPPAATSRGFRIANYERIEPVLNTQLTAAFDGKTPPVAALNNAASQARSLAAQR
>NZ_CP014013.1|WP_003810621.1|3736144_3737401_-|D-amino-acid-dehydrogenase
MKVAVLGSGIIGVSSAWWLSQAGHDVVVVDRCTGAAQETSLANGAQISVSYAEPWANPQAPFKLLKWMFQDDAPLLFRPQLDWRQWQWGLAFLRECLPSRLAPNIRAMVRMAEYSRATLQGMRAELGIQYDHLERGILNFYRDQREFETSQRAAGLMRDFGVERRVINADEVVAIEPALAPHRQTIVGGDYTPEDESGDVHLFAAALARRCEAAGVEFRFSTRVTRLLGEGGRVQGVELIEPDGRYGRLDADAFVVAMGSFSAQLVRPLGVPCMVYPAKGYSATFPVRPGALAPVVSLTDSSHKVVFSRLGERLRMAGTAELSGYSRGLNTGRCEAMTRLARELFPDALDFERVSYWSGLRPSTPSNVPLIGRTSVSNLYLNTGHGTLGWTMGVGSGRALADLLSGRRPEPEFPFLGL
>NZ_CP014013.1|WP_003810619.1|3737596_3738643_-|CDP-6-deoxy-delta-3,4-glucoseen-reductase
MSFQVTIEPSKHQFQAEAGQTVLDAALAAGIVLPYSCRTGACSTCKGKVVAGEVDAGPYPAQILSPEDLAQGYTLFCQAKPQSDLVVESTEVRLASDIQIRKLPSRVQTIERVAPDVAVLKLQLPASEQFRYYAGQYIEVILKDGKRRSYSMAGAPHTGSPLELHIRHMPGGLFTDHVFGAGDTQMKEREILRLEGPFGSFFLREDSDKPIVLLASGTGFAPVKAIVEHMIHNQIQRPAVLYWGGRRPRDLYHDALAQSWAGSLPGFRYVPVVSDALDEDGWSGRTGYVHEAVMQDLSDLSGYEVYACGTPLMVDAARREFSAQCGLPAEAFYADAFTSEADLAKATP
>NZ_CP014013.1|WP_003810617.1|3738700_3739069_-|aspartate-1-decarboxylase
MQRIMLRAKLHRVTVTEADLHYEGSCGIDEDLLDAAGMREFERIELYNVTNGERFDTYIIKAARGSGAISLNGAAARRAQVGDLLIICTYGPMSEEQSATHKPQVVLVDDANRVKEIRKFPA
>NZ_CP014013.1|WP_003810615.1|3739199_3740072_-|MOSC-N-terminal-beta-barrel-domain-containing-protein
MSTRIRSLHIYPVKSCAGIDLAESIVDRAGLAHDRRWMVTTAAGQFMTQRQYPQMARIRTALEDGMLVLRAPGMEDLRIPADGSELAERTQPVGVWRDTVIARAEHPRSAEWLSRFLGLPCRLLKIDLRADRSANPEWVDTWLERHPEWAEDFAGDHFFGFADGFPLLVANQSSLDELNERLAARGQAPVPMNRFRANIVVEGDWPAFEEDQTACIVAGGVRMAFVKPCTRCPMPNVDQVTAEVYDEPGLTLTTFRSLEIGVVFGQNAIVDRTAPAPLRVGDAVEIELDF
>NZ_CP014013.1|WP_010926765.1|3740148_3741051_-|GntR-family-transcriptional-regulator
MALSAIEPFALDRSGATPLHAQVADAIRNHIRDHRLTAGTVLPSEAALCHSFGVARSVVRQALGALVAEGLIRRDPGRAPVVAPPREHRRMVQRSAGLYEQFAGLGVALRTRVLACRPAEPPPEVAAFFGTTETLLLERLRSVDAQPLAYVRTWLPRAAIAGLAADHLQDASLHRVLAQRFGLRPGRGRNRIRAVAAEAALAQALDVAPGSPLLMLEGQGLDQDGHPLEWFTTWHRPENLVFDVDVGQERESVQPALTCGTAAVAPPAVAAPPSGALDAVEQSLLQALQAVRRARGDQQE
>NZ_CP014013.1|WP_003810611.1|3741055_3742111_-|4-hydroxythreonine-4-phosphate-dehydrogenase-PdxA
MTQDATPSRIPTLAVTLGDVAGIGPEITAKMLLGHDELRQRARLLVVGDAAVLAQAVQAVGGDPARVRVIATPAEATNQPGSIEVIQAGPSLAHVPPGQLSAEAGDGSVRYVTTACALARDGLIDGIVTAPLNKAAMHMAGHKWPGHTELLAHEFGVKTFSLVLSAGDLYIFHATTHVSLRQAIEDVNPQRMRAVLRLAGSFARALGRADHPVAVAGLNPHAGENGIFGTEDAEILAPAVAQANAEGILAAGPIPADALFPQAVRGKWKFVIACYHDQGHAPFKSVYGDDGVNITVGLPVVRVSVDHGTAFDIAGKGIAREDSLVLAAERAAQLAPGWHQVWETARSTTGG
>NZ_CP014013.1|WP_003810609.1|3742107_3743325_-|four-carbon-acid-sugar-kinase-family-protein
MGGPYIGIVADDLTGSGDTAVQFVRAGWATQLSVGGAEQALADPAVRQAEVLAVTTHSRPLAAADAAAVVRGEVERLRAAGVQRLYKKVDSTLRGAFKAEIDAARLAWGEDAIAVVCPAFPVTGRTVRQGVLYVGDRPVTETSAATDPVTPVTESHIPTLLGCAQLAAQAGETPAELARRIAAAAPVVVVDALDDADVQRLARAIGVLGQRAVPVGSGGLAAPLARVWAGGQAAGPVLVVVTSQHSAARQQAAALQQAGARTWAPTLAQLADDRNWAAWTAEVEAAEHGMPAVDALMLLAPEGRLAGLDADSVARRLGELAARLVLAHGAAGVVATGGDGASAVLAALQASGIALVDEVTGGVPLGTLTGGQAAGLPVVTKAGGFGEQDVLIRAAQAIRERRFTK
>NZ_CP014013.1|WP_003810604.1|3743325_3744348_-|2-keto-3-deoxygluconate-permease
MTTEVSRVPFYTTMMKVPGGLMLLPLILGSLLGTFAPDALAIGGFTTALFKNSALPLIALLIFATGTQVNMRTGGPILATAGTILLMKTLVPATLIILLGHFVGLDGVMGISILAMLAAFDNSNGGLWLAYTGQYGDSRDRGAYVASAVNDGPFFSLLFLGASGLADIPTIALVAALVPFLLGVVVGNLDIEWRNVLKPVPNIVIPFFAFALGTGINLGAVISGGMSGLVLGLLISPITGALVYFGYRYILRRGGKSGLGFAAGTTAGNAIATPAVVAAADPSFQPYVATATAQVAACVLISSILAPVLASYFLKRAGELKPVEQEPQDERAGQPAEVSL
>NZ_CP014013.1|WP_003818667.1|3744597_3745524_-|ectoine-hydroxylase
MISPAQDPYASRTDRSSAIIARQDPVVYGEGKFADALSADQVQSYERDGFLLLENLFSDEEVAALLAEVERMTRDPAIVRREEAITEPGSNAVRSIFMVHVLSPILGRLVRDPRLANAARQILGSEVYVHQSRANMKPGFKGKEFYWHSDFETWHVEDGMPSMRALSCSVLLTDNNETNGPLMLVPGSHRQFISCVGETPRDHYKQSLKKQEYGVPDPVSLQLLAEQGGISTMTGKAGSVVFFDCNTMHGSNSNISPWPRANVFMVYNSMENTLNPPKYGLNPRPEHIATRQAFKAVRPLDSLKLVER

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP014013_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP014013_4

3875179-3875308

Orphan

Consensus_repeat	Method
TGCCCCCCGAGGGGGCTTTTTTGCCTTGGGGCGGCCCGGCGGCAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP014013_4

>merge|NZ_CP014013|4|3875179-3875308|CRISPRCasFinder
TGCCCCCCGAGGGGGCTTTTTTGCCTTGGGGCGGCCCGGCGGCAAAGGTCGCGCCCCCACGCTGCGCCCGCTGTGCGGGCTTGCTGCCCCCCGAGGGGGCTTTTTTGCCTTGGGGCGGCCCGGCGGCAAA

>NZ_CP014013|4|4|3875179-3875308|CRISPRCasFinder
TGCCCCCCGAGGGGGCTTTTTTGCCTTGGGGCGGCCCGGCGGCAAA	GGTCGCGCCCCCACGCTGCGCCCGCTGTGCGGGCTTGC
TGCCCCCCGAGGGGGCTTTTTTGCCTTGGGGCGGCCCGGCGGCAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP014013.1\|WP_003810383.1\|3865015_3865678_-\|cytochrome-c-oxidase,-cbb3-type-subunit-II	unknown	unknown	gnl\|CDD\|237725
NZ_CP014013.1\|WP_003810356.1\|3879282_3879855_-\|CDP-diacylglycerol--glycerol-3-phosphate-3-phosphatidyltransferase	unknown	unknown	gnl\|CDD\|182763
NZ_CP014013.1\|WP_003810362.1\|3875396_3876719_-\|isocitrate-lyase	unknown	unknown	gnl\|CDD\|237893
NZ_CP014013.1\|WP_010926793.1\|3877037_3877859_+\|NADPH-dependent-7-cyano-7-deazaguanine-reductase-QueF	unknown	unknown	gnl\|CDD\|236986
NZ_CP014013.1\|WP_033449735.1\|3879894_3881724_-\|excinuclease-ABC-subunit-UvrC	unknown	unknown	gnl\|CDD\|234792
NZ_CP014013.1\|WP_033449714.1\|3869857_3871051_+\|8-amino-7-oxononanoate-synthase	unknown	unknown	gnl\|CDD\|273303
NZ_CP014013.1\|WP_003810381.1\|3865688_3867176_-\|cytochrome-c-oxidase,-cbb3-type-subunit-I	unknown	unknown	gnl\|CDD\|237726
NZ_CP014013.1\|WP_003810367.1\|3873120_3873480_+\|CidA/LrgA-family-protein	unknown	unknown	gnl\|CDD\|377131
NZ_CP014013.1\|WP_003810340.1\|3885571_3888802_-\|multidrug-efflux-RND-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|273335
NZ_CP014013.1\|WP_003810358.1\|3877865_3879119_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340883
NZ_CP014013.1\|WP_003810346.1\|3882786_3883248_-\|holo-ACP-synthase	unknown	unknown	gnl\|CDD\|234610
NZ_CP014013.1\|WP_010926791.1\|3871696_3873133_+\|dethiobiotin-synthase	unknown	unknown	gnl\|CDD\|379223
NZ_CP014013.1\|WP_003810379.1\|3867300_3867444_-\|cbb3-type-cytochrome-oxidase-assembly-protein-CcoS	unknown	unknown	gnl\|CDD\|377073
NZ_CP014013.1\|WP_010926789.1\|3867440_3868415_-\|membrane-protein	unknown	unknown	gnl\|CDD\|319774
NZ_CP014013.1\|WP_003810342.1\|3884075_3885575_-\|efflux-transporter-outer-membrane-subunit	unknown	unknown	gnl\|CDD\|182103
NZ_CP014013.1\|WP_003810363.1\|3874226_3874937_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014013.1\|WP_003810375.1\|3868479_3869754_-\|adenosylmethionine--8-amino-7-oxononanoate-transaminase	unknown	unknown	gnl\|CDD\|235656
NZ_CP014013.1\|WP_003810344.1\|3883332_3884079_-\|pyridoxine-5'-phosphate-synthase	unknown	unknown	gnl\|CDD\|235380
NZ_CP014013.1\|WP_003810348.1\|3881686_3882748_-\|beta-N-acetylhexosaminidase	unknown	unknown	gnl\|CDD\|235417
NZ_CP014013.1\|WP_010926792.1\|3873472_3874216_+\|LrgB-family-protein	unknown	unknown	gnl\|CDD\|377236

Protein	Function_ID	Function_description	E-value
NZ_CP014013.1\|WP_003810383.1\|3865015_3865678_-\|cytochrome-c-oxidase,-cbb3-type-subunit-II	gnl\|CDD\|237725	PRK14487, PRK14487, cbb3-type cytochrome c oxidase subunit II; Provisional.	1.50334e-135
NZ_CP014013.1\|WP_003810356.1\|3879282_3879855_-\|CDP-diacylglycerol--glycerol-3-phosphate-3-phosphatidyltransferase	gnl\|CDD\|182763	PRK10832, PRK10832, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase.	3.46977e-48
NZ_CP014013.1\|WP_003810362.1\|3875396_3876719_-\|isocitrate-lyase	gnl\|CDD\|237893	PRK15063, PRK15063, isocitrate lyase; Provisional.	0
NZ_CP014013.1\|WP_010926793.1\|3877037_3877859_+\|NADPH-dependent-7-cyano-7-deazaguanine-reductase-QueF	gnl\|CDD\|236986	PRK11792, queF, 7-cyano-7-deazaguanine reductase; Provisional.	0
NZ_CP014013.1\|WP_003810375.1\|3868479_3869754_-\|adenosylmethionine--8-amino-7-oxononanoate-transaminase	gnl\|CDD\|235656	PRK05964, PRK05964, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional.	0
NZ_CP014013.1\|WP_003810381.1\|3865688_3867176_-\|cytochrome-c-oxidase,-cbb3-type-subunit-I	gnl\|CDD\|237726	PRK14488, PRK14488, cbb3-type cytochrome c oxidase subunit I; Provisional.	0
NZ_CP014013.1\|WP_003810367.1\|3873120_3873480_+\|CidA/LrgA-family-protein	gnl\|CDD\|377131	pfam03788, LrgA, LrgA family. This family is uncharacterized. It contains the protein LrgA that has been hypothesized to export murein hydrolases.	2.10855e-25
NZ_CP014013.1\|WP_003810340.1\|3885571_3888802_-\|multidrug-efflux-RND-transporter-permease-subunit	gnl\|CDD\|273335	TIGR00915, Probable_aminoglycoside_efflux_pump, The (Largely Gram-negative Bacterial) Hydrophobe/Amphiphile Efflux-1 (HAE1) Family. Proteins scoring above the trusted cutoff (1000) form a tight clade within the RND (Resistance-Nodulation-Cell Division) superfamily. Proteins scoring greater than the noise cutoff (100) appear to form a larger clade, cleanly separated from more distant homologs that include cadmium/zinc/cobalt resistance transporters. This family is one of several subfamilies within the scope of pfam00873. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Unknown substrate].	0
NZ_CP014013.1\|WP_003810358.1\|3877865_3879119_-\|MFS-transporter	gnl\|CDD\|340883	cd17325, MFS_MdtG_SLC18_like, bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters. This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.57397e-25
NZ_CP014013.1\|WP_003810346.1\|3882786_3883248_-\|holo-ACP-synthase	gnl\|CDD\|234610	PRK00070, acpS, 4'-phosphopantetheinyl transferase; Provisional.	1.59551e-52
NZ_CP014013.1\|WP_010926791.1\|3871696_3873133_+\|dethiobiotin-synthase	gnl\|CDD\|379223	pfam13500, AAA_26, AAA domain. This domain is found in a number of proteins involved in cofactor biosynthesis such as dethiobiotin synthase and cobyric acid synthase. This domain contains a P-loop motif.	3.72752e-66
NZ_CP014013.1\|WP_003810379.1\|3867300_3867444_-\|cbb3-type-cytochrome-oxidase-assembly-protein-CcoS	gnl\|CDD\|377073	pfam03597, FixS, Cytochrome oxidase maturation protein cbb3-type.	1.64467e-12
NZ_CP014013.1\|WP_010926789.1\|3867440_3868415_-\|membrane-protein	gnl\|CDD\|319774	cd02079, P-type_ATPase_HM, P-type heavy metal-transporting ATPase. Heavy metal-transporting ATPases (Type IB ATPases) transport heavy metal ions (Cu(+), Cu(2+), Zn(2+), Cd(2+), Co(2+), etc.) across biological membranes. These ATPases include mammalian copper-transporting ATPases, ATP7A and ATP7B, Bacillus subtilis CadA which transports cadmium, zinc and cobalt out of the cell, Bacillus subtilis ZosA/PfeT which transports copper, and perhaps also zinc and ferrous iron, Archaeoglobus fulgidus CopA and CopB, Staphylococcus aureus plasmid pI258 CadA, a cadmium-efflux ATPase, and Escherichia coli ZntA which is selective for Pb(2+), Zn(2+), and Cd(2+). The characteristic N-terminal heavy metal associated (HMA) domain of this group is essential for the binding of metal ions. This family belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	3.27753e-20
NZ_CP014013.1\|WP_003810342.1\|3884075_3885575_-\|efflux-transporter-outer-membrane-subunit	gnl\|CDD\|182103	PRK09837, PRK09837, Cu(I)/Ag(I) efflux RND transporter outer membrane protein.	7.76589e-112
NZ_CP014013.1\|WP_003810344.1\|3883332_3884079_-\|pyridoxine-5'-phosphate-synthase	gnl\|CDD\|235380	PRK05265, PRK05265, pyridoxine 5'-phosphate synthase; Provisional.	5.79242e-145
NZ_CP014013.1\|WP_033449735.1\|3879894_3881724_-\|excinuclease-ABC-subunit-UvrC	gnl\|CDD\|234792	PRK00558, uvrC, excinuclease ABC subunit UvrC.	0
NZ_CP014013.1\|WP_033449714.1\|3869857_3871051_+\|8-amino-7-oxononanoate-synthase	gnl\|CDD\|273303	TIGR00858, Putative_8-amino-7-oxononanoate_synthase, 8-amino-7-oxononanoate synthase. 7-keto-8-aminopelargonic acid synthetase is an alternate name. This model represents 8-amino-7-oxononanoate synthase, the BioF protein of biotin biosynthesis. This model is based on a careful phylogenetic analysis to separate members of this family from 2-amino-3-ketobutyrate and other related pyridoxal phosphate-dependent enzymes. In several species, including Staphylococcus and Coxiella, a candidate 8-amino-7-oxononanoate synthase is confirmed by location in the midst of a biotin biosynthesis operon but scores below the trusted cutoff of this model. [Biosynthesis of cofactors, prosthetic groups, and carriers, Biotin].	1.2202e-142
NZ_CP014013.1\|WP_003810348.1\|3881686_3882748_-\|beta-N-acetylhexosaminidase	gnl\|CDD\|235417	PRK05337, PRK05337, beta-hexosaminidase; Provisional.	0
NZ_CP014013.1\|WP_010926792.1\|3873472_3874216_+\|LrgB-family-protein	gnl\|CDD\|377236	pfam04172, LrgB, LrgB-like family. The two products of the lrgAB operon are potential membrane proteins, and LrgA and LrgB are both thought to control of murein hydrolase activity and penicillin tolerance.	3.62626e-69

>NZ_CP014013.1|WP_003810363.1|3874226_3874937_-|hypothetical-protein
MALVLARFGFGFCMLLAALVLLAAATLLATRLVGWAVRAFALERSQALASGVAIFILVALALWGCHAVGEVLYGAIGATALVGGAPHWLAGNSHVSAAALMGATTAAAMLAGGPAFWRWLRARRAAAAEQPAPRKAAPPKGAKPAARAAKAAAKTQIAPRGQRIPWLGWTAFFLLFIGAAVLAFAYIVAPIEAGASGLRLEHATRARPVYLAGLTLLGGGAFFLLAWLSRRRPPGD
>NZ_CP014013.1|WP_010926792.1|3873472_3874216_+|LrgB-family-protein
MPDFVNLWIYLSSTPLFGLTATLTVYLSAHAMYLRLGQVPLANPVLWSMVVLAAGLLAFGVPYPTYFAGAQFIHFLLGPAVVALAWPLWMRRAELRRRWARLLWAALFGGAVACASAVLLGWAVGLPRDIILSLAPKSVTAPVAMGLSETLGGIPALSAVFAALTGLVGALTGKYLFDLLGAVRGRQDWADRGFALGTVSHGIGAARAIQVNADAGAYAGLALGLQVILASLLIPVAFRLAAGLGGS
>NZ_CP014013.1|WP_003810367.1|3873120_3873480_+|CidA/LrgA-family-protein
MQALTGFTWLLALQALGEACSRLLHFPIPGPVTGMLLLLVALRWPLVREPVALAAQFLLSHLSLLFVPVGVGVMTHIALLAEYGLRMAAVIALSTLAGMAATYWALRVGRSAAPETDDA
>NZ_CP014013.1|WP_010926791.1|3871696_3873133_+|dethiobiotin-synthase
MSTRSTPTISQRFDRAAARYETHAEVQRHAAEQLAERIAALPLPAEPRILEIGCGTGLLTRALARRLGRADWTITDIAPAMLAAQQAGPPPAGRVRHQLVDGEHPAGLPGGYDLICSSLAVQWFGDLDAGLARLAGLLAPGGLLAIATLAEHTFSEWRAAHQAHGLHAATPAYPPAERIGRTLAGLRGGITREAYRQRHPDALHFVRSLKAIGASAPAAGHAPLSPAAFRRVLAQFDRQGNHVTYDLAYGLWRKQAPGVFVTGTDTGVGKTLASAILARAWRAHYWKPLQTGVAEEPGDTETVAALAGLEPARLHPPAHVLQAPLSPWAAAPLEGVTLDAAAIAPPQVDGPLVVEGAGGLYVPIDERHMMIDLIARLGMPVVLAARSGLGTINHTLLSLHALRERRLPVLGVIMLGEPSAGNRHAIEHFGGVPVLAQIPRLARVDAEAVEAWAARIPPLADCLARRWPDTQETPACRP
>NZ_CP014013.1|WP_033449714.1|3869857_3871051_+|8-amino-7-oxononanoate-synthase
MSKLDSLFTAALEQAAQRQVRRRLRRATAAPPGRLALDGRTLVNFSSNDYLGLARHPLLAERASLWATRHGAGAQASRLVCGNLDLHEQVEAKLARLKGTEAALLLASGWQANAAVLPALFKAAAAQGEPQVYTDRLNHASLHHGCQAAGVRQIRFRHNDLAHLEHLLAERAGAPGARFIVTESVFSMDGDRADVPALAALAARHHAFLYLDEAHATGVLGPRGMGLAGLAPGGVDLAMGTFSKGLGSFGAYVAGSRALCDYLVNACSGFIYTTALPPAVLGAIDAALDLVPRLDQARAALLGHGERLRASLAAQGIDCGASSTQIVPAIVGDAGHALALAAELERRGLLAVAIRPPTVPAGTSRLRIALSAAHGEAELDQLIEALAAGWRAVRQAA
>NZ_CP014013.1|WP_003810375.1|3868479_3869754_-|adenosylmethionine--8-amino-7-oxononanoate-transaminase
MSDTTPAWMAQGYPHIWLPYAQMKTAAPPLPVVRSHGSLLELADGRTLIDGVASWWTACHGYNHPHIAQAVREQLDRMPHVMFGGLAHEPALNLASRLSALLGPGLERVFYTDSGSVAVEVAMKMAVQFWLNQGERGRTRFVAFRGGYHGDTFGTMAVCDPDEGMHAMFRGLLPEHDVLALPRDEAALAALQAHLERHAGRIAGMLVEPLVQGAGGMLLHDPQVLARLRELADRYGILLIFDEIFTGFGRTGTMFAFEQAGVRPDIVTLSKALTGGTLPLAATVASARVFEGFWSDDPGHALMHGPTFMGCALACAAANASLDLFEREPRLRQVAALEQALRAGLEPCRDLPWVRDVRVLGAIGVIELDGIGARDDLRRRLVDAGVWVRPFGNIVYLTPAFTIAEDELQALLAAVRQVVAERRP
>NZ_CP014013.1|WP_010926789.1|3867440_3868415_-|membrane-protein
MRPTSILAVPADLPGADRQARRHALVRLGVAWLAMMQVMMFAWPGYVRNDGIPADALATLDWAIVLMNWAALLMTVPVVLYCAWPIWRGAASGLRRGRAGMDAPVALGIVAAFVPSVHATWTGRGEVYFDSVTMFVAFLLTARYLELCARQACGACALATPLVRRLHQAGGELGAAADRLATRFVFVQVALALAAGAAWTQIDAAHAVPVMVALLVMSCPCAMSMAVPSAMACAHSALLARPEATAAQGDALLAAAARVARQNLYGSLAWHLLMTPLALAGWVAPWLAAITMLLSSLAVAGNAWRLRRHRWDAAPAAAVAQPAP
>NZ_CP014013.1|WP_003810379.1|3867300_3867444_-|cbb3-type-cytochrome-oxidase-assembly-protein-CcoS
MSILYLLLPLSLAFVLAIGVALWWAVFSGQYDDTEDQGAAILRDNDN
>NZ_CP014013.1|WP_003810381.1|3865688_3867176_-|cytochrome-c-oxidase,-cbb3-type-subunit-I
MNDCSAIASKAETFNYKVVRQFAIMTVVWGIVGMAVGVLIAAQLIWPQLNFDTAWLSYGRLRPLHTNAVIFAFGGSALFATSYYVVQRTCQARLFCDKLAAFTFWGWQAVIVAAAITLPMGFTSSKEYAELEWPIDILITLVWVAYAVVFFGTIVKRRSRHIYVANWFFGSYILTIAILHIFNNIEMPVTLWKSYSAYAGVQDAMVQWWYGHNAVGFFLTTSFLGMMYYFVPKQAGRPIYSYRLSIVHFWALAFTYMWAGPHHLLYTSLPDWTQSLGMTFSLILLAPSWGGMINGIMTLQGAWHKLRTDPILKFLVTALSFYGMSTFEGSMMSIRTVNSLSHYTDWTIGHVHSGALGWVAMITFGSLYYLIPRLYGRQQMHSVRAMELHFWVATIGVVLYIAAMWIAGVQQGLMWRDTAADGTLVYSFVEELKTRVPYYVIRLAGGILYLSGVFVMAWNVWMTVRGARAVNPAIPLENDNRATAPAGVPAAVPAV
>NZ_CP014013.1|WP_003810383.1|3865015_3865678_-|cytochrome-c-oxidase,-cbb3-type-subunit-II
MAQKQHGFFSHQTLEKNIGLMIIASILVVSVAGLVQIIPLFFQHSTTQAMPGVEPYEPLQLMGRDVYIREGCVGCHSQQVRTLQAEVQRYGPYSVAGESVFDHPFLWGSKRTGPDLARVGERYSDEWHRIHLRDPRAVVPESNMPAYPWLQHADLTGQNVAQRMQALRRLGVPYTDEAIAAAPAAIAGKTEEDALVAYLQALGVGARRGAASEPQRAAGG
>NZ_CP014013.1|WP_003810362.1|3875396_3876719_-|isocitrate-lyase
MSNRETEIRNLQKDWAENTRWQGIKRAYSAEDVIRLRGSVAVEHSLARRGATRLWDSLHSEPFVNSLGALTGNQAMQQVKAGLKAIYLSGWQVAGDANLAGEMYPDQSLYPANSVPQVVRRINNALARCDQIQWMEGKNPGDQDYIDYYAPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTREAVSKLVSARLAADVMGTPTILLARTDADAADLVTSDVDENDRPFITGERTVEGFFRTRAGLDQAISRGLAYAPYADLIWCETSTPNLEYARKFAEAVHRQFPGKLLAYNCSPSFNWKKNLDDGTIAKFQRELGAMGYKFQFITLAGFHALNYGMFELAHGYARRQMSAFVELQQKEFAAAELGFTAVKHQREVGTGYFDAVTQTIEGGQSSTTALTGSTEEAQFEHGGQAVKAA
>NZ_CP014013.1|WP_010926793.1|3877037_3877859_+|NADPH-dependent-7-cyano-7-deazaguanine-reductase-QueF
MSLSNAPLGQHVAYPSQYDPGLLFPIPRATNRASLQLGATLPFTGVDLWNAYELSWLDARGKPRVAMATFSFPADSPNIVESKSFKLYLNSFNQTRLPNAQALRDRLERDLAAAAGAPVGLEFISPQRFGELNMAELDGIYIDKLDIEIDTYEPAPQLLQCAPGDEVEETLATRLLKSNCPVTGQPDWASLQVRYRGRPIDRAALLKYVVSFRQHAEFHEHCVERIFGDIMRACQPRQLTVYARYTRRGGLDINPWRSNFESAPPADVRTARQ
>NZ_CP014013.1|WP_003810358.1|3877865_3879119_-|MFS-transporter
MAMNSETAVLDSPALRRRDWQIILLIGVAHSSSHFFQLVLPSLYVSLGTEFGLDFARLGLLVSVFYVVSGLGQASSGFVVDRIGARPVLWFGLACFVLSAVLIGAASGYAMLMLAAAIGGIGNSVFHPADYSIINHRVSPPRLGHAFSLHGLTGNLGWALTPVFITTITLLASWRVAAFSAAALVAVVLLMTVIGRDLLGGAAPAEAGGKSAARPAAQESVWQTLAALLARPALWGAFLFFACTSIALSSVQNYTIPLLGQLYDLSKVAASSALSGYMVASALGMAAGGFLVSANPRTELTVTAALIMAGLTLVVLAMGWVPAGWAALVVGLAGFCSGVAAPSRDMLIRRVTPKGATGSVYGLVYSGMDVGSALGPLGFGLLLDAGMAHGPWVGAGVAFAAAALLAQWIAMQARRTA
>NZ_CP014013.1|WP_003810356.1|3879282_3879855_-|CDP-diacylglycerol--glycerol-3-phosphate-3-phosphatidyltransferase
MPINVPIFLTWLRIAMIPLVVGLFYLPESWMSVPMRDTFAAWAFIIAALTDWFDGWLARRWNQTSAFGAFLDPVADKLMVCAALIVLLDLSRVDAFISLIIIGREITISALREWMAKIGASASVAVHRLGKFKTAAQMVAIPCLLYDQPLFGLSSRLIGDVLIVVAAVLTVWSMLYYLQRAWPAIREKSQ
>NZ_CP014013.1|WP_033449735.1|3879894_3881724_-|excinuclease-ABC-subunit-UvrC
MPDDFNLKSFLADLPHLPGVYRHLDAAGEVMYVGKARDLKKRVSSYFQKNLASPRIAQMVAKVASVDVTVTRSEAEALLLENNLIKSLRPRYNILFRDDKSYPYLLITGHAWPRIAYYRGATSKRGQYFGPYPNSWAVRETIQILQKVFRLRTCEDTVFANRSRPCLLHQIGRCSAPCVGVIEAGDYAHDVQRAVRFLNGEAREVMDEIEARMLQASTELRFEEAAVLRDQMGSLSKVLHQQTMENVGGDDTDVIAVASAGGKICVNLAMVRGGRHLGDKPFFPTHAEGEQPAQVLEAFVAQHYADGAMPPVLVCSHALPDSGLVGLLAEQGGTRAARVLTRPQGVRRSWLEQAQKNAEMALARALTESGARAGRTLALAEALDLDTDEESLDALRIECFDISHTAGEATQASCVVFLHHDMQPSLYRRYNIVGITPGDDYAAMRQVLTRRFGKVADGEAPMPGLVLIDGGKGQVEVARQVFVELGLDIQSLVGVAKGEGRKVGLETLVFADGRPPVALGKESAALMLIAQVRDEAHRFAITGMRARRAKTRNVSRLEEIEGIGARRRQRLLARFGGLSGVSSASIEDLASVEGISQELAVRIYDALHG
>NZ_CP014013.1|WP_003810348.1|3881686_3882748_-|beta-N-acetylhexosaminidase
MSSKKKTKPVLPPGPVMVDVAGTTLTKDEKRRLRNPLVGGVILFARNFTDRRQLCALTRAIHKARKEPLLIAVDHEGGRVQRFRDDGFTALPPMQELGKLWDRDPLAAMRLATEAGYVLAAELRACGVDLSFTPVLDLDYGVSKVIGNRAFHHDARVVTMLSRALAQGLALAGMAACGKHFPGHGFVGADSHHEIPVDPRPLARILKDDAAPYAWLGDLVMPAVMPAHVIYPKVDAQPAGFSRRWVSEILRERLGYDGVVFSDDLTMEGASVAGDILARAEAALGAGCDMVLVCNRPDLADELLDRLQVQHPAASVERIRRLMPRFAAPDWDTLQNDSRYQHARRLQSQIVSG
>NZ_CP014013.1|WP_003810346.1|3882786_3883248_-|holo-ACP-synthase
MSSVSAAGATPPASPGCIAGIGMDLLRIERIERALARHGDRFAQKILGPEELAKFHARRRRDPARGVRFLATRFAAKEAFSKAIGLGMRMPMSWRRVQTLNAPGGRPVLVIGAELADWFDARFGAAHVSITDESDMAAAYVIVERKPAPDGRP
>NZ_CP014013.1|WP_003810344.1|3883332_3884079_-|pyridoxine-5'-phosphate-synthase
MIELGVNIDHVATLRQQRHTAYPDPVQAALRAEDAGADLITLHLREDRRHIQDADVYAIRPLLRTRMNLECAVTPEMLEIACAVKPSDVCLVPEKRTELTTEGGLDVAGAQAAVTDAVQLLAEAGIRVSLFIDPDARQIEAAARAGAPVIELHTGAYAEARDDAAVQAELARVRAAVAEGLRHGLRVNAGHGLHYGNVQAVAALDGIAELNIGHAIVAQSIFDGWDKAVRDMKALMVQARLAAVRGHA
>NZ_CP014013.1|WP_003810342.1|3884075_3885575_-|efflux-transporter-outer-membrane-subunit
MMAVMYKRSALSVLVAAALAGCSLAPDYKRPEAPVQANWPDQPKVQYGAYASPTSLGEQPAAAVAPQGATPADEIGWREFFRDARLQKLIELALVNNRDLRVAVQRVEEARAQYGVQRGAQWPSIGAGIQGQRQHLPPDMRPLGPDSTSISSQYQAGLGLTTFEIDLFGRLRNLSEAAYQQYLSTEQAQRSVHITLVGAVAQSYFNLRAAEVQLELTQKTLASRQESYNLVKTRFDGGVASELDLNQSKSLLDSASADLAALARARAQAANALVVLVGLPGLPEDLPAPAVFGRDQLLASVPAGLPSDLLTRRPDILAAENQLKAANANIGAARAAFFPTISLTGLLGVASPSLDNLFKGGQGYWSFSPSITTPLFAGGSIREGLNLAKARDNIAVAQYEQSIQQAFREVSDALAGEATYSAQLDAQRALQVAAGRTLELSNLRYNNGIDSYLQVQTAQVDFFNAQLGLVQTGLAALINRVELYKALGGGWQESTTKQP
>NZ_CP014013.1|WP_003810340.1|3885571_3888802_-|multidrug-efflux-RND-transporter-permease-subunit
MPQFFIDRPIFAWVVALFILLTGILAIPNMPVSQYPDVAPPAITITATYPGASAKEVAESVTSIIEDQLNGAKGLLYYESVSDSYGQSQITATFAPGTDPDLAQVDVQNRVSNVTAQLPVAVMQQGLQYEQTSAGFLMIVTLSSTDGTLDQTALADYITRNVKNPVSRVPGVGQFQLFAAPRAMRIWVDPDKLVGFNLSMAEVNQAISQQNVLISAGSIGAPPNPDSQRATATVIVNGQLSTIEGFGQIVLRANTDGSKVLLRDVARIEVGADNYQFGARLNGKPTAAFAIVLSPDANALATAEGVRQQMASLSQYFPSNIRYDIPYDTAPYVKVSIEQVIHTLVEAMVLVFLVMFLFLQNVRYTLIPALVVPVAMLGAFAVMLALGFSINVLTMFAMVLAIGILVDDAIVVVENVERIMASEGLSPKEATKKAMPQISGAIVGITLVLVTVFLPLAFMTGSVGVIYRQFSVAMAVSIFFSAFLALSFTPALCATILKPIPKGHHQEKKGFFGWFNRKFDATTHNYQNWVSRILHKGGRMMLAFALLVVLLGWLYMRLPSSFLPEEDQGYVVSNIELPTGASANRTIEVIEEVENYFRNIPAVENVITVQGYSFNGNGLNAAIAFTTLKDFSERKSRADSAGAIAFTAFSKQLMGIHDAQVFTLVPPAISSLGNASGFDFRLQDRGGAGTEALGAATAELMGMAAKSPVLSQVRITGLGPGSQLSLTIDRDKAAALGVNFDEAATLISTAVGSAFLNKFPNMGRMQNIWVQADQQYRMQVEDLLKLNARNNQGGMVPLSTFVSAKWVQGPVQVVRYNSYESVRIGGDAAAGYTTGEAMQEMQDLVARLPQGFGYEWNGLSYQERLAGNQAPILMGLALLVVFLVLAALYESWAIPLSVMLVVPLGMLGAVALVTVLGMSNDVYFQVGMVTVIGLAAKNAILIVEFAKDQYARGQGLYESAVEAARLRFRPILMTSLAFILGVVPLAIATGAGAASQRAVGIGVLGGMLAATPFAVIFVPTFFVVVLGLFKTRPRLLGAELRAFEEEQAAKRAAEQQQPQDGAATPAPQTGGQENKE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP014013_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP014013_5

4544863-4544966

Orphan

Consensus_repeat	Method
GCGCAGCGAGCGCAGCGTGGGGGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP014013_5

>merge|NZ_CP014013|5|4544863-4544966|CRISPRCasFinder
GCGCAGCGAGCGCAGCGTGGGGGCATTTTCCACCGCCGGGCCGCCCCAAGGCAAAAGCCCCCCTGGGGGGCAGCAAGCTGGCGCAGCGAACGCAGCGTGGGGGC

>NZ_CP014013|5|5|4544863-4544966|CRISPRCasFinder
GCGCAGCGAGCGCAGCGTGGGGGC	ATTTTCCACCGCCGGGCCGCCCCAAGGCAAAAGCCCCCCTGGGGGGCAGCAAGCTG
GCGCAGCGAACGCAGCGTGGGGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP014013.1\|WP_003814199.1\|4547881_4548982_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|223506
NZ_CP014013.1\|WP_003814203.1\|4550671_4551511_+\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	unknown	unknown	gnl\|CDD\|224131
NZ_CP014013.1\|WP_003814183.1\|4541993_4542794_-\|EI24-domain-containing-protein	unknown	unknown	gnl\|CDD\|377798
NZ_CP014013.1\|WP_003814179.1\|4541128_4541941_-\|competence/damage-inducible-protein-A	unknown	unknown	gnl\|CDD\|223986
NZ_CP014013.1\|WP_003814193.1\|4546240_4547161_+\|branched-chain-amino-acid-transaminase	unknown	unknown	gnl\|CDD\|235841
NZ_CP014013.1\|WP_010931455.1\|4545308_4546058_-\|AzlC-family-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224215
NZ_CP014013.1\|WP_003814170.1\|4532294_4533344_+\|quinone-dependent-dihydroorotate-dehydrogenase	unknown	unknown	gnl\|CDD\|235388
NZ_CP014013.1\|WP_003814206.1\|4552495_4553590_-\|porin	unknown	unknown	gnl\|CDD\|238208
NZ_CP014013.1\|WP_003814201.1\|4549078_4550596_-\|M48-family-metallopeptidase	unknown	unknown	gnl\|CDD\|227122
NZ_CP014013.1\|WP_003814174.1\|4534456_4535434_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugD	unknown	unknown	gnl\|CDD\|270294
NZ_CP014013.1\|WP_033446149.1\|4551532_4552405_-\|cytochrome-c-oxidase-assembly-protein	unknown	unknown	gnl\|CDD\|378238
NZ_CP014013.1\|WP_003814195.1\|4547207_4547420_+\|zinc-finger-domain-containing-protein	unknown	unknown	gnl\|CDD\|226826
NZ_CP014013.1\|WP_003814185.1\|4542855_4543239_+\|thioredoxin-family-protein	unknown	unknown	gnl\|CDD\|239245
NZ_CP014013.1\|WP_010927006.1\|4535527_4539922_-\|dermonecrotic-toxin	unknown	unknown	gnl\|CDD\|283449
NZ_CP014013.1\|WP_161939025.1\|4543250_4544609_-\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|236722
NZ_CP014013.1\|WP_003814172.1\|4533491_4534070_-\|TIGR01841-family-phasin	unknown	unknown	gnl\|CDD\|130900
NZ_CP014013.1\|WP_003814197.1\|4547442_4547865_+\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|379209
NZ_CP014013.1\|WP_033446151.1\|4531528_4532254_+\|arginyltransferase	unknown	unknown	gnl\|CDD\|234939
NZ_CP014013.1\|WP_003814188.1\|4544976_4545306_-\|AzlD-domain-containing-protein	unknown	unknown	gnl\|CDD\|226827
NZ_CP014013.1\|WP_003814178.1\|4540122_4540971_-\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332

Protein	Function_ID	Function_description	E-value
NZ_CP014013.1\|WP_003814199.1\|4547881_4548982_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|223506	COG0429, COG0429, Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only].	1.70568e-90
NZ_CP014013.1\|WP_003814203.1\|4550671_4551511_+\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	gnl\|CDD\|224131	COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane].	2.75704e-156
NZ_CP014013.1\|WP_003814183.1\|4541993_4542794_-\|EI24-domain-containing-protein	gnl\|CDD\|377798	pfam07264, EI24, Etoposide-induced protein 2.4 (EI24). This family contains a number of eukaryotic etoposide-induced 2.4 (EI24) proteins approximately 350 residues long as well as bacterial CysZ proteins (formerly known as DUF540). In cells treated with the cytotoxic drug etoposide, EI24 is induced by p53. It has been suggested to play an important role in negative cell growth control.	1.28978e-07
NZ_CP014013.1\|WP_003814179.1\|4541128_4541941_-\|competence/damage-inducible-protein-A	gnl\|CDD\|223986	COG1058, CinA, Predicted nucleotide-utilizing enzyme related to molybdopterin-biosynthesis enzyme MoeA [General function prediction only].	2.67138e-63
NZ_CP014013.1\|WP_003814193.1\|4546240_4547161_+\|branched-chain-amino-acid-transaminase	gnl\|CDD\|235841	PRK06606, PRK06606, branched-chain amino acid transaminase.	0
NZ_CP014013.1\|WP_010931455.1\|4545308_4546058_-\|AzlC-family-ABC-transporter-permease	gnl\|CDD\|224215	COG1296, AzlC, Predicted branched-chain amino acid permease (azaleucine resistance) [Amino acid transport and metabolism].	6.63749e-32
NZ_CP014013.1\|WP_003814170.1\|4532294_4533344_+\|quinone-dependent-dihydroorotate-dehydrogenase	gnl\|CDD\|235388	PRK05286, PRK05286, quinone-dependent dihydroorotate dehydrogenase.	0
NZ_CP014013.1\|WP_003814206.1\|4552495_4553590_-\|porin	gnl\|CDD\|238208	cd00342, gram_neg_porins, Porins form aqueous channels for the diffusion of small hydrophillic molecules across the outer membrane. Individual 16-strand anti-parallel beta-barrels form a central pore, and trimerizes thru mainly hydrophobic interactions at the interface. Trimers are stabilized by hytrophillic clamping of Loop L2. Loop 3 bends into the pore, creating an elliptical constriction of about 7 x 11A, large enough to allow passage of a glucose molecule without steric hindrance. Removal of the C-terminal residue (usuallly F) destabilizes the trimer and removal of the 16th beta-sheet abolishes trimerization. Unlike typical membrane proteins, porins lack long hydrophobic stretches. Short turns are found at the smooth, periplasmic end, longer irregular loops are found at the rough, extracellular end. C-terminal residue forms salt bridge with N-terminus.	8.91426e-53
NZ_CP014013.1\|WP_003814201.1\|4549078_4550596_-\|M48-family-metallopeptidase	gnl\|CDD\|227122	COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only].	4.64199e-95
NZ_CP014013.1\|WP_003814174.1\|4534456_4535434_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugD	gnl\|CDD\|270294	cd13576, PBP2_BugD_Asp, Aspartic acid transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	2.54496e-161
NZ_CP014013.1\|WP_033446149.1\|4551532_4552405_-\|cytochrome-c-oxidase-assembly-protein	gnl\|CDD\|378238	pfam09678, Caa3_CtaG, Cytochrome c oxidase caa3 assembly factor (Caa3_CtaG). Members of this family are the CtaG protein required for assembly of active cytochrome c oxidase of the caa3 type, as found in Bacillus subtilis.	5.4923e-46
NZ_CP014013.1\|WP_003814195.1\|4547207_4547420_+\|zinc-finger-domain-containing-protein	gnl\|CDD\|226826	COG4391, COG4391, Uncharacterized protein conserved in bacteria [Function unknown].	5.98518e-12
NZ_CP014013.1\|WP_003814185.1\|4542855_4543239_+\|thioredoxin-family-protein	gnl\|CDD\|239245	cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the redox state of target proteins via the reversible oxidation of an active site dithiol, present in a CXXC motif, partially exposed at the protein's surface. TRX reduces protein disulfide bonds, resulting in a disulfide bond at its active site. Oxidized TRX is converted to the active form by TRX reductase, using reducing equivalents derived from either NADPH or ferredoxins. By altering their redox state, TRX regulates the functions of at least 30 target proteins, some of which are enzymes and transcription factors. It also plays an important role in the defense against oxidative stress by directly reducing hydrogen peroxide and certain radicals, and by serving as a reductant for peroxiredoxins. At least two major types of functional TRXs have been reported in most organisms; in eukaryotes, they are located in the cytoplasm and the mitochondria. Higher plants contain more types (at least 20 TRX genes have been detected in the genome of Arabidopsis thaliana), two of which (types f amd m) are located in the same compartment, the chloroplast. Also included in the alignment are TRX-like domains which show sequence homology to TRX but do not contain the redox active CXXC motif. Group II proteins, in addition to either a redox active TRX or a TRX-like domain, also contain additional domains, which may or may not possess homology to known proteins.	1.97539e-15
NZ_CP014013.1\|WP_010927006.1\|4535527_4539922_-\|dermonecrotic-toxin	gnl\|CDD\|283449	pfam05785, CNF1, Rho-activating domain of cytotoxic necrotizing factor. This family consists of several bacterial cytotoxic necrotizing factor proteins as well as related dermonecrotic toxin (DNT) from Bordetella species. Cytotoxic necrotizing factor 1 (CNF1) causes necrosis of rabbit skin and re-organisation of the actin cytoskeleton in cultured cells. Bordetella dermonecrotic toxin (DNT) stimulates the assembly of actin stress fibers and focal adhesions by deamidating or polyaminating Gln63 of the small GTPase Rho. DNT is an A-B toxin which is composed of an N-terminal receptor-binding (B) domain and a C-terminal enzymatically active (A) domain.	5.01116e-144
NZ_CP014013.1\|WP_161939025.1\|4543250_4544609_-\|DEAD/DEAH-box-helicase	gnl\|CDD\|236722	PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional.	4.34586e-157
NZ_CP014013.1\|WP_003814172.1\|4533491_4534070_-\|TIGR01841-family-phasin	gnl\|CDD\|130900	TIGR01841, hypothetical_protein, phasin family protein. This model describes a family of small proteins found associated with inclusions in bacterial cells. Most associate with polyhydroxyalkanoate (PHA) inclusions, the most common of which consist of polyhydroxybutyrate (PHB). These are designated granule-associate proteins or phasins; the member from Rhodospirillum rubrum is an activator of polyhydroxybutyrate (PHB) degradation. However, the member from Magnetospirillum sp. AMB-1 is called a magnetic particle membrane-specific GTPase.	3.19978e-10
NZ_CP014013.1\|WP_003814197.1\|4547442_4547865_+\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|379209	pfam13474, SnoaL_3, SnoaL-like domain. This family contains a large number of proteins that share the SnoaL fold.	1.07341e-14
NZ_CP014013.1\|WP_033446151.1\|4531528_4532254_+\|arginyltransferase	gnl\|CDD\|234939	PRK01305, PRK01305, arginyl-tRNA-protein transferase; Provisional.	6.46686e-140
NZ_CP014013.1\|WP_003814188.1\|4544976_4545306_-\|AzlD-domain-containing-protein	gnl\|CDD\|226827	COG4392, COG4392, Predicted membrane protein [Function unknown].	7.8037e-15
NZ_CP014013.1\|WP_003814178.1\|4540122_4540971_-\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	4.34506e-72

>NZ_CP014013.1|WP_161939025.1|4543250_4544609_-|DEAD/DEAH-box-helicase
MLKSIADTGYTNPTPIQAQAIPVVVEGRDVMGAAQTGTGKTAAFTLPILHRLMPLANTSASPARHPVRALILTPTRELADQVYESVKRYSLHTPLRSAVVFGGVDIGPQKEALRRGCEVLVATPGRLLDHVEQKNVNLSQVGILVLDEADRMLDMGFLPDLERIIRLLPAQRQGLLFSATFSNEIRKLGRSYLNHPVEIEVAARNATADTVTQIAYQMHGDTKRAAVVHLVKSRGLKQVIVFSNTKIGTARLARQLERDGVKAESIHGDKTQGDRMKALEAFKAGDLEVLVATDVAARGLDVAGVPCVINYDLPYNAEDYVHRIGRTGRAGASGEAIALFTADEERYLLDIEKLIKRQVPRGKLELPADLVARSHGRDRDAPRERERGADRHRGERRTSGAAAPRQPVDELFYKPYEPANGQPASPETPKQEGRSNAPKRQLAVLLGGSRKG
>NZ_CP014013.1|WP_003814185.1|4542855_4543239_+|thioredoxin-family-protein
MPLHVPGSDIPTLRAALARSDAWLVACFCAAWCDTCQQYRPKLLELARARPGHTFAWIDIEDHPDLLGEEDVENFPTLLVQAHGKVLFYGPMLPHIGHLERLLDSLDPQGRPVATGLPDVARLLAAA
>NZ_CP014013.1|WP_003814183.1|4541993_4542794_-|EI24-domain-containing-protein
MTVPRPESIIPPAGNAATGAAGIARAFKRALVSQCHPNMLFAVLLPFLIALLGAILLLWLFWTPLNEWLRFEASQWQAINQVDDWMVAAGLFSLKIYLVPVIAAAILLPISGILGLAIAAVFVMPLVLRHVGGREYAGLARQGRNATAVSVWNALWVSLAFGAGWLLTLPFWLIPPMAVILSVFWWAFAFTRMLRLDAIVEHASPAERAILLKRHNSGFWLIGLVCSLLNLLPPAWIILPVFSGLVYAHYGLDALQRLRQERTIDV
>NZ_CP014013.1|WP_003814179.1|4541128_4541941_-|competence/damage-inducible-protein-A
MAAESARRIGLIIVGDEILSGRRQDKHFSKVVELLGARGLKLSWAELLPDDRATLAAVLRRSFASGDIVFSCGGIGGTPDDHTRQAAAEALDLPLALHPEAEQAIALRAAEMAAKGQGTADMGTPENQQRLQMGMFPRGCEIVPNPYNRIPGFFVRDHTFVPGFPVMAWPMLEWTLDTRYRALHHQVRHAEHSFLVFDMPESRITPAMVEIEQRWPGVRAFSLPSVGETGGPSHIDLGVKGEPEAAAQALAFLRAEVVRLGGKLAPPAQN
>NZ_CP014013.1|WP_003814178.1|4540122_4540971_-|IclR-family-transcriptional-regulator
MSRIPNATARGPGSHSDDGAGQHPIAIQVIDRAMRLLDALAAQPEPVTLKELSATTGLHASTAHRILNDLVVGRYVERVDNGLYQLGMRLLELGSLVKGRLNVREAAIGAMRSLHKQTGQTINLSVQQGDEIVYIDRAWSERSGMQVVRAIGGRAPLHLTSTGKLFLSTYDTRLVRAYALRTGLAGHTRNSLTELDRLERELALVRRHGYARDNEELELGVRCIAAGIYDDTGKLVAGLSISAPAERLQDEWIRLLVDAAASISEALGYEPGVNGIHAPAAA
>NZ_CP014013.1|WP_010927006.1|4535527_4539922_-|dermonecrotic-toxin
MDKDESALRQLVDMALVGYDGVVEELLALPSEESGDLAGGRAKREKAEFALFSEAPNGDEPIGQDARTWFYYPKYRPVAVSNLKKMQVAIRARLEPESLILQWLIALDVYLGVLIAALSRTAISDLVFEYVKARYEIYYLLNRVPHPLAAAYLKRRRQRPVDRSGRLGSVFEHPLWFAYDELAGTVDLDADIYEQALAESIERRMDGEPDDGSLDTAEHDVWRLCRDGINRGEQAIFQASGPYGVVADAGYMRTVADLAYADALADCLHAQLRIRAQGSVDSPGDEMPRKLDAWEIAKFHLAATQQARVDLLEAAFALDYAALRDVRVYGDYRNALALRFIKREALRLLGARRGNASTMPAVAAGEYDEIVASGAANDAAYVSMAAALIAGVLCDLESAQRTLPVVLARFRPLGVLARFRRLEQETAGMLLGDQEPEPRGFISFTDFRDSDAFASYAEYAAQFNDYIDQYSILEAQRLARILALGSRMTVDQWCLPLQKVRHYKVLTSQPGLIARGIENHNRGIEYCLGRPPLTDLPGLFTMFQLHDSSWLLVSNINGELWSDVLANAEVMQNPTLAALAEPQGRFRTGRRTGGWFLGGPATEGPSLRDNYLLKLRQSNPGLDVKKCWYFGYRQEYRLPAGALGVPLFAVSVALRHSLDDLAAHAKSALYKPSEWQKFAFWIVPFYREIFFSTQDRSYRVDVGSIVFDSISLLASVFSIGGKLGSFTRTQYGNLRNFVVRQRIAGLSGQRLWRSVLKELPALIGASGLRLSRSLLVDLYEIFEPVPIRRLVAGFVSATTVGGRNQAFLRQAFSAASSSAGRTGGQLASEWRMAGVDATGLVESTSGGRFEGIYTRGLGPLSERTEYFIVESGNAYRVIWDAYTHGWRVVNGRLPPRLTYTVPVRLNGQGHWETHLDVPGRGGAPEIFGRIRTRNLVALAAEQAAPMRRLLNQARRVALRHIDTCRSRLASPRAESDMDAAIRIFFGEPDAGLRQRIGRRLQEVRAYIGDLSPVNDVLYRAGYDLDDVATLFNAVDRNTSLGRQARMELYLDAIVDLHARLGYENARFVDLMAFHLLSLGHAATASEVVEAVSPRLLGNVFDISNVAQLERGIGNPASTGLFVMLGAYSESSPAIFQSFVNDIFPAWRQASGGGPLVWNFGPAAISPTRLDYANTDIGLLNHGDISPLRARPPLGGRRDIDLPPGLDISFVRYDRPVRMSAPRALDASVFRPVDGPVHGYIQSWTGAEIEYAYGAPAAAREVMLTDNVRIISIENGDEGAIGVRVRLDTVPVATPLILTGGSLSGCTTMVGVKEGYLAFYHTGKSTELGDWATAREGVQALYQAHLAMGYAPISIPAPMRNDDLVSIAATYDRAVIAYLGKDVPGGGSTRITRHDAGAGSVVSFDYNAAVQASAVPRLGQVYVLISNDGQGARAVLLAEDLAWAGSGSALDVLNERLVTLFPAPV
>NZ_CP014013.1|WP_003814174.1|4534456_4535434_+|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugD
MPPISRKLSALFAAVALTGAGTALAEYPERPVNMVVPFAAGGPTDNVARSLAESMRPTLGETVVVENKGGAGGTIGTTQVARAQPDGYSILLMHAGFSTAPSLYKNPGYEPYTSFEPIGLVVDVPMTIIARGDFPPNNIKELAEYVKKNADKISLANAGIGAASHLCGTMLVEALGVNLLTIPYKGTAPAMNDLLGKQVDLMCDQTTNTTQQITSGKVKAYAVTSLKRVPTLPDLPTMDESGYKGFEVGIWHGMWAPKGTPKPVVDKLVKSLQAGLADPKFQERMKQLGAEVLTNEANPEALQAKVKQQVPQWAELFKKAGVEKQ
>NZ_CP014013.1|WP_003814172.1|4533491_4534070_-|TIGR01841-family-phasin
MSAIPQQVLARQKATVNSLVAAQSAMFAGFEKLVDLNLKVVRATLDEVAQQSQQAAELKDPQDVASFTSGLVQPGAEKALAYGKHVYDIVAGVQAELAQLAEAQIAEGQQQLTEAVEQFSKNAPTGSESAVALIKSSLATANSAYDSLTKAAKQAAEVAESNLNAAANASFKAASDAAEVATKAAGRNRRAA
>NZ_CP014013.1|WP_003814170.1|4532294_4533344_+|quinone-dependent-dihydroorotate-dehydrogenase
MSILFHAYPLARPALFAMDAETAHEVTLAQLQRAYDCGLTRKLLHAQPEAPATLMGLSLRNPVGLAAGLDKNGAHIDALGNLGFGFVEVGTVTPRAQPGNPKPRMFRLPRANALINRLGFNNQGLDAFIANVQRSQWRSQGGILGLNIGKNADTPIERAAEDYLIGLAGVYPHADYVTVNISSPNTKNLRALQGGDELSALLGQLQERRLALADQHQRHVPLAVKIAPDLSDDQIDAIAEILPRHGIDGVIATNTTLARDAVQGLPHAEEAGGVSGAPVHELSLRVIERLRSRLGDAVAIIGVGGILSGRQASEKMAAGAQAVQLYTGLIYRGPALVGECVRALAQGSR
>NZ_CP014013.1|WP_033446151.1|4531528_4532254_+|arginyltransferase
MSQLKELPFSTLQFYATAPYPCSYLPGRQARSQVAAPGHLINAGTYSQLVEQGFRRSGLFTYRPHCDNCHACVPVRVDAARFEPNRTQRRAWRSHQALRAFVAELAWSPEHYDLYTRYQQGRHPGGGMDEDSRTQYAQFLLTTRVNTRLVEFRAPQGQLAMISIIDVLDDGLSSVYTFYDPDMAGSLGTYSILWQIEQCRTLDLPWLYLGYWIADSRKMAYKANFRPLQMHVDGAWRETPP
>NZ_CP014013.1|WP_003814188.1|4544976_4545306_-|AzlD-domain-containing-protein
MSDRDLYVYGAILLLTLCSVLTRAGFMLFGDYIPLPDGVRRALRYAPAAALTAIVVPDLLPWKAGLGPAFDYKLVAGVLAIMAFLRTRSAVLVIVVGMVALWGLRWLAG
>NZ_CP014013.1|WP_010931455.1|4545308_4546058_-|AzlC-family-ABC-transporter-permease
MASDPATSALEDARQARQERADAFRAGVRAITPALIATGTWGMVTGVAMVKSGLTESMALAMTLLMYAGSAQLTSLPLIATGAPLWLIFAAGFVVNLRFLIFGAALHPYFRHMSWPRRLGLGYFTTDMGFVLFMPRFGDAAERGTREQLWFFLGTVAPGWMVWQVTSIVGIYLGSLVPEAWSLDFAAVLALLAITVPLANSKPMLVSMLAAGMVAWVGQLLPLRLGLAAAVVAGIVAGIWAERFFKGRT
>NZ_CP014013.1|WP_003814193.1|4546240_4547161_+|branched-chain-amino-acid-transaminase
MSMSDRDGFIWYDGKLVPWREATTHVLTHSLHYGLSVFEGVRAYETAAGTAIFRLQDHTNRLFNSAHIYQIPLPYDRDTLNEAQREVVRANGLASCYLRPLAFYGSEKMGVSPKGAQVHVAIAAWPWGAYLGETALAQGIRVKVSSFARQHVNVTMPRAKVATTYANSIIANAEALQDGYDEALLLDTEGFVAEGAGENIFIVKDGVLCEPEIASALTGITRSTIHALAADLGLRVVTKRLTRDDVYIADEAFFTGTAAEVTPIREVDNRQIGAGRRGPVTEKLQQAFFDLVNGRNPKYQHWLTPV
>NZ_CP014013.1|WP_003814195.1|4547207_4547420_+|zinc-finger-domain-containing-protein
MTAAAQAAVPAHDAIEVGAEDLPVYCPGPKAPLWSMHPRVFLDVTHTGQASCPYCGAAYRLKPGTVVHGH
>NZ_CP014013.1|WP_003814197.1|4547442_4547865_+|nuclear-transport-factor-2-family-protein
MFATPDEAEHAFYEALEHADLDRLMQVWSDDEEIACIHPGGLRIVGHTAVHESWQQVLANGPLHLRPLRPLVMQSMMCAVHVLVEQVTVMTREGAQFANCYATNVYHKGPAGWRMVLHHASQAPAEAGVLDLHDFPDRLH
>NZ_CP014013.1|WP_003814199.1|4547881_4548982_+|alpha/beta-fold-hydrolase
MAASRIDLTPCPVPPWLPDRHSQTVYAAVLAQYHRIAFVRERVDTPDTDFVDFDWTGPGLFPHKTAEGAAPAGPAPQGNGRIAAARWITATDWASLPQTADTPALILFHGLEGGSTSRYAQSIAHYFRARGWIVVIAHFRGCSGVPNRLARAYYSGDSAEVGFMLDTVRARIPHARWHAVGVSLGGNALLKYLGEHHDEASWLAAAAGVSVPLDLVAGGKALCTGFIARRIYTAYFLKTMRRKVLEKAKRFPGAIDVIRIAHARDLRDFDDAYTARMHGYRNALDYWTRASSKPWLAHIKTPTLVLNARNDPFLPESALPIPAECSDSVLLHQPAEGGHAGFPTGPFPAHLNWLPQRLGRFFEMGS
>NZ_CP014013.1|WP_003814201.1|4549078_4550596_-|M48-family-metallopeptidase
MNRWNLTFSPSLGRRALAAALSLALGLPVAPAVGQPSGLPSMGAASASELSPMLERQLGDAIMAQGRRDPTYINDPELRQYLTTMGRKLASFAPGAAPHVEMFGVRDPEINAFAMPGGYIGVNTGLIVSSASESELAAVLAHEIGHVAQRHIARGMTQQNQNSMVMLASLAGALLAALAGGGGNLAMGVAAFGQAAAINRQLGFSRDAEREADRTGLQMLAKAGYDPDGMAQMFSRLMNASRLNEGMGGGAWASTHPLSIDRMSDVQNRIRGLPGSRHVDSDDFWFIRAKMRVAQGRDALSLRTAQQQLQDESRALSGVRQAAAFYGLALYAFQRNDLAQARAFLEQAGAGGRSSPQMARLAIDVAVAAKDNDQALALAQAAVKRWPDRKALGIAYAQALQAAGRHADAQAYLRERARQWGGDEPSLYQLLAQSEERTGHPVDARRNMARYYDLTGAYASAESQLQQARGLSNDFYEQSQIDVSIREIKQKLADERQLLERFKSG
>NZ_CP014013.1|WP_003814203.1|4550671_4551511_+|UTP--glucose-1-phosphate-uridylyltransferase-GalU
MQVVRKAVFPVAGMGTRFLPATKAMPKEMLPVVDKPLIQYAVEEAVAAGITDLIFVTGRNKRAIEDHFDAAPELETDLEAKGKHELLALVRDILPAHVNCLYIRQSAPLGLGHAVLTAAPAVGNEPFAVLLADDLIDADTPVLKQLIDVAVARQGSVLGVQEVPREDTRKYGIVASQPVDARTERVTHIVEKPAPEQAPTTLAVVGRYVLEAAIFDHLRATTVGAGNEIQLTDGIAALLRERDVYAHRYDGKRYDCGSKAGMFQATVALGRKYHGLIPE
>NZ_CP014013.1|WP_033446149.1|4551532_4552405_-|cytochrome-c-oxidase-assembly-protein
MDWLEWLIPWEFSPTLVAAFVVAIVLFVRGQRVHHVTAARQWLFWSGMVLLYLSMHTRLDYYAERMFFIHRAQHLVLHHLGPLLVMAAFPGSAMRAGLPMAWRVRLRDFLRTGTGRALAAVLTHKVFVPTLFVFLVLVWLLPSVQFYSMLDWRLYRLMNWSVVISGFMYWNLILDRRPSPPAAMTPGGRVLSPALTMAPQMVAGAVIAFTERDLYPLFELCGRAIAMSAQTDQTIGGLTMWIPAALVEVVGLLVALGTLMRLSGKGRLRPQDRAARARQRAAGSPTSPAA
>NZ_CP014013.1|WP_003814206.1|4552495_4553590_-|porin
MRRLLVVAAMAAGSSSVFWSVAPARAANQLELYGVVDVGLATTRVSGLGTRQQVLGGGQTDNLWGLRGTEELDGGWRASFGLESGFDAANGTRNDDARLFDYGTWVGLGHAGVGELSLGRQQSIGLQYGGQLEIASWRDMGMGALFKASDNYRVNNLVNYLSPEFSGWQWGVGYAFDVESGDTGRFDRSPAFSTGLKYEDGPLLAAFTWDKLNLHDTSATGGRSPQALQAGFTYDFEALKMALAWSRQRNGFVGLNGGGQIGLGPEPFAHGGAINAWLLGLEVPVHGNGAWLVQGSMARPDWHWANGQQASKAYVVTLGYRQDLSARTSLYAYGGYMKGYDPEDPFASDVGRATRFGVGMTQRF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP014013_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP014013_6

4846793-4846886

Orphan

Consensus_repeat	Method
GTGCCTGTCCCCGCCGGGACAGGCAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP014013_6

>merge|NZ_CP014013|6|4846793-4846886|CRISPRCasFinder
GTGCCTGTCCCCGCCGGGACAGGCACCCGGGCCCAGGAAAACCCCCACGCTGCGCCCGCTGTGCGGGCGTGCCTGTCCCCGCCGGGACAGGCAC

>NZ_CP014013|6|6|4846793-4846886|CRISPRCasFinder
GTGCCTGTCCCCGCCGGGACAGGCAC	CCGGGCCCAGGAAAACCCCCACGCTGCGCCCGCTGTGCGGGC
GTGCCTGTCCCCGCCGGGACAGGCAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP014013.1\|WP_003814699.1\|4844438_4846562_-\|elongation-factor-G	unknown	unknown	gnl\|CDD\|234569
NZ_CP014013.1\|WP_162835034.1\|4852603_4853605_-\|ChbG/HpnK-family-deacetylase	unknown	unknown	gnl\|CDD\|212118
NZ_CP014013.1\|WP_010927083.1\|4837527_4838700_-\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|173841
NZ_CP014013.1\|WP_003814676.1\|4836472_4837501_-\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|366103
NZ_CP014013.1\|WP_010927086.1\|4853894_4855514_-\|glycosyltransferase-family-39-protein	unknown	unknown	gnl\|CDD\|224720
NZ_CP014013.1\|WP_010927084.1\|4839813_4840785_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270234
NZ_CP014013.1\|WP_003814689.1\|4840851_4841637_-\|crotonase/enoyl-CoA-hydratase-family-protein	unknown	unknown	gnl\|CDD\|181723
NZ_CP014013.1\|WP_010927085.1\|4850475_4851135_+\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
NZ_CP014013.1\|WP_003814701.1\|4846972_4847443_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
NZ_CP014013.1\|WP_003814694.1\|4843057_4843813_-\|TerC-family-protein	unknown	unknown	gnl\|CDD\|223930
NZ_CP014013.1\|WP_003814706.1\|4849564_4850479_+\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|223769
NZ_CP014013.1\|WP_003814711.1\|4852151_4852607_-\|multidrug/biocide-efflux-PACE-transporter	unknown	unknown	gnl\|CDD\|226610
NZ_CP014013.1\|WP_003814697.1\|4843923_4844442_+\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NZ_CP014013.1\|WP_033446464.1\|4847975_4849421_-\|PLP-dependent-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|224089
NZ_CP014013.1\|WP_003820700.1\|4847531_4847876_-\|TIGR01244-family-phosphatase	unknown	unknown	gnl\|CDD\|225984
NZ_CP014013.1\|WP_003814709.1\|4851222_4852146_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|378820
NZ_CP014013.1\|WP_003814691.1\|4841629_4842862_-\|CoA-transferase	unknown	unknown	gnl\|CDD\|367110
NZ_CP014013.1\|WP_042962164.1\|4853539_4853935_+\|GtrA-family-protein	unknown	unknown	gnl\|CDD\|377229
NZ_CP014013.1\|WP_010927082.1\|4835213_4836407_-\|acetyl-CoA-C-acyltransferase	unknown	unknown	gnl\|CDD\|180775
NZ_CP014013.1\|WP_003814681.1\|4838825_4839803_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176106

Protein	Function_ID	Function_description	E-value
NZ_CP014013.1\|WP_003814699.1\|4844438_4846562_-\|elongation-factor-G	gnl\|CDD\|234569	PRK00007, PRK00007, elongation factor G; Reviewed.	0
NZ_CP014013.1\|WP_162835034.1\|4852603_4853605_-\|ChbG/HpnK-family-deacetylase	gnl\|CDD\|212118	cd10807, YdjC_like_3, uncharacterized YdjC-like family proteins from bacteria. This subfamily contains many hypothetical proteins, and belongs to the YdjC-like family of uncharacterized proteins from bacteria. The YdjC-family is represented by an uncharacterised protein YdjC (also known as ChbG) encoded by the chb (N,N'-diacetylchitobiose, also called [GlcNAc]2) or cel operon in Escherichia coli, which encodes enzymes involved in growth on an N,N'-diacetylchitobiose carbon source. The molecular function of this subfamily is unclear.	1.99725e-92
NZ_CP014013.1\|WP_010927083.1\|4837527_4838700_-\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|173841	cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26. Putative acyl-CoA dehydrogenases (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha, beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	3.6654e-83
NZ_CP014013.1\|WP_003814676.1\|4836472_4837501_-\|acyl-CoA-dehydrogenase	gnl\|CDD\|366103	pfam00441, Acyl-CoA_dh_1, Acyl-CoA dehydrogenase, C-terminal domain. C-terminal domain of Acyl-CoA dehydrogenase is an all-alpha, four helical up-and-down bundle.	1.19321e-12
NZ_CP014013.1\|WP_010927086.1\|4853894_4855514_-\|glycosyltransferase-family-39-protein	gnl\|CDD\|224720	COG1807, ArnT, 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane].	1.9702e-50
NZ_CP014013.1\|WP_010927084.1\|4839813_4840785_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270234	cd07012, PBP2_Bug_TTT, Bug (Bordetella uptake gene) protein family of periplasmic solute-binding receptors; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) proteins present in a number of bacterial species, but mainly in proteobacteria. In eubacteria, at least three families of periplasmic binding-protein dependent transporters are known: the ATP-binding cassette (ABC) transporters, the tripartite ATP-independent periplasmic transporters, and the tripartite tricarboxylate transporters (TTT). Bug proteins are the PBP components of the TTT. Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	2.41957e-116
NZ_CP014013.1\|WP_003814689.1\|4840851_4841637_-\|crotonase/enoyl-CoA-hydratase-family-protein	gnl\|CDD\|181723	PRK09245, PRK09245, crotonase/enoyl-CoA hydratase family protein.	2.06175e-156
NZ_CP014013.1\|WP_010927085.1\|4850475_4851135_+\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	4.25651e-32
NZ_CP014013.1\|WP_003814701.1\|4846972_4847443_-\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	9.38587e-30
NZ_CP014013.1\|WP_003814694.1\|4843057_4843813_-\|TerC-family-protein	gnl\|CDD\|223930	COG0861, TerC, Membrane protein TerC, possibly involved in tellurium resistance [Inorganic ion transport and metabolism].	1.14565e-78
NZ_CP014013.1\|WP_003814706.1\|4849564_4850479_+\|DMT-family-transporter	gnl\|CDD\|223769	COG0697, RhaT, Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only].	8.05606e-10
NZ_CP014013.1\|WP_003814711.1\|4852151_4852607_-\|multidrug/biocide-efflux-PACE-transporter	gnl\|CDD\|226610	COG4125, COG4125, Predicted membrane protein [Function unknown].	2.35069e-54
NZ_CP014013.1\|WP_003814697.1\|4843923_4844442_+\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	1.52093e-44
NZ_CP014013.1\|WP_033446464.1\|4847975_4849421_-\|PLP-dependent-aminotransferase-family-protein	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	6.70342e-111
NZ_CP014013.1\|WP_003820700.1\|4847531_4847876_-\|TIGR01244-family-phosphatase	gnl\|CDD\|225984	COG3453, COG3453, Uncharacterized protein conserved in bacteria [Function unknown].	3.40043e-35
NZ_CP014013.1\|WP_003814709.1\|4851222_4852146_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|378820	pfam12146, Hydrolase_4, Serine aminopeptidase, S33. This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length. It is found in association with pfam00561. The majority of the members in this family carry the exopeptidase active-site residues of Ser-122, Asp-239 and His-269 as in UniProtKB:Q7ZWC2.	2.97616e-21
NZ_CP014013.1\|WP_003814691.1\|4841629_4842862_-\|CoA-transferase	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	8.36236e-118
NZ_CP014013.1\|WP_042962164.1\|4853539_4853935_+\|GtrA-family-protein	gnl\|CDD\|377229	pfam04138, GtrA, GtrA-like protein. Members of this family are predicted to be integral membrane proteins with three or four transmembrane spans. They are involved in the synthesis of cell surface polysaccharides. The GtrA family are a subset of this family. GtrA is predicted to be an integral membrane protein with 4 transmembrane spans. It is involved is in O antigen modification by Shigella flexneri bacteriophage X (SfX), but does not determine the specificity of glucosylation. Its function remains unknown, but it may play a role in translocation of undecaprenyl phosphate linked glucose (UndP-Glc) across the cytoplasmic membrane. Another member of this family is a DTDP-glucose-4-keto-6-deoxy-D-glucose reductase, which catalyzes the conversion of dTDP-4-keto-6-deoxy-D-glucose to dTDP-D-fucose, which is involved in the biosynthesis of the serotype-specific polysaccharide antigen of Actinobacillus actinomycetemcomitans Y4 (serotype b). This family also includes the teichoic acid glycosylation protein, GtcA, which is a serotype-specific protein in some Listeria innocua and monocytogenes strains. Its exact function is not known, but it is essential for decoration of cell wall teichoic acids with glucose and galactose.	8.84202e-15
NZ_CP014013.1\|WP_010927082.1\|4835213_4836407_-\|acetyl-CoA-C-acyltransferase	gnl\|CDD\|180775	PRK06954, PRK06954, acetyl-CoA C-acetyltransferase.	1.95135e-174
NZ_CP014013.1\|WP_003814681.1\|4838825_4839803_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176106	cd08414, PBP2_LTTR_aromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LTTRs involved in degradation of aromatic compounds, such as CbnR, BenM, CatM, ClcR and TfdR, as well as that of other transcriptional regulators clustered together in phylogenetic trees, including XapR, HcaR, MprR, IlvR, BudR, AlsR, LysR, and OccR. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the substrate-binding domains from ionotropic glutamate receptors, LysR-like transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	2.33368e-60

>NZ_CP014013.1|WP_003814699.1|4844438_4846562_-|elongation-factor-G
MTRRTSIERYRNIGISAHIDAGKTTTTERILFYTGITHKLGEVHEGAATMDWMEQEQERGITITSAATTAFWRGMAGNYPEHRINIIDTPGHVDFTIEVERSMRVLDGACMVYDSVGGVQPQSETVWRQANKYGVPRIAFVNKMDRVGADFFRVQRQIVERLKGDAVPIQIPVGAEDHFEGVVDLVKMKAIIWDDASQGVRFEYRDIPPELQAQAEQWREKMIEKAAEANEALLEKYLSGQPLSEDEIKSGLRARTVANEIVPMLCGSAFKNKGVQAMLDAVIDYLPSPADVPAIIGHDERDREIERHPADDEPFSALAFKIMTDPFVGQLVFFRVYSGVVKSGDSVLNPLKSKKERLGRILQMHANERREISEVYAGDIAAAVGIKEITTGDTLTDPAHVIILERMTFPEPVISQAVEPRTKADQEKMGIALNRLAQEDPSFRVRTDEESGQTIISGMGELHLEILVDRMKREFGVEANVGKPQVAYRETIRSTVTDVEGKFVKQSGGRGQYGHVVLKLEPQEQGKGYEFVDAIKGGVVPREFIPAVDRGVRETLNTGVLAGYPVVDVKVTLVFGSYHDVDSNENAFRMAASMAFKEGMRRAKPVLLEPMMHVEVETPEDFTGNVMGDLSSRRGMVQGMEDIAGGGGKLVRAEVPLAEMFGYSTSLRSLTQGRATYSMEFKHYAEAPRQVAEQIIAARGSGAAARG
>NZ_CP014013.1|WP_003814697.1|4843923_4844442_+|MgtC/SapB-family-protein
MDTVWMEIWTTVRNEFADIPDVAEATRIVLRLGMAVALGGLLGYERERSGKAAGLRTHMLVALGAALFVLVPLQGGMEVGDLSRVLQGVIAGIGFLGAGAIIKLGNEGEIRGLTTSAGIWLTAAIGVAAGMGREATALASTLIALFVLAALRRLEKRIAARDDKRVVAQPPP
>NZ_CP014013.1|WP_003814694.1|4843057_4843813_-|TerC-family-protein
MDYLVSLAQQPAAWAALATLIAMEVVLGIDNLIFISILTNKLPPQHQTKARRIGIGMALILRLALLGTVAFIVQLTQPVFELFGHGFSWRDVILVAGGLFLVWKATKEIHHHVDPNPGDDMFGGKAATLGFAAAVAQILMLDLVFSIDSIITAVGMTEHIPIMFVAVIVAVAVMLLAAEPLARFIERNPTVVMLALAFLMMIGMTLIAEGFGAHVPKGYIYAAMAFSALVEGLNMMARRAREGRGAGAAGG
>NZ_CP014013.1|WP_003814691.1|4841629_4842862_-|CoA-transferase
MSGPLEGVRILDVTTVLMGPYATQILGDLGADVIKVEPPAGDNVRGIGPGRHADMGGIFLHANRSKRSIALDLKNPAGREALLKVAATCDVLVYNVRPQAMARLGLSYAEVAQANPSILYVGMYGYDQRGPYAARAAYDDLIQGAVGIPSLSVEAGSDIPRYAPSAMVDRIVGISAANAVTAGLYHRARTGQGQAIDVPMFETMAHLILGDHMMGQTFEPPLGPPGYPRILNADRRPYATRNGHICVLLYADKHWKAFFELIGQPGRDAADPRFRDIGTRTQHIHAIYRLVSDAIASRTTEEWLAAFEAADIPAMPVHTMASLLRDPHLEAIGFFGMVDHPSEGAVRMMAVPSRWSGTPPQPRGHAPRLGEHSVDVLKEAGYDDEAIAALVRNGAAIAAARQLPEGTDHD
>NZ_CP014013.1|WP_003814689.1|4840851_4841637_-|crotonase/enoyl-CoA-hydratase-family-protein
MTDFLRHERHGGVLLLTMDRERTRNALSDADAVEALVQACARIGADLSVRAVVLTGSHGVFSSGGNLKTLSDTVGAGLGEPVHSRQAYRSGIQRIPLALYNLEVPTIAAVNGPAIGAGCDLACMCDIRLAARQASFAESFVKLGLTPGDGGAWLLPRIVGMSRACELAFTGRSIDAARARELGLVSEVFDADALLPAALALAQEIAQHSGHALRLTKRLLREGQHTRLDTLLELSAGFQALAHHTQEHAGALDAHLSRKRG
>NZ_CP014013.1|WP_010927084.1|4839813_4840785_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MHSRTLALALLSVAALAQGGSARAASDYPAHPVKIIVSLPPGSGADTTARFLSKHLAERFKRPFVVENRPGGNSFIAAQAVATAPPDGYTLFVASNSPMTTNAAVFKNLPYDAVKDFAPVAPIARFPMALVVPANSPYRSVADLVAAARAAPGQLNFASGTATYQVVLELFHEQNGIKATHVPYKGTSAALADVAGGVVQYSVADVSAALPLIRGGKLRPLAVTSTRRIKDLPDVPTMQESGNKGFEAYAWTAAFFPAKVDPAIVARVSDAVQALVRSQEGKAFMEQLGGEPFVGGPDTLAAFQRDELASMRRIAKLANIQQE
>NZ_CP014013.1|WP_003814681.1|4838825_4839803_+|LysR-family-transcriptional-regulator
MWTGQYIVHIASPAHHWRRAVELRQLKQLLVLSETLNFHRAAERLHMAQPPLSTAIKKLEQELGVQLFERLPAGLQPTPAAEVVLRYARATLFYADEIQRAAQEGASGKQGMLKVGFVGSSIYSLMPQLLSAFRKDYPRVDLVIEESTTVDLLRRLDAHTLDVALVRFPVLEPSTARITLLQADHLMLAVPAGSRYAQRDDVALDELADEPFIGYSRTHVPGMHALIMYAFQQYGVVPHIAQEAIQVQTILSLVESGLGLAIVPKVACRQAGSGVRLVNVPQLAETIKVGIALAVHPDNATPTTANFVDMACRLMQTEPAAGQAR
>NZ_CP014013.1|WP_010927083.1|4837527_4838700_-|acyl-CoA-dehydrogenase-family-protein
MGAILGTIIEALQLAAIPAHDEALRPAVRAFLDEALREMPADRRARSWMGHDAEFSRALARQGWLGLTLPVEYGGAGRSNFARFVLSEELLAVGAPVSAHWIADRQTAPLILRFGSPAQRAFYLPRIIRGEAFFAIGMSEPDTGSDLASVRTRATPVADGWLLNGRKIWTTNAHRSHYMCALVRTSGAPEDRHRGLSQMIFDLALPGIEIRPIRDIAGDAHFCEVLFDNVLLPHDALVGEEGSGWRQVMAELALERSGPERIYSSMVLLDGWLAHLRRDAAPQRAQVCLAGRLAARLAVLRSMSLAVSQRLEQGADASLAAVLVKDLGTEFEQAVPELIGQALHASPQPAPDDVLMRTLAYLTLINPTFSLRGGTRHILRGIIARELGLR
>NZ_CP014013.1|WP_003814676.1|4836472_4837501_-|acyl-CoA-dehydrogenase
MVSTMQQDLYETFARALAGLCPLERVRELEAAADPRAGAARAWNEVDALGYGDALSPAEHGGAGLSLADAEGLLRAAGAMALPFPFADTLLARALLRAAGQAVPDGPIALGVALPHGAGWRCAPIAGVALAQAVAVEHDGCLALWPAPDAVQPGLFRPRASGAPAWRGTPAQAGRAGAPAGAVQAWRNAADAAGMAGAMQAVLDRCVAYVQERQQFGRALGRFQAVQQDISMLAEQVAAVAMAARLACASGALFPDPALAACARLRACEAVPVVCALAHAVHGAIGITEELPLGLYTARLHEWRATGMSEDDCAELLGRRVLADGERTLLDVVRGMVSAAHA
>NZ_CP014013.1|WP_010927082.1|4835213_4836407_-|acetyl-CoA-C-acyltransferase
MSVHPDPVVIVAARRTPIGAFQGALAHYSAPQLGAHALAAAVRQAGLQPDAAQEALMGCCLFAGLGQAPARQAVLGAGLPTDVQATTLSKMCGSGMKAAMLAHDMLRAGSADVVLAGGMESMSNAPHLIPKARQGYRLGDGQLLDHMYRDGLQDAYEGRLMGHYADLAAREYGFSREQQDAYAHESVLRAQRSVAEGEFAEEIAPIAGLARRGAPAAMVAVDETPGLCDVSRLASLKPVFNADGTVTAGNASSISDGAAALVLTRQAHAERLGLAPQAHIVGHATAALPPGQFPAAPVRAIARLFERVGWDRDSVDLFEINEAFAVVTMIALRELGLPAERVNVNGGACALGHPVGATGARLIVTLMHALRRRGLRRGVACLCLGGGEATAIAIERA
>NZ_CP014013.1|WP_003814701.1|4846972_4847443_-|universal-stress-protein
MFKKILIPTDGSPLSAQAANAGICFARSTGAEVVALHVTQPFAATIGFDGMAAAYAITDEDYEKASAEQAEKYLKLILDRAETAGVKAESRAVSNFNVADGIVQAAGEAGCDLIFIGSHGRSGLSRLLLGSVTAKVLSLAHTAVLVYRVKEDKDKK
>NZ_CP014013.1|WP_003820700.1|4847531_4847876_-|TIGR01244-family-phosphatase
MSAAIKPLTENFAVAPQLGPADMADVAAAGYKSVIINRPDFEGGPDQPTAADVSQAAQALGLQVEYQPVVGSAMTAADVARFAELLRTMPGPVLAYCRTGTRCTNLFAAAQQLG
>NZ_CP014013.1|WP_033446464.1|4847975_4849421_-|PLP-dependent-aminotransferase-family-protein
MTVATSSPSGAGWQPVRQADATLVTQLADDLARRIDEHGLRPGTRLPSIRRMAEQSGVSRFTVVEAYDRLVARGLVQSRRGAGFFVRARSASLTALASARVPQAAPETPVRVDVSWLLRNMFRETAAGMPGGAGLLPPEWLDPDMVAAAVRAVGRTVRGNLVSYGSPQGYAPLRQQLASMLQADGVPAHPERNLLTTNGVTHGLDIVARHLIKPGDTVLVEDPAWFVIFGRLAAFGARPVGVPRGPDGPDLAMLDRLAAEHKPRLYIINGAVHNPTGHTLSAGAAYDILRLAERHDFMVVEDDTYADLHPGGAMKLAALDRLERVILVGGFSKMLAASLRVGYIAAGAETLQRLTDLKMLAGLTSPELGERVVHRVLVEGQYRRHIERVRARVNEARLRSIQALQQLGLSVPHEPHAGMFVWADCGRDSEPVARNAAERGMLLAPGTLFSPSGAPSTMLRFSVAMVDTPGIWQSIAAVMAQ
>NZ_CP014013.1|WP_003814706.1|4849564_4850479_+|DMT-family-transporter
MSPPSAQASAPSASPHAPSWEGYGYGLIGVLVFALTLPMTRLAVGELSPLLVGLGRALLAAVPAAALLWLTRSRRPDRAEWSGIVLAAVGIVVGWPVASTLAMASVPAAHGAVFNGLLPLSTAVFAAWRSGERPSPAFWSFAVLGAVLVAGYALRQGHGALQPGDLWLLLAVVLGGMGYAEGARASRTLGGWRTICWALVVSVPALLPAVLWLAHDAAWPSLPVAGAFAYLAFGSMFLGFFAWYRGLAIGGIARVGQIQLLQPFLTVVAAALLFNEQVEPITYVFAVAVVLVIAGGRRAMVRKA
>NZ_CP014013.1|WP_010927085.1|4850475_4851135_+|LysE-family-translocator
MIGSDLSSLDQAPLASLSVLMPLVLFTLVNSLTPGPNNVMLASSGLTFGFRRTIPHLLGISVGFSIMLLMVGLGLGATLERLPWLYSTLKYGGAAYLLYLAWKIATSGPMESGAERGKPLTFIQAALFQWVNPKAWVMIVSVVATYTPQHGYFANLIIATLVCGVVNLPSVGVWAAFGMALRRWLHRPAAVRAFNVGMAVLLVVSLYPVGLDLLALYTG
>NZ_CP014013.1|WP_003814709.1|4851222_4852146_+|alpha/beta-fold-hydrolase
MVSLPFRLSWRRMAAVLLLAAGALGFNQLDAWQRQAIFSPQTDQQRWWREPPAGTEVFDLALPNGDKVHAWYWQSPRRDAPTVLYLHGARWNLNGSAFRMEGWTRMGYSMLAIDYRGFGQSTPLLPSEQSASQDAAAALQELARRQPDPARRFIYGHSLGGAIAIDLAARPDLPPFAGLIVESSFTSIGAMLGTMKWGWVPGATLLVTQPFASVDKLAALTTPMLLLHGTADRVVPHTMSDELYRAAQQVPADLKRLVKIEGASHSGAIRSGRIYEDAVADFVRDAGRGYAGRQGAPTPLTASRPGT
>NZ_CP014013.1|WP_003814711.1|4852151_4852607_-|multidrug/biocide-efflux-PACE-transporter
MSSSSKQTPKTIKERFLHAFFFEIIAIGLSAPVAAWAMDQPLFDMGVLTAVIAWIALLWNMVYNAGFERLERRFGVVRTMPVRVAHAVGFELGLVLIIVPLAAWWLAISFWEAFMLDIGLLMFYLPYAFFYNLAYDKLRARWWGRIEPAGA
>NZ_CP014013.1|WP_162835034.1|4852603_4853605_-|ChbG/HpnK-family-deacetylase
MGGGRGASDGNEPGNLSQQAAHVEEVSPLRNQAGDVRCRRIAVCGDDFGMNEAIDGALIELAGAGRLSAVSCMPLAPAFAADAPALARLDVDLGVHVDFTEAFAGAAPAAPGLAALLWRAYAGQLDPDWIDARLASQFDAFERAFGRAPDYVDGHQHVHQLPGILPRLRALLKRRYAGQRIWLRHTAPGLQFGLPLAEAAKARLIGALGAGALARAAGQEGWQTNRRMLGVYGFTGGPRRYAGLLHHWLMNARDGDLLMCHPGWPQVHGAAHASQRAAEYEVLAHPELGTWLARNGLRIVRLSQVRGRQASQESGKVRNVPHSGSFRRLASRL
>NZ_CP014013.1|WP_042962164.1|4853539_4853935_+|GtrA-family-protein
MRGLLRQIAWFIAVGCAAAATHWAVAVACVEWAGLPPLGANVVGWLLAFVVSFTGHFRLTFRHLAASWTIAARRFFLVSALGFAINELSYAWLLHATSLPYDVLLALVLIGLAFLTFVASRLWAFRHRHAP
>NZ_CP014013.1|WP_010927086.1|4853894_4855514_-|glycosyltransferase-family-39-protein
MTLATRSMQPHAVSPGQARSWPLPAAGWLLLAVGVWLAFLSWMRPLALPDEGRYAGVAWDMLRNGSFAVPLIDGMPYFHKPPLYYWLAELSFRLFGVNEWAARLPSALAAWASAVALYLFVRRHRDAASATLCVLVLATLPLFFGGAQYANMDMLVAGMITLCVLAGADTALRVRGGQAWRAMALATGVCAALAMLAKGLIGLVLPGAILLAWLAWRRDWRGLRALLWPPAILAFAVVAVPWFWLMQVRYPGFFQYFFVHQHFERFAQTGFNNVQPFWFYLPVIAGLALPWSLWAGGLLRKQFWAADADPDGLRRLALVWLAVIVAFFSMPQSKLVGYIMPVLPPLAFLLAEVVMGALRDPAVARATRRMARVSALVAVAICVTAVFVASFNARGSSRELALSLRGELRPDDTLVALHTYPFDLQLYAHAARPMWVVDDWSNPEIPKRDNWRRELYDAVQFEPALGERLLVSADTFQQRLCQAPEGSRYWVWGTAADEEAYAPLRGQAARFADARRSLWLVLVDEAFKGRVCDGTPTGG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP014013_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP014013_7

5125454-5125537

Orphan

Consensus_repeat	Method
GGTGCCTGTCCCCGCGGGGACAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP014013_7

>merge|NZ_CP014013|7|5125454-5125537|CRISPRCasFinder
GGTGCCTGTCCCCGCGGGGACAGATACCGTCTTGGCCGTCAAGCGTTCTGGCGTATGACGGGGTGCCTGTCCCCGCGGGGACAG

>NZ_CP014013|7|7|5125454-5125537|CRISPRCasFinder
GGTGCCTGTCCCCGCGGGGACAG	ATACCGTCTTGGCCGTCAAGCGTTCTGGCGTATGACGG
GGTGCCTGTCCCCGCGGGGACAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP014013.1\|WP_003815190.1\|5124203_5124947_+\|BON-domain-containing-protein	unknown	unknown	gnl\|CDD\|182907
NZ_CP014013.1\|WP_033446463.1\|5118757_5119372_-\|c-type-cytochrome	unknown	unknown	gnl\|CDD\|225418
NZ_CP014013.1\|WP_003815197.1\|5130631_5131687_+\|Ldh-family-oxidoreductase	unknown	unknown	gnl\|CDD\|376860
NZ_CP014013.1\|WP_003815201.1\|5132845_5134798_-\|penicillin-binding-protein-2	unknown	unknown	gnl\|CDD\|274573
NZ_CP014013.1\|WP_003815194.1\|5127543_5128290_+\|pyrimidine-5'-nucleotidase	unknown	unknown	gnl\|CDD\|319791
NZ_CP014013.1\|WP_003815181.1\|5117460_5118747_-\|cytochrome-c	unknown	unknown	gnl\|CDD\|365823
NZ_CP014013.1\|WP_010927137.1\|5123071_5123605_+\|YraN-family-protein	unknown	unknown	gnl\|CDD\|173148
NZ_CP014013.1\|WP_033446211.1\|5123613_5124207_+\|phosphoheptose-isomerase	unknown	unknown	gnl\|CDD\|237567
NZ_CP014013.1\|WP_003815185.1\|5121497_5122070_-\|methylated-DNA--[protein]-cysteine-S-methyltransferase	unknown	unknown	gnl\|CDD\|223427
NZ_CP014013.1\|WP_003815183.1\|5119681_5120554_+\|RNase-adapter-RapZ	unknown	unknown	gnl\|CDD\|235450
NZ_CP014013.1\|WP_003815184.1\|5120550_5121501_+\|septal-ring-lytic-transglycosylase-RlpA-family-protein	unknown	unknown	gnl\|CDD\|223868
NZ_CP014013.1\|WP_003815192.1\|5125591_5126380_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224381
NZ_CP014013.1\|WP_003815191.1\|5124943_5125435_+\|TlpA-family-protein-disulfide-reductase	unknown	unknown	gnl\|CDD\|239264
NZ_CP014013.1\|WP_003815203.1\|5135361_5136246_-\|rod-shape-determining-protein-MreC	unknown	unknown	gnl\|CDD\|237560
NZ_CP014013.1\|WP_003815198.1\|5131712_5132849_-\|rod-shape-determining-protein-RodA	unknown	unknown	gnl\|CDD\|274033
NZ_CP014013.1\|WP_010927138.1\|5128339_5128915_+\|nucleoid-occlusion-factor-SlmA	unknown	unknown	gnl\|CDD\|181894
NZ_CP014013.1\|WP_003815202.1\|5134811_5135375_-\|rod-shape-determining-protein-MreD	unknown	unknown	gnl\|CDD\|274574
NZ_CP014013.1\|WP_003815186.1\|5122066_5123005_-\|16S-rRNA-(cytidine(1402)-2'-O)-methyltransferase	unknown	unknown	gnl\|CDD\|223390
NZ_CP014013.1\|WP_003815193.1\|5126641_5127544_+\|acetylglutamate-kinase	unknown	unknown	gnl\|CDD\|234869
NZ_CP014013.1\|WP_010927139.1\|5129127_5130621_+\|DASS-family-sodium-coupled-anion-symporter	unknown	unknown	gnl\|CDD\|279307

Protein	Function_ID	Function_description	E-value
NZ_CP014013.1\|WP_003815190.1\|5124203_5124947_+\|BON-domain-containing-protein	gnl\|CDD\|182907	PRK11023, PRK11023, divisome-associated lipoprotein YraP.	1.20064e-42
NZ_CP014013.1\|WP_033446463.1\|5118757_5119372_-\|c-type-cytochrome	gnl\|CDD\|225418	COG2863, COG2863, Cytochrome c553 [Energy production and conversion].	1.97897e-12
NZ_CP014013.1\|WP_003815197.1\|5130631_5131687_+\|Ldh-family-oxidoreductase	gnl\|CDD\|376860	pfam02615, Ldh_2, Malate/L-lactate dehydrogenase. This family consists of bacterial and archaeal Malate/L-lactate dehydrogenase. L-lactate dehydrogenase, EC:1.1.1.27, catalyzes the reaction (S)-lactate + NAD(+) <=> pyruvate + NADH. Malate dehydrogenase, EC:1.1.1.37 and EC:1.1.1.82, catalyzes the reactions: (S)-malate + NAD(+) <=> oxaloacetate + NADH, and (S)-malate + NADP(+) <=> oxaloacetate + NADPH respectively.	1.11307e-125
NZ_CP014013.1\|WP_003815201.1\|5132845_5134798_-\|penicillin-binding-protein-2	gnl\|CDD\|274573	TIGR03423, pbp2_mrdA, penicillin-binding protein 2. Members of this protein family are penicillin-binding protein 2 (PBP-2), a protein whose gene (designated pbpA or mrdA) generally is found next to the gene for RodA, a protein required for rod (bacillus) shape in many bacteria. PBP-2 acts as a transpeptidase for cell elongation (hence, rod-shape). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	0
NZ_CP014013.1\|WP_003815194.1\|5127543_5128290_+\|pyrimidine-5'-nucleotidase	gnl\|CDD\|319791	cd02604, HAD_5NT, haloacid dehalogenase (HAD)-like 5'-nucleotidases similar to Saccharomyces cerevisiae Phm8p and Sdt1p. This family includes Saccharomyces cerevisiae Phm8p (phosphate metabolism protein 8) and Sdt1p (Suppressor of disruption of TFIIS). Phm8p participates in the ribose salvage pathway, it catalyzes the dephosphorylation of nucleotide monophosphates to nucleosides, its preferred substrates are nucleotide monophosphates AMP, GMP, CMP, and UMP. Phm8p is also a lysophosphatidic acid phosphatase, dephosphorylating lysophosphatidic acids (LPAs) to monoacylglycerol in response to phosphate starvation. Sdt1p is a pyrimidine and pyridine-specific 5'-nucleotidase; it is an NMN/NaMN 5'-nucleotidases involved in the production of nicotinamide riboside and nicotinic acid riboside, and is a pyrimidine 5'-nucleotidase with high specificity for UMP and CMP. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	1.14842e-46
NZ_CP014013.1\|WP_003815181.1\|5117460_5118747_-\|cytochrome-c	gnl\|CDD\|365823	pfam00034, Cytochrom_C, Cytochrome c. The Pfam entry does not include all Prosite members. The cytochrome 556 and cytochrome c' families are not included. All these are now in a new clan together. The C-terminus of DUF989, pfam06181, has now been merged into this family.	4.18466e-10
NZ_CP014013.1\|WP_010927137.1\|5123071_5123605_+\|YraN-family-protein	gnl\|CDD\|173148	PRK14685, PRK14685, hypothetical protein; Provisional.	1.2057e-90
NZ_CP014013.1\|WP_033446211.1\|5123613_5124207_+\|phosphoheptose-isomerase	gnl\|CDD\|237567	PRK13936, PRK13936, phosphoheptose isomerase; Provisional.	6.68272e-126
NZ_CP014013.1\|WP_003815185.1\|5121497_5122070_-\|methylated-DNA--[protein]-cysteine-S-methyltransferase	gnl\|CDD\|223427	COG0350, Ada, Methylated DNA-protein cysteine methyltransferase [DNA replication, recombination, and repair].	7.98182e-54
NZ_CP014013.1\|WP_003815183.1\|5119681_5120554_+\|RNase-adapter-RapZ	gnl\|CDD\|235450	PRK05416, PRK05416, RNase adapter RapZ.	1.18739e-149
NZ_CP014013.1\|WP_003815184.1\|5120550_5121501_+\|septal-ring-lytic-transglycosylase-RlpA-family-protein	gnl\|CDD\|223868	COG0797, RlpA, Lipoproteins [Cell envelope biogenesis, outer membrane].	3.79567e-55
NZ_CP014013.1\|WP_003815192.1\|5125591_5126380_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224381	COG1464, NlpA, ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism].	1.17353e-136
NZ_CP014013.1\|WP_003815191.1\|5124943_5125435_+\|TlpA-family-protein-disulfide-reductase	gnl\|CDD\|239264	cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases.	1.58284e-41
NZ_CP014013.1\|WP_003815203.1\|5135361_5136246_-\|rod-shape-determining-protein-MreC	gnl\|CDD\|237560	PRK13922, PRK13922, rod shape-determining protein MreC; Provisional.	9.0892e-90
NZ_CP014013.1\|WP_003815198.1\|5131712_5132849_-\|rod-shape-determining-protein-RodA	gnl\|CDD\|274033	TIGR02210, Rod_shape-determining_protein_RodA, rod shape-determining protein RodA. This protein is a member of the FtsW/RodA/SpoVE family (pfam01098). It is found only in species with rod (or spiral) shapes. In many species, mutation of rodA has been shown to correlate with loss of the normal rod shape. Note that RodA homologs are found, scoring below the cutoffs for this model, in a number of both rod-shaped and coccoid bacteria, including four proteins in Bacillus anthracis, for example. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Cell division].	3.23854e-160
NZ_CP014013.1\|WP_010927138.1\|5128339_5128915_+\|nucleoid-occlusion-factor-SlmA	gnl\|CDD\|181894	PRK09480, slmA, division inhibitor protein; Provisional.	1.59741e-107
NZ_CP014013.1\|WP_003815202.1\|5134811_5135375_-\|rod-shape-determining-protein-MreD	gnl\|CDD\|274574	TIGR03426, shape_MreD, rod shape-determining protein MreD. Members of this protein family are the MreD protein of bacterial cell shape determination. Most rod-shaped bacteria depend on MreB and RodA to achieve either a rod shape or some other non-spherical morphology such as coil or stalk formation. MreD is encoded in an operon with MreB, and often with RodA and PBP-2 as well. It is highly hydrophobic (therefore somewhat low-complexity) and highly divergent, and therefore sometimes tricky to discover by homology, but this model finds most examples. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	7.62373e-19
NZ_CP014013.1\|WP_003815186.1\|5122066_5123005_-\|16S-rRNA-(cytidine(1402)-2'-O)-methyltransferase	gnl\|CDD\|223390	COG0313, COG0313, Predicted methyltransferases [General function prediction only].	9.54075e-109
NZ_CP014013.1\|WP_003815193.1\|5126641_5127544_+\|acetylglutamate-kinase	gnl\|CDD\|234869	PRK00942, PRK00942, acetylglutamate kinase; Provisional.	1.71108e-158
NZ_CP014013.1\|WP_010927139.1\|5129127_5130621_+\|DASS-family-sodium-coupled-anion-symporter	gnl\|CDD\|279307	pfam00939, Na_sulph_symp, Sodium:sulfate symporter transmembrane region. There are also some members in this family that do not match the Prosite motif, and belong to the subfamily SODIT1.	5.11287e-116

>NZ_CP014013.1|WP_003815191.1|5124943_5125435_+|TlpA-family-protein-disulfide-reductase
MKKIALVLIIAVAAGIGGWFMWRPAQTAPDVAFTTLEGQKITMQDLRGKVVLVKFWATSCVTCVKQMPDNIANYNQYHPQGYETIAVAMNYDPPNYVLNFAQTRKLPFPVALDTSGELAQAFGNVRLTPTAFLIDKQGQIIKRYLGEYDKAEFQATVQKALAG
>NZ_CP014013.1|WP_003815190.1|5124203_5124947_+|BON-domain-containing-protein
MMPDAKTAARPLLLAAALSAAALTLSACAPLVIGGAAATTAVVVTDRRTSGVQLEDQNIAFKAESQIAQKLGNTARVNAMVYGGHVLLTGDAPTEEAKAQATAIAQSIENVKAVTNQLTVGPAADFSTRSNDTWLTSKVKTALINTKYVPSGTISVTTSRGVVYLMGKVTQAEGDYAANAAAGVGGVARVVKLFETISREEAIRLSGSGTKSGEGSSDGTAAQKAPIESGAAPAGSGSNGVEAIPIK
>NZ_CP014013.1|WP_033446211.1|5123613_5124207_+|phosphoheptose-isomerase
MDMTSRMTSHFRDAMALCEQSADALAAPLAAAVDLLFAALANNGRILACGNGGSAADAQHFIAELVGRFERERLPLAGIALNTDTSIMTAVGNDYGFDEIFERQVHALGQPGDVLVAISTSGNSPNVVRAMETAREREMHVIALTGKGGGVMGELITPHDVHLCVPHDRTMRIQEVHIILLHALCDGIDALLLGDTE
>NZ_CP014013.1|WP_010927137.1|5123071_5123605_+|YraN-family-protein
MTDTATRLAFARAAQAQRRLHRRPPASPRARPGARDGGSPTQRRGQAYESAALRWLARQGLRPLARNLRCRAGEIDLAMRDGEVLVLVEVRVRAHAGYGGAAASIGASKQGRLARAAALLLPVLLRRHWPGAPPPVRFDVVAFEAGRPHWLRGAFWLAEHAPAQGRRGQDAQGWRVR
>NZ_CP014013.1|WP_003815186.1|5122066_5123005_-|16S-rRNA-(cytidine(1402)-2'-O)-methyltransferase
MNQDVLSPAPGDAWSRVADRVAAQHWPAATLYVIATPIGNLGDLGLRAWQALVRADVIAAEDTRASRTLLDAWGVSTPLMAAHRHNEASAAQAICERLAQGQRVALVSDAGAPAVSDPGARIVRAVREAGYAVVPVPGPSAVIAALMGSGATSDENPAFAFAGFPPAKAVARQRWLRQWCALPAPVVMFESPHRLAATLADLREAGGPARLLTVARELTKRFEEIATMPLGEAADWLAADAHRGQGEFVLIVHQAPGAQDDEADPADPRTDALLDALLESLSVRDAARVAAKVTGLARDVLYARALARKEQP
>NZ_CP014013.1|WP_003815185.1|5121497_5122070_-|methylated-DNA--[protein]-cysteine-S-methyltransferase
MNPPSEQATDILYCDTDTPLGPMRLAARGQALCGAWFVDQRDCPAAAGWTPDAAHPALRQAAAELEQWFAGRRRAFEVDMQPEGTPFQRQVWQALLELPFGATISYGELARRVGRPKAARAVAGAVGRNPISILIPCHRIIGHDTSLTGFGGGLPRKQALLAHEGHRYLSRAARARRVSTTQMELPFGAA
>NZ_CP014013.1|WP_003815184.1|5120550_5121501_+|septal-ring-lytic-transglycosylase-RlpA-family-protein
MIRSRPLALLSTLLLALAIAGCSTPGKKRGGYYKDDGPDANPPSNLDNVPDATPRLEPLASGPNRPYVVFGKRYVPDTSERPFRQQGLASWYGKKFHGNSTSNGESYDMYAMTAAHPTMPIPSYARVTSKINGRTVIVRVNDRGPFHSDRIMDLSYVAAHKLGIIGPGSGPVTVERILPAEILAMNGGAAAPRPGPASATGPLPVAAPSAAAAVELHPATQLASNAPTPPRPATGAGSGIYLQLGAFSQPANAESLVSRINGQLDPASGIPPAVVEQANNLYRVRIGPYATREAALGAVQPVADRTGILPSLSATP
>NZ_CP014013.1|WP_003815183.1|5119681_5120554_+|RNase-adapter-RapZ
MLRVVLITGISGSGKSVALRLLEDAGFTCIDNLPVRFLAEFIANARDDAMERVAVAIDVRSPGELAELPDVITASRAMGTSLSVIFLDANTDTLVQRYSESRRRHPLTDRLARGGKTPSLAECIALERELMAPLRDQEHVIDTSDLTPGQLRAWIRDLIQADRPPLVLTFESFAYKRGVPSDADLMFDVRCLPNPYYDRTLRPLTGRDEPVATWLGGFDIVTQMIDDIAAFIRRWLPQYTQDTRNYLTVAIGCTGGQHRSVYVVEQLARRFSDHDPLLVRHRTQLPDDPA
>NZ_CP014013.1|WP_033446463.1|5118757_5119372_-|c-type-cytochrome
MAARVAACTACHGEQGRAGPDGYYPRLAGKPQDYLYHQLLNFRDARRQYPPMAHLLNGLPDAYLREMAAYFAGQDVPYPPPARVEASAALVERGRLLVREGDPARAIPSCASCHGASLAGVAPAIPGLLGLPRDYLVAQIGSWQNGLRRAAEPDCMAQVSLKLTPEDIGAVSAWLAGQPVGHPYTPQPAGSLTLPLECGSQAGH
>NZ_CP014013.1|WP_003815181.1|5117460_5118747_-|cytochrome-c
MKIIKRVLVVAILALLAAVATLYWLGTRDHVPAGPQAAPATGSADELVEQGRYLARAGNCMACHTARGGQAYAGGTPIPTPFGTLYGPNITPDAETGIGGWSADDFWQALHNGKGPGGRLLYPAFPYTEYTRMTRADADALYAFLRTVEPVRQASRPHELASPYDQRLLLAAWRALYFEPGGPQADPGQSLQWNRGRYLTEGLGHCAACHTPRNSLGATRAAEALGGGMIDGLGWYAPPLTGQPGTGLGDWSAQDIAALLTTGIAPHSTVAGPMAEVVLGSTQYLSGDDALAIGTYLKSLPAAAPPPARRGAPSATVMELGGKLYGQHCAQCHQADGKGSFPAWPALAGNPSVIAAEPANVIRMVLDGGFAPATAANPRPHGMPPFAQALPDNDIAMLVSYVRNSWGNQAGAVTPLDVKRTRESGAGR
>NZ_CP014013.1|WP_003815192.1|5125591_5126380_-|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein
MRMNFVRSALLASAFLLAGGAAQAEKLVVGATQVPHAEILEVVKPALAKEGVELDIKVFTDYVQPNLQLADKQLDANFFQHQPYLDTFNKDRKTNLVSVGLVHVEPFGGYSKKIKSLAELKDGATIAIPNDPSNSGRALLLLQKQGLLKLKDPSNIVATPIDIAENPKKLKFRELEAAMLPRSLDDLDLALINTNYALEAGLVPTRDALFIEGADSPYANLVAARPDNKDAPAVKKLVNALHSEAVRKFIIEKYKGAVVPAF
>NZ_CP014013.1|WP_003815193.1|5126641_5127544_+|acetylglutamate-kinase
MTDTPDPAAVLSPAVKAAVLSEALPYIRRFHGKTIVVKYGGNAMTEERLQRSFAHDVVLLKLVGLNPVVVHGGGPQIDDALRRIGKQGTFVQGMRVTDAETMEVVEWVLGGQVQQDIVMMINEVGGKAVGLTGKDGMLIQATKKLMVNKDDPSQPLDIGFVGDITRVEPAVVKALQDDQFIPVISPIGYGEDGTAYNINADVVAGKMAEVLGAEKLLMMTNTPGVLDKGGKLLRSLSAQTIDELFADGTISGGMLPKISSSLDAAKNGVNSVHIVDGRVPHCLLLEILTDQGVGTMISSH
>NZ_CP014013.1|WP_003815194.1|5127543_5128290_+|pyrimidine-5'-nucleotidase
MQARRYLLRPAARLRRSRRIATAAPERLWLFDLDNTLHDTSHAIFPLIDRGMTEAVAETLAVDEATANRLRAEYWRRYGATVIGLVRHHGVDADAFLHRSHNFEVAPLVRAETALADKLRRLPGRKVLLTNAPLHYARAVLRHLGLLRQFDSIWAIEQMRMHGQFRPKPSDALLRYVLAREGVPAARAVLIEDTLDNLRSARRVGLRTVHVFHPGTPFARGHRQRPGYVDLRVNSVSDLLLRRRPLRG
>NZ_CP014013.1|WP_010927138.1|5128339_5128915_+|nucleoid-occlusion-factor-SlmA
MASKPGERKTQILHTLAEMLEQPHAARITTSALAARMQVSEAALYRHFASKAQMFEGLIEFIETSIFTVVNQIAVSEPYGMGQARKTVAMLLAFAERNRGITRVLTGDALVTEDNRLQERINHINDRIEASLKQCLRVAVSDGALPADANIAAHASLLTHLVLGRWLRYAQSGWRVAPTTHLEEHLRLALG
>NZ_CP014013.1|WP_010927139.1|5129127_5130621_+|DASS-family-sodium-coupled-anion-symporter
MTAPAAVPAPQSPPKVKIPIGLIAGIIAMVVVLLLPLPAELPPAGHRMLAILAFAVVVWITEAVSYEASAIMITTLMAFLLGTAPNVKNPDVLYGTSAAISMALTGFSNSALALVTGALFIAAAMTFTGLDKRIALVTLARVGTSTRRILLGAIAVTIVLSLVVPSATARSAAVVPIMLGVIAAFGVDKRSNIAAGIMIIVAQATSIWNVGIQTAAAQNLLTVGFMDKMLGERVAWSDWLIAGVPWSLLMSAVLIFVVLRLLPPESDAIAGGKEAVEASLRELGPMTSAQKRLMLVSIMLLLFWSTEGKLHKFDTTSTTYFGLVLLMLPRFGVMTWKDVQTRIPWGTVIVFGVGISLGTALLTTQAGQWLGAQVVTHTGLDHLGPLGIFAILSAFLILIHLGFASATALTSAMLPILIAVLQTLPGDFNRLGMTMLLGFVVSYGFILPINAPQNMVALGTETFTAKQFAKVGIVLTIVGYLLMLLMSVTYWRWLGWM
>NZ_CP014013.1|WP_003815197.1|5130631_5131687_+|Ldh-family-oxidoreductase
MKLSIAQAIAFGQRLLAAQGVPDDIARDVAEHLVESDRVGYTSHGLSILPNYRRVLAEGFVKADGRARLLNDRGAMLAFDGDNGFGQHVGKAVMQQAIERARQYGQCIVTLRRTHHLGRMGYYGEMAAEAGLILLAFTNVVNRPPTVAPYGGAQACLTTNPLCFAGPLPGGRPPFLVDMATSSIAVNKARVLAARGEPAPDGALIDAQGNPTNDPNALFADPPGALLPFGGHKGYAMGLVAELLAGVLSGGGTIQPEHPRNGVATNNMFAILLDPQVDFNADWRTQEVGAFIDYLHACPPQPGVDRVQYPGEYEAMNRARHAEAIEFEGAIWDSLAKLAQDLGAADALPRA
>NZ_CP014013.1|WP_003815198.1|5131712_5132849_-|rod-shape-determining-protein-RodA
MKRLGLILLRVFTAFDWPLLLILILFTLLGLTVMHSAVGSTDWRFAEQSRNFLIAFAAMWAMALVPPNTLMKLALPFYVLGVILLLGVEFFGETSKGATRWLNLGVTRIQPSEMMKIAVPMMLAWYFQRHDGAVRIRDFFVAAAMLAAPFVLIVLQPDLGTALLVFGAGFFVIYFAGLSFKLLVPCLLAGIIAIGTLIYYEDQLCEPEVDWVVLHDYQKHRVCTLLNPSSDPLGKGFHTIQSMIAVGSGGLYGKGYMQGTQTHLDFIPERTTDFIFAVYAEEFGLYGGVALLVLYGLFMARGLAIASRASSQFGRLLAGAITMMMFIYVFVNVGMVTGILPVVGVPLPFMSYGGTALLTMGIACGILMSISRRRPAPA
>NZ_CP014013.1|WP_003815201.1|5132845_5134798_-|penicillin-binding-protein-2
MFEFKKTGQQQKQRFRLRAWVGGLFALACFGVLAGRFWYLQVDRYEGFSERADRNRIAVVPIPPRRGEILDRNGEVLARNYRTYTLEVVPAQAGNLDQLFDRLARVVYISPSDQRRFKRRVGESSRYASLQLRNNLNDTEAAWFSAHSFEFPGVELRARWVREYPQGEAAAHVVGFIGRIAENDIEELDKAGQLGNYRGTDVIGKKGIEKTWEAALHGRTGLEEVEVTAGGRPMRTLRRIDPVPGSDIMLSIDLELQKLAEQAFEGRRGALVALDPDTGEVLAFVSQPSFDPNLFVDGIDVENWRRLNESPDHPLINRPLYGTYPIGSTYKPFVALAALELGKRRATDRMPDPGYFEFGGQKFRNAGGAAYGMTDMHRAIVVSSDTYFYSLGPEIGVNALHDFSKQFGFGQITGIDLEGEKAGVLPSTEWKRKAYKDRDRQRWYAGETISVAVGQGYNSFTLLQLAQATSTLANSGLYRRPHLVHAIRDSRSGSVNPTEIAPDYRIPLKQENVDVIKRAMADVVRAGTARRAFAGAPYQAAGKTGTAQVFSLRGGQYRASAIDERLRDHALFMGFAPVEQPRIAVALIVENAGWGASAAAPIARTLFDNWLGRADAPSVVRAGAKPVAAEPEAAALELGATDGPMQERRQ
>NZ_CP014013.1|WP_003815202.1|5134811_5135375_-|rod-shape-determining-protein-MreD
MERTKVSVPARRKLGTPSNVEPERLARPAHGVFVWGTVLLVWLLSLLPWRQWPGSPDVLVLVIAFWCVHEPRRVGLLTAFVFGLLLDVHDAGLLGGHALSYTLTAYGAIALHRRLQRFDLWSQAMHMLPVFFLAQLVTQIILAWLAGKWPGWQWAVSVGLTVAIWPLAGWVLHMPQRRYDDVESSAV
>NZ_CP014013.1|WP_003815203.1|5135361_5136246_-|rod-shape-determining-protein-MreC
MQRQATPPLFRRGPPAEVRLAVLVILALALLIVDSQLRVLEPVRRAVSVALYPFQRAVMAPRDLVQQVDEWINAASLIRSENEALQRQRIELAQVATHAAQLAAENAQLRRLLGVTDTVAQSAVVVEVLYEPPNAFHQRLVFNKGAKSGLAPGMPVIDEGGVVGQIVRVTPMTAEAALVTDERVSIPVQVLRNGLRLIAFGANTPGVIEVRYLAANADIKVGDTIVTSGVGGLFPAGLPVAKVASVERDTASGFARALGEPLAHPERYRHFLVLQVDVDQAESNRQEADVDGAD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP014013_8

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP014013_8

5208554-5208634

Orphan

Consensus_repeat	Method
GTGCCTGTCCCCGCGGGGACAGGCACCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP014013_8

>merge|NZ_CP014013|8|5208554-5208634|CRISPRCasFinder
GTGCCTGTCCCCGCGGGGACAGGCACCTTGTGCCGGCCCTCCGCAACGCTCGGGTGCCTGTCCCCACGGGGACAGGCACCT

>NZ_CP014013|8|8|5208554-5208634|CRISPRCasFinder
GTGCCTGTCCCCGCGGGGACAGGCACCT	TGTGCCGGCCCTCCGCAACGCTCGG
GTGCCTGTCCCCACGGGGACAGGCACCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP014013.1\|WP_003815348.1\|5219844_5220384_-\|F0F1-ATP-synthase-subunit-delta	unknown	unknown	gnl\|CDD\|235593
NZ_CP014013.1\|WP_033451846.1\|5201517_5202486_+\|succinylglutamate-desuccinylase/aspartoacylase-family-protein	unknown	unknown	gnl\|CDD\|349481
NZ_CP014013.1\|WP_003815337.1\|5213173_5214250_-\|uroporphyrinogen-decarboxylase	unknown	unknown	gnl\|CDD\|234644
NZ_CP014013.1\|WP_003815350.1\|5220396_5220867_-\|F0F1-ATP-synthase-subunit-B	unknown	unknown	gnl\|CDD\|180240
NZ_CP014013.1\|WP_003815318.1\|5199765_5201394_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173863
NZ_CP014013.1\|WP_003815325.1\|5204446_5205430_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223521
NZ_CP014013.1\|WP_003815317.1\|5199232_5199469_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014013.1\|WP_003815344.1\|5217264_5218170_-\|F0F1-ATP-synthase-subunit-gamma	unknown	unknown	gnl\|CDD\|235535
NZ_CP014013.1\|WP_003815316.1\|5198244_5199105_+\|NAD(P)H-hydrate-dehydratase	unknown	unknown	gnl\|CDD\|238576
NZ_CP014013.1\|WP_003815331.1\|5207388_5208522_+\|M20-family-metallopeptidase	unknown	unknown	gnl\|CDD\|349881
NZ_CP014013.1\|WP_003815333.1\|5208652_5210722_-\|UvrD-helicase-domain-containing-protein	unknown	unknown	gnl\|CDD\|130146
NZ_CP014013.1\|WP_003815346.1\|5218268_5219810_-\|F0F1-ATP-synthase-subunit-alpha	unknown	unknown	gnl\|CDD\|236448
NZ_CP014013.1\|WP_003815341.1\|5215389_5215812_-\|F0F1-ATP-synthase-subunit-epsilon	unknown	unknown	gnl\|CDD\|234796
NZ_CP014013.1\|WP_003815327.1\|5205426_5206437_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|226967
NZ_CP014013.1\|WP_003815343.1\|5215821_5217222_-\|F0F1-ATP-synthase-subunit-beta	unknown	unknown	gnl\|CDD\|236447
NZ_CP014013.1\|WP_003815335.1\|5210764_5212867_-\|primosomal-protein-N'	unknown	unknown	gnl\|CDD\|235514
NZ_CP014013.1\|WP_003815329.1\|5206439_5207345_+\|hydrolase	unknown	unknown	gnl\|CDD\|226040
NZ_CP014013.1\|WP_010927150.1\|5214325_5215207_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|185070
NZ_CP014013.1\|WP_003815321.1\|5202544_5203522_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NZ_CP014013.1\|WP_003815324.1\|5203529_5204450_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224094

Protein	Function_ID	Function_description	E-value
NZ_CP014013.1\|WP_003815348.1\|5219844_5220384_-\|F0F1-ATP-synthase-subunit-delta	gnl\|CDD\|235593	PRK05758, PRK05758, F0F1 ATP synthase subunit delta; Validated.	1.16567e-65
NZ_CP014013.1\|WP_033451846.1\|5201517_5202486_+\|succinylglutamate-desuccinylase/aspartoacylase-family-protein	gnl\|CDD\|349481	cd06910, M14_ASTE_ASPA-like, Peptidase M14 Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA)-like; uncharacterized subgroup. A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases. ASTE catalyzes the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway, and aspartoacylase (ASPA, also known as aminoacylase 2, and ACY-2; EC:3.5.1.15) cleaves N-acetyl L-aspartic acid (NAA) into aspartate and acetate. NAA is abundant in the brain, and hydrolysis of NAA by ASPA may help maintain white matter. ASPA is an NAA scavenger in other tissues. Mutations in the gene encoding ASPA cause Canavan disease (CD), a fatal progressive neurodegenerative disorder involving dysmyelination and spongiform degeneration of white matter in children. This enzyme binds zinc which is necessary for activity. Measurement of elevated NAA levels in urine is used in the diagnosis of CD.	2.1253e-80
NZ_CP014013.1\|WP_003815337.1\|5213173_5214250_-\|uroporphyrinogen-decarboxylase	gnl\|CDD\|234644	PRK00115, hemE, uroporphyrinogen decarboxylase; Validated.	0
NZ_CP014013.1\|WP_003815350.1\|5220396_5220867_-\|F0F1-ATP-synthase-subunit-B	gnl\|CDD\|180240	PRK05759, PRK05759, F0F1 ATP synthase subunit B; Validated.	2.79837e-52
NZ_CP014013.1\|WP_003815325.1\|5204446_5205430_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223521	COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.03649e-169
NZ_CP014013.1\|WP_003815318.1\|5199765_5201394_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173863	cd08498, PBP2_NikA_DppA_OppA_like_2, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP014013.1\|WP_003815344.1\|5217264_5218170_-\|F0F1-ATP-synthase-subunit-gamma	gnl\|CDD\|235535	PRK05621, PRK05621, F0F1 ATP synthase subunit gamma; Validated.	1.30561e-149
NZ_CP014013.1\|WP_003815316.1\|5198244_5199105_+\|NAD(P)H-hydrate-dehydratase	gnl\|CDD\|238576	cd01171, YXKO-related, B.subtilis YXKO protein of unknown function and related proteins. Based on the conservation of the ATP binding site, the substrate binding site and the Mg2+binding site and structural homology this group is a member of the ribokinase-like superfamily.	5.19791e-73
NZ_CP014013.1\|WP_003815331.1\|5207388_5208522_+\|M20-family-metallopeptidase	gnl\|CDD\|349881	cd03885, M20_CPDG2, M20 Peptidase Glutamate carboxypeptidase, a periplasmic enzyme. Peptidase M20 family, Glutamate carboxypeptidase (carboxypeptidase G; carboxypeptidase G1; carboxypeptidase G2; CPDG2; CPG2; Folate hydrolase G2; Pteroylmonoglutamic acid hydrolase G2; Glucarpidase; E.C. 3.4.17.11) subfamily. CPDG2 is a periplasmic enzyme that is synthesized with a signal peptide. It is a dimeric zinc-dependent exopeptidase, with two domains, a catalytic domain, which provides the ligands for the two zinc ions in the active site, and a dimerization domain. CPDG2 cleaves the C-terminal glutamate moiety from a wide range of N-acyl groups, including peptidyl, aminoacyl, benzoyl, benzyloxycarbonyl, folyl, and pteroyl groups to release benzoic acid, phenol, and aniline mustards. It is used clinically to treat methotrexate toxicity by hydrolyzing it to inactive and non-toxic metabolites. It is also proposed for use in antibody-directed enzyme prodrug therapy; for example, glutamate can be cleaved from glutamated benzoyl nitrogen mustards, producing nitrogen mustards with effective cytotoxicity against tumor cells.	1.92296e-158
NZ_CP014013.1\|WP_003815333.1\|5208652_5210722_-\|UvrD-helicase-domain-containing-protein	gnl\|CDD\|130146	TIGR01074, ATP-dependent_DNA_helicase_Rep, ATP-dependent DNA helicase Rep. Designed to identify rep members of the uvrD/rep subfamily. [DNA metabolism, DNA replication, recombination, and repair].	0
NZ_CP014013.1\|WP_003815346.1\|5218268_5219810_-\|F0F1-ATP-synthase-subunit-alpha	gnl\|CDD\|236448	PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated.	0
NZ_CP014013.1\|WP_003815341.1\|5215389_5215812_-\|F0F1-ATP-synthase-subunit-epsilon	gnl\|CDD\|234796	PRK00571, atpC, F0F1 ATP synthase subunit epsilon; Validated.	1.40936e-54
NZ_CP014013.1\|WP_003815327.1\|5205426_5206437_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|226967	COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism].	5.08932e-129
NZ_CP014013.1\|WP_003815343.1\|5215821_5217222_-\|F0F1-ATP-synthase-subunit-beta	gnl\|CDD\|236447	PRK09280, PRK09280, F0F1 ATP synthase subunit beta; Validated.	0
NZ_CP014013.1\|WP_003815335.1\|5210764_5212867_-\|primosomal-protein-N'	gnl\|CDD\|235514	PRK05580, PRK05580, primosome assembly protein PriA; Validated.	0
NZ_CP014013.1\|WP_003815329.1\|5206439_5207345_+\|hydrolase	gnl\|CDD\|226040	COG3509, LpqC, Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism].	9.10797e-08
NZ_CP014013.1\|WP_010927150.1\|5214325_5215207_-\|hypothetical-protein	gnl\|CDD\|185070	PRK15115, PRK15115, response regulator GlrR; Provisional.	3.22829e-05
NZ_CP014013.1\|WP_003815321.1\|5202544_5203522_+\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	7.49002e-115
NZ_CP014013.1\|WP_003815324.1\|5203529_5204450_+\|ABC-transporter-permease	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.17965e-94

>NZ_CP014013.1|WP_003815331.1|5207388_5208522_+|M20-family-metallopeptidase
MTTTLPDTDQLVAGIQSWIQCESPSNSPAGVTAMAHLAAEYARAVGLAVEIRPLNAEVGPLVYATNRADGDTRPGVLVLGHLDTVHPIGTLQDNPCRIDGDRLYGPGSYDMKAGIYLALSALRGLPSPHATALPIDFLLVPDEETGSHASREHIEHYAARAKYALVCEPARPNGGKCVTARKGTGMLRLNVKGRPAHAGMQHEKGRSAIREMAHQVLELESMTDYERGITVSVGTIAGGTVTNTVPALCRCVVDFRVPDMGAAEDVLRRMRNLCAVGPDMELDIDVELNRPPMVKTEAATALLQLAQDFAAQAGFALEDAPMTGGGSDANFTSAMGVPTLDGLGADGDGAHTLNEYILVSTLAARMRFWELLLKALH
>NZ_CP014013.1|WP_003815329.1|5206439_5207345_+|hydrolase
MKPADLTNADRIALELGHAGRNAIPYLDDDRNADRPFTLNTYRPYGYTPDRPVVVVQHGVLRNGADYRDFWIPAADRHKLLIVAPTFSDEIWPGVESYNNGRAFTAAGNPRHVDGWTYALVARVLANIRAAEIADCEQVYLFGHSAGGQFVHRLMSSQPHAPFHAVTAANPGWYTLPTFEHRFPEGLDGVGLTEDHLARLLAYPMTILAGDQDIATDDPNLPSEPAALRQGPHRYARARHYYEAGQRAAAQRGLPFGWQLQVVPGIGHDGQAMSQVCASLWFDGRMPDAAELARLAGSQSA
>NZ_CP014013.1|WP_003815327.1|5205426_5206437_+|ATP-binding-cassette-domain-containing-protein
MTTSDLPVIELRDVHKRFEHRPDMAQRLLALTGKPLDRRTVHAVNGVSLSVRRGEVLGLVGESGCGKSTLGRVVAGLHRESAGELLYQGRPAAQLRGADRLAYVLGVQMIFQDPQASLNPRQRLRQILAEALKVHKLAPPAEIPARVDRALAEVGLDREYRERYSHQISGGQRQRIGIARALMVEPRFLVCDEPVAALDVSIQAQVINLFMDLREQRGLTYLFISHDLGVVRHISDRVAIMYLGKIVEQASSAEIFAHPNHPYTQALMAEVPDVGRRGRVFTPIRGEIPSPLDPPPGCTFHPRCPHAMPRCREQAPVLREIAPGHVSACHLNDTAS
>NZ_CP014013.1|WP_003815325.1|5204446_5205430_+|ABC-transporter-ATP-binding-protein
MKDILLDVRGLRTAFHTEAGAWPAVDGVDLVVRRGEIVGLVGESGSGKSVTGFSLLGLIDPPGEVVEGEIRFKGKDLRKLGEEQMRQLRGNRIAMIFQDPLMTLNPVLRIGEQMAEAILTHENVPRAQAMERCREALEMVGIPSPEKRLRSFPHEFSGGMRQRVAIAIAMLNKPDLIICDEPTTALDVTIQGQILYRMQEICRQHDTALIWITHDLGVVAELADRVAVMYAGRIVESGPVDAVLDAPRHPYTRGLLESMPAQTQPGARLRQIDGMAPTLSARPWGCAFRPRCPNAVTRCTEQAPSVTQEGPRSYRCYVPIASETATA
>NZ_CP014013.1|WP_003815324.1|5203529_5204450_+|ABC-transporter-permease
MANPPSNGRTRTVHPLSETPRRAQILKKLHSRPTVRGSVIALLALVALILLAPYFAPQNPYDLASLNLLDGRLPPRSPTMDGGFYWLGTDDQGRDMFSAILYGLRISLLVGLTAVVLATAIGSLVGLLAAYAGGVIDAVLMRIVDFILGFPTILVALVLLAMMGRGVDKVILALVVVQWAHYARIMRGRALQERRKEYVEAAANLGFPAWRIMLFHLLPNCMAPVMVFATIQIANAIVLEATLSFLGVGVPVTEPSLGLLIANGFQYLLSGDYWISLFPGLALLLLILSINIVGDRLRESLDPRRA
>NZ_CP014013.1|WP_003815321.1|5202544_5203522_+|ABC-transporter-permease
MALFILRRLIQSLFVLLAVSVVVFFAVYAVGDPIELLVSPEASADARQAMIARLGLDLPVWQQYGNFLWRALHGDLGNSFVHGIPAISLILQRIPATFELVLVAIVLTCTIGIPLGLVAGLHRDRPLGRGIMATSVLGFSLPNFWQGMMLILLFSVWLGWLPASGRGDTANLFGVPLSILTLDGWSHVIMPAINLAVANVALVLRLTASGVVEAQSQEYVKFARAKGIKPGRIVRRHILRNILIPVVTVIGMEFGHLIAYSTITETVFAWPGMGKLLIDSVYQLDRPVVVAYVMLVTLIFVVINLVVDILYAALDPRVQLVAPAQ
>NZ_CP014013.1|WP_033451846.1|5201517_5202486_+|succinylglutamate-desuccinylase/aspartoacylase-family-protein
MSPPPAVAAVRPFELACPRLDAERVGNGATPGVWHFDAGLPGRHVLLTALIHGNELCGAWALKDALAAGLRPRRGKLTLAFCNLAAFDRFDPLNYAPARFVDEDMNRVWSADKLTAPDTQERRRARALLPWVEQADWLLDFHSMSNADEPLQLTGTQPRNIELALKLGNPAHLVADAGHAAGVRLRDYGRFGAEGENGTRSLLIECGFHGAPASRTVARDILARFLLEAGTLAADDIPPGWLADAAPRQRALRVTHAVAARSADFRFAQPWQGLERIARAGTVIGWSDGEPVATPYDDCVLIMPSLANLRPGVTVVRLAQPI
>NZ_CP014013.1|WP_003815318.1|5199765_5201394_+|ABC-transporter-substrate-binding-protein
MKLRTTLALLATSAGLAAAPGSASAQSLKIALSSEPTSADPHYHKQTQNDAFSAHVYSSLIGRDADMKLVPALATSWKNLDDLTWEFKLRDDVKFSNGKPFTSEDVLFTICRTLNNETNVSQSYMDTTKRIADVQTPDAHTVIIKTAAPLPLLPAELARSLPIVWNGIVEHGKLTFNPKEGCGVTGPWPTVADFNNGKDAIGTGPYKLKSYVKGTGIELERNDNYWGPKPYWKDVKMVPVPNAGPRLTGLLSGDFDVIENPAARDLPRIKSNPQFGFVATPSTRLIFFQPDVGRNPSPLVKSADGKNPLQDLRVRQAISMAIDRKTIVTRLMDGIATPAYQYMPDGMFGGVPNAPEIKYDPEGAKKLLAEAGYANGFELTISTPNDRYVNDGQIAQAVAQYLSRVGIKANVDAMTASLYFPKRAKREFSFSMGGWPAEVGEASALFQLWVASLDSPRSLGTSNYGGFSNAEFDKVFTEALVTVDVAKREKLLQQSTQIALDNVPLIPLHFESSIWAFRKGLTYEGRRDQFTLAMSVQPADQK
>NZ_CP014013.1|WP_003815317.1|5199232_5199469_+|hypothetical-protein
MSDLTLSHNARLTDSLERELLRGAMEDQSNTIRPLAAVKAAAVGVGRGVRAVFAFIDEVNESMNRARAQSAHYTGSQW
>NZ_CP014013.1|WP_003815316.1|5198244_5199105_+|NAD(P)H-hydrate-dehydratase
MDTSSSSLPAIERQHLPALFAARPTDAHKGSCGTLGVIGGGPGMVGAALLAARAGLKVGAGKVLVGLVAETPPLPCDPMQPELMLRDFRGLLEAGLGIDAWTAGCGCGMDALAANALSELFQLRGDAALVLDADGLNLLAAGAVQPRWGDAPVVLTPHPAEAGRLLGLSTEAVQADRPAAARTLAARYGAWVVLKGAGSIVCDPAGACRINRTGNPGLATAGTGDVLAGILGALLAQRIAPEQAVPGAVWLHGAAADALVTHGIGPIGLTAGELADSARRLRNSRA
>NZ_CP014013.1|WP_003815333.1|5208652_5210722_-|UvrD-helicase-domain-containing-protein
MSASDTSIGSGLNPSQKEAVLYLDGPCLVLAGAGSGKTRVITQKMAYLLRECGYMGRNIVALTFTNKAAREMAERVKTLVDPKLAKGLTISTFHALGVRLLREEAAHAGLKPQFSILDADDAMSIIQELLATTDRGRLREVQSIISLWKNALLTPDQAAAAAITPTEVEAVTVYRGYAATLAAYQAVDFDDLIRIPAELLERNEEVRTRWQNRVRYLLVDEYQDTNVCQYRLVQLLTGVRAMFTAVGDDDQAIYAWRGATIENLAKLTTDYPNLKLIKLEQNYRSVQRILAAANNVIERNPKLFEKKLWSDLGHGEPIIVSPMNGDEHEAESIAMKVSAARFERQAQWKDFAILYRSNHQSRVLEQALRNLKIPYTISGGQSFFDKAEVRDILAYLRLVANDEDDPAFIRAATTPKRGIGQGTLQTLGQYAAQRQCSLLAAVDEAGLESLLAPRQLEPLRTFAEFVRRIQWRAGRGVEGQPARAPEPAGQILDDLLSAIQYERYLYDMLEERPAQTRWQNVLELTGWLKRKAEEDGMTLFDLVQHVALVTMLERGEEEEPDAVKLSTLHASKGLEYPHVYLAGVEEGLLPHLGKDDEDSGDPARAAETLATRIQEERRLMYVGITRAQRSLNLSWCKKRRRAREDVVREPSRFIEEMGLGDAKVQEDEATRAMSPKERLGMLKALLKKD
>NZ_CP014013.1|WP_003815335.1|5210764_5212867_-|primosomal-protein-N'
MSDASSADPALPAADAAGVWVRVALDVPLPGPFDYRSAAPLPLGARVIVPFGRRKLVGVVVEHPAQPSIDPAQVREVEQPLEDLPPMPADWMRLARFAADYYQRPLGEVMLPVLPPPLRKPSAYQGKRSGLGPVARLDARKPRAEAAVAAEPDQAPELNEAQREAVDTIGALSAFQPVLLHGVTGSGKTEVYLHAAARVLQAGRQVLLMVPEINLTPQLEGALRARLEALVGPQGVAILHSGLADGERVQAWARAQRGQARLLLGTRMSIFAPLPELGLIVVDEEHDPSYKQQEGLRYSARDLAIWRARDLDIPVVLGSATPSLESWQHAERGRYLRLTLPGRARASSLPEIRLIDTRRLQLKQGLAPQFIEAIGQRLERGEQSLVFLNRRGYAPVLHCASCAWVSHCPRCSTFTVLHRGPGAGGYRLQCHHCGYQAPVPRACPECGDQDLEPMGRGTQRIEEQLAEWFPQARIARIDADSTRRKGSAQALFAAVHAGEVDIMVGTQMVAKGHDFARLGLVGVLNADSMLFAHDFRAPERLFAQLMQVAGRAGRHAAGAQVLIQTGYPEQPVYQALLRHDYAGFARHALQEREDTGLPPFAYQALLTAEARELTVAQGFLQRARDLATGEPWPGVDAITLYDPVPLRVVRVAHVERAQLLIESTSRPALQGFLTAWAACLPQLAAEARVRWQLEVDPLEI
>NZ_CP014013.1|WP_003815337.1|5213173_5214250_-|uroporphyrinogen-decarboxylase
MSVAPLKNDVFLRALLREPVPYTPIWLMRQAGRYLPEYNATRARAGSFMGLAQNPDYACEVTLQPLARYPLDAAILFSDILTVPHAMGLGLDFAPGEGPRFAHPVRDESDVAKLAVPDMDSLRYVFDAVRTIRRELDGRVPLIGFAGSPWTIACYMVEGRGSDDYRLIKSMLYGRPDLLHRILEINAEATRHYLNAQIDAGAQAVMLFDSWGGVLADGLFQQFSLAYTRRVVEGLTREREGRRVPVIVFTKGGGQWLEEIAACGCDAVGLDWTVNLGTARRRVADAVALQGNLDPMTLFGGAQAVRAEARRTLDAFGPVGKGGHVFNLGHGISQYSPPEVVSELVDEVHTYSRALHAG
>NZ_CP014013.1|WP_010927150.1|5214325_5215207_-|hypothetical-protein
MRALLECAVLVMPDQPSWVGAWLAAVRGPEARLADRLRLHEYPLSGGRDGLALGQAAMSLRRFDALLLPVQASTLGWARLVLAQASPALSTPVLVLVRDLTAPAIADLLRLGARDFLRVPACLEELRVRASRAWRAIPPPAAGARAAVPVPGAEPGGGRGPGAPTDPGEGDGYRLPGMPETADASAAAPCMLAQTRAPYAATLGDARMAVQRELPFRQAKAQVVGRFERAYLRGALARHGGNVAQAARAACKHRRAFWALMRKHGIDARPYREGVAGAWPYETAPPRDPADEA
>NZ_CP014013.1|WP_003815341.1|5215389_5215812_-|F0F1-ATP-synthase-subunit-epsilon
MATLHVDVVSAEEAIFTGEAKFVVLPGEAGELGILPGHTPLISRIRPGTVKIVRADEGEENIFVAGGILEVQPGSVTVLADTAIRAADLDEARAVAAREKAEEALRNAKDKADIAVVEAELAMLAAQAVAARKLRQGRTH
>NZ_CP014013.1|WP_003815343.1|5215821_5217222_-|F0F1-ATP-synthase-subunit-beta
MSNGTIVQCIGAVVDIQFPRDNMPKIYEALTLVDEGSSFAEKGLTLEVQQQLGDGVVRTIALGSSDGLRRGMQVAGTGAPISVPVGHGTLGRIMDVLGRPIDEAGPIASDEKRAIHQPAPRFDELSPSVELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELINNIAKQHSGLSVFAGVGERTREGNDFYHEMEESNVLDKVAMVFGQMNEPPGNRLRVALTGLTMAEKFRDEGRDILFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSIQAVYVPADDLTDPSPATTFQHLDSTVVLSRDIAALGIYPAVDPLDSSSRQLDPQVVGEEHYQVARGVQQTLQRYKELRDIIAILGMDELSPEDKQAVARARKIQRFLSQPFHVAEVFTGSPGKYVSLAETIRGFKMIVDGECDALPEQAFYMVGTIDEAFEKAKKLQ
>NZ_CP014013.1|WP_003815344.1|5217264_5218170_-|F0F1-ATP-synthase-subunit-gamma
MPGIKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQERMRAGRPYATKVREIAAHLMQANPEYSHPYLVEREVKAVGVVLVTTDKGLCGGLNTNISRVTLSKLKEFEQRSIKVQATAFGNKGLGLLTRIGAKLVSQEVQLGDKPDLDRLLGAIKVQLDDYLEGRIDALYVATTRFVNTMRQEPVFLRLLPLSNGLDDPFQSGVETLAKTAEIKSDYSWDYIYEPDAKSVIDDLLQRYVEGLLYQAVAENMASEQSARMVAMKSASDNAKKVIGDLQLVYNKTRQAAITKEISEIVGGAAAV
>NZ_CP014013.1|WP_003815346.1|5218268_5219810_-|F0F1-ATP-synthase-subunit-alpha
MQLNPSEISELLKSRIEGLGASTDVRTQGTVVSVTDGITRIHGLSDVMQGEMLEFPNNVFGVALNLERDSVGAVVLGDYTGVSEGDQVKTTGRILEVPVGPELKGRVVNTLGDAIDGKGPINTTQTDIIEKVAPGVIARRSVSQPLQTGIKAIDSMVPIGRGQRELIIGDRQTGKTAVAVDTIISQKGKGVTCVYVAIGQKASTINNVVRKLEEHGAMEYTIVVAAAASDSAAMQYLAAYAGCTMGEYFRDRGEDALIVYDDLTKQAWAYRQVSLLLRRPPGREAYPGDVFYLHSRLLERAARVNEEYVEKFTNGAVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLFNAGVRPAINAGISVSRVGGAAQTKVIKKLSGGIRTDLAQYRELAAFAQFASDLDDATRRQLERGKRVVELLKQPQYQPLQVWELAVSLYAVNNGYLDDVDVAQILAFEKSLKDHLKAKHAALIQRIEDTKELSKDDEAELAAAVQDFKKHGAF
>NZ_CP014013.1|WP_003815348.1|5219844_5220384_-|F0F1-ATP-synthase-subunit-delta
MAELSTVARPYAEALFGAARDDKAGLAVWADLVSEMAQVAANPDVREAMADPRLDDKQRSEVFTGLIKSQLPQAARNFIELLVKNDRLLLLPVIATQFVALKNRHEGTAQAEITSAFELSDAQVKELIAALELKFGLKLKPHVSVDQELIGGVRVAVGDQVLDTSVKAQLARLRDTLAA
>NZ_CP014013.1|WP_003815350.1|5220396_5220867_-|F0F1-ATP-synthase-subunit-B
MNLNATIFFQMLVFFVLGWFTMKFVWPPLTKAIDERRQKIADGLAAAEKGKADLAQAQARVSLIEASAKSETHARIIEAEKQAASVIEQARREAEAERARIVAQAAQDAAQEVQRAREALRDDVAALAVKGAEQILKREVDARAHAELLNQLKAQL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP014013_4	4.1\|3875225\|38\|NZ_CP014013\|CRISPRCasFinder	3875225-3875262	38	NZ_CP014013.1	1771079-1771116	0	1.0

1. spacer 4.1|3875225|38|NZ_CP014013|CRISPRCasFinder matches to position: 1771079-1771116, mismatch: 0, identity: 1.0

ggtcgcgcccccacgctgcgcccgctgtgcgggcttgc	CRISPR spacer
ggtcgcgcccccacgctgcgcccgctgtgcgggcttgc	Protospacer
**************************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2067923 : 2114008

Burkholderia_phage(19.23%)

tail,terminase,capsid,head,integrase,protease,portal

attL 2075917:2075936|attR 2115603:2115622

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033447056.1\|2067923_2068571_+\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_010926218.1\|2068656_2069562_+	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_033447671.1\|2069579_2070701_+	outer membrane protein assembly factor BamC	NA	NA	NA	NA
WP_003809958.1\|2070788_2071415_-	fimbrial protein	NA	NA	NA	NA
WP_033446615.1\|2071664_2071874_-	hypothetical protein	NA	NA	NA	NA
WP_010926219.1\|2072145_2073333_-	cupin domain-containing protein	NA	NA	NA	NA
WP_010926220.1\|2073329_2075927_-	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	2.2e-20	22.4
2075917:2075936	attL	NA	NA	NA	NA
WP_033451925.1\|2075983_2076973_-\|integrase	tyrosine-type recombinase/integrase	A0A2H4J8E5	uncultured_Caudovirales_phage	2.5e-94	54.7
WP_010926222.1\|2076950_2077163_-	DUF4224 domain-containing protein	NA	NA	NA	NA
WP_010926223.1\|2077319_2077967_-	hypothetical protein	Q5QF30	Pseudomonas_virus	3.8e-35	42.3
WP_010926225.1\|2078078_2078255_-	hypothetical protein	NA	NA	NA	NA
WP_010926228.1\|2079989_2081924_-	DNA cytosine methyltransferase	Q5QF27	Pseudomonas_virus	1.3e-163	46.8
WP_010926229.1\|2081925_2082411_-	class I SAM-dependent methyltransferase	A0A0N7IRF6	Acinetobacter_phage	1.6e-57	63.6
WP_010926231.1\|2082750_2082978_-	hypothetical protein	A0A125RNQ4	Pseudomonas_phage	1.4e-13	49.2
WP_010926232.1\|2082974_2083496_-	hypothetical protein	NA	NA	NA	NA
WP_010926233.1\|2083492_2084137_-	hypothetical protein	NA	NA	NA	NA
WP_010926234.1\|2084133_2084958_-	ParB N-terminal domain-containing protein	C7BGF1	Burkholderia_phage	6.5e-88	65.8
WP_010926235.1\|2084978_2085350_-	hypothetical protein	NA	NA	NA	NA
WP_010926236.1\|2085360_2085597_-	hypothetical protein	NA	NA	NA	NA
WP_146090591.1\|2085906_2086266_+	hypothetical protein	NA	NA	NA	NA
WP_010926238.1\|2086570_2087254_-	LexA family transcriptional regulator	NA	NA	NA	NA
WP_080561918.1\|2087339_2087552_+	hypothetical protein	NA	NA	NA	NA
WP_010926239.1\|2087655_2088186_+	hypothetical protein	B7SYH6	Stenotrophomonas_phage	4.1e-27	38.9
WP_049803241.1\|2088185_2088488_+	hypothetical protein	Q6V7S5	Burkholderia_virus	2.0e-07	38.8
WP_010926241.1\|2088480_2088783_+	hypothetical protein	NA	NA	NA	NA
WP_010926242.1\|2088779_2089274_+	DUF1364 family protein	NA	NA	NA	NA
WP_010926244.1\|2090468_2090948_+	hypothetical protein	NA	NA	NA	NA
WP_010926245.1\|2090944_2091313_+	hypothetical protein	A0A0P0I8E8	Acinetobacter_phage	7.5e-20	48.1
WP_146090592.1\|2091327_2091810_+	hypothetical protein	NA	NA	NA	NA
WP_010926247.1\|2091810_2092494_+	hypothetical protein	Q3HR05	Burkholderia_phage	1.5e-29	45.1
WP_010926248.1\|2092750_2093029_-	BrnA antitoxin family protein	K4NZP3	Burkholderia_phage	1.3e-08	60.4
WP_010926249.1\|2093015_2093282_-	BrnT family toxin	NA	NA	NA	NA
WP_080561919.1\|2093481_2094261_+	HNH endonuclease	A0A2D1GPH3	Lactobacillus_phage	9.0e-15	32.7
WP_010926251.1\|2094366_2094786_+	hypothetical protein	NA	NA	NA	NA
WP_010926252.1\|2094763_2096533_+\|terminase	terminase large subunit	A0A0U4B0M7	Pseudomonas_phage	5.9e-264	74.2
WP_010926253.1\|2096529_2097825_+\|portal	phage portal protein	G0ZT36	Aeromonas_phage	1.1e-134	59.5
WP_010926254.1\|2097836_2098712_+\|protease	Clp protease ClpP	K7PH05	Enterobacteria_phage	4.5e-79	60.2
WP_010926255.1\|2098716_2099916_+\|capsid	phage major capsid protein	A0A2H4PI18	Pseudomonas_phage	2.2e-113	56.1
WP_010926256.1\|2099965_2100199_+	hypothetical protein	NA	NA	NA	NA
WP_010926257.1\|2100201_2100531_+\|head,tail	phage gp6-like head-tail connector protein	H2BDB3	Pseudomonas_virus	3.5e-21	57.8
WP_033452542.1\|2100530_2100905_+\|head,tail	head-tail adaptor protein	H2BDB4	Pseudomonas_virus	2.0e-28	50.8
WP_155272940.1\|2100970_2101126_+	hypothetical protein	NA	NA	NA	NA
WP_010926260.1\|2101122_2101608_+	hypothetical protein	NA	NA	NA	NA
WP_010926261.1\|2101607_2101979_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_010926262.1\|2102041_2102539_+	hypothetical protein	A0A2H4J511	uncultured_Caudovirales_phage	7.8e-12	32.2
WP_010926263.1\|2102548_2102881_+	hypothetical protein	NA	NA	NA	NA
WP_146090594.1\|2103329_2103680_+	hypothetical protein	NA	NA	NA	NA
WP_033452353.1\|2103738_2106720_+\|tail	phage tail tape measure protein	A0A2H4J7J3	uncultured_Caudovirales_phage	2.0e-25	31.9
WP_010926267.1\|2106721_2107069_+	hypothetical protein	Q2NPH3	Xanthomonas_virus	2.5e-09	33.3
WP_010926268.1\|2107070_2107547_+	DUF1833 family protein	I7GYA2	Xanthomonas_virus	1.1e-10	25.9
WP_010926269.1\|2107546_2107933_+	hypothetical protein	NA	NA	NA	NA
WP_104442497.1\|2108067_2111766_+	hypothetical protein	A5A3R1	Burkholderia_phage	9.5e-46	24.9
WP_010926271.1\|2111770_2112547_+	hypothetical protein	NA	NA	NA	NA
WP_010926272.1\|2112543_2112933_+	hypothetical protein	NA	NA	NA	NA
WP_033452351.1\|2113019_2113463_+	hypothetical protein	A0A0U5LBV3	unidentified_phage	4.3e-14	40.0
WP_010926274.1\|2113459_2114008_+	hypothetical protein	I6NSS1	Burkholderia_phage	9.1e-30	53.4
2115603:2115622	attR	NA	NA	NA	NA

DBSCAN-SWA_2

2646774 : 2681291

Pseudomonas_phage(17.24%)

terminase,integrase,tail

attL 2645883:2645898|attR 2655764:2655779

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2645883:2645898	attL	NA	NA	NA	NA
WP_010926402.1\|2646774_2647764_+\|integrase	site-specific integrase	A0A1B1P9F9	Acinetobacter_phage	2.0e-75	44.4
WP_010926403.1\|2647760_2647961_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_010926405.1\|2648073_2648739_-	hypothetical protein	H2BDG4	Pseudomonas_virus	8.7e-51	47.6
WP_010926407.1\|2650000_2650420_-	hypothetical protein	NA	NA	NA	NA
WP_010926408.1\|2650508_2651156_-	YqaJ viral recombinase family protein	A0A0U2BXF3	Paracoccus_phage	1.2e-31	41.4
WP_010926409.1\|2651152_2652139_-	recombinase RecT	H9C0R8	Aeromonas_phage	4.0e-68	57.8
WP_010926410.1\|2652142_2652325_-	hypothetical protein	NA	NA	NA	NA
WP_010926411.1\|2652321_2652699_-	hypothetical protein	NA	NA	NA	NA
WP_010926412.1\|2652701_2652911_-	hypothetical protein	NA	NA	NA	NA
WP_010926413.1\|2652930_2653398_-	hypothetical protein	Q3HQX1	Burkholderia_phage	8.0e-43	70.5
WP_010926414.1\|2653433_2653676_-	hypothetical protein	NA	NA	NA	NA
WP_004566311.1\|2653872_2654895_-	P63C domain-containing protein	Q8HA04	Enterobacteria_phage	3.9e-74	51.9
WP_010926415.1\|2655033_2655663_-	S24 family peptidase	NA	NA	NA	NA
WP_023853179.1\|2656217_2656469_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
2655764:2655779	attR	NA	NA	NA	NA
WP_161781422.1\|2656461_2657151_+	hypothetical protein	NA	NA	NA	NA
WP_010926418.1\|2657168_2657423_-	hypothetical protein	NA	NA	NA	NA
WP_010926419.1\|2657508_2657673_-	hypothetical protein	NA	NA	NA	NA
WP_010926420.1\|2657760_2658069_+	DNA-binding protein	A0A1S5NNI6	Burkholderia_phage	3.9e-14	47.8
WP_010926421.1\|2658071_2658479_+	recombination protein NinB	A0A0H5AUD0	Pseudomonas_phage	2.6e-29	62.4
WP_010926422.1\|2658478_2658928_+	HNH endonuclease	A0A2I7RKD9	Vibrio_phage	1.7e-21	39.2
WP_010926423.1\|2658924_2659341_+	DUF1364 family protein	A4JX58	Burkholderia_virus	1.4e-14	42.9
WP_004566303.1\|2659340_2660165_+	hypothetical protein	R9TJW3	Synechococcus_phage	1.9e-07	45.3
WP_004566302.1\|2660161_2660533_+	hypothetical protein	NA	NA	NA	NA
WP_004566301.1\|2660529_2661471_+	AAA family ATPase	A0A0U4B0G9	Pseudomonas_phage	8.5e-52	36.5
WP_004566300.1\|2661467_2662151_+	hypothetical protein	K4ICN3	Acidithiobacillus_phage	4.9e-33	50.0
WP_004566298.1\|2662347_2662788_+	hypothetical protein	NA	NA	NA	NA
WP_004566297.1\|2663105_2663477_+	DNA-binding protein	A0A090DCM3	Clostridium_phage	6.2e-06	36.7
WP_004566296.1\|2663463_2664741_+\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	9.2e-150	64.2
WP_004566295.1\|2664743_2666162_+	DUF4055 domain-containing protein	R9TF43	Synechococcus_phage	1.2e-97	41.5
WP_004566294.1\|2666190_2667243_+	hypothetical protein	A0A0H5BBX3	Pseudomonas_phage	6.3e-96	50.8
WP_033448595.1\|2667248_2667491_+	hypothetical protein	A0A0H5AUE5	Pseudomonas_phage	1.9e-16	51.9
WP_004566293.1\|2667613_2668216_+	hypothetical protein	R9TF81	Synechococcus_phage	5.5e-28	44.3
WP_003813425.1\|2669219_2669477_+	hypothetical protein	NA	NA	NA	NA
WP_004566291.1\|2669539_2670022_+	hypothetical protein	A0A2H4JE38	uncultured_Caudovirales_phage	2.6e-12	38.5
WP_004566290.1\|2670023_2670224_+	hypothetical protein	NA	NA	NA	NA
WP_004566289.1\|2670223_2670619_+	hypothetical protein	A0A2D2W284	Stenotrophomonas_phage	7.8e-07	35.0
WP_004566288.1\|2670615_2671014_+	HK97 gp10 family phage protein	S4SIM9	Salmonella_phage	2.1e-23	44.9
WP_004566287.1\|2671010_2671433_+	DUF4128 domain-containing protein	NA	NA	NA	NA
WP_004566286.1\|2671440_2671941_+	HNH endonuclease	A0A1I9SEX5	Klebsiella_phage	7.5e-31	45.1
WP_157835999.1\|2672041_2672197_-	hypothetical protein	NA	NA	NA	NA
WP_003813414.1\|2672195_2672711_+\|tail	phage tail protein	A0A1S5R1H0	Pseudomonas_phage	1.2e-23	38.3
WP_010926424.1\|2672723_2673053_+\|tail	phage tail assembly chaperone	A0A2H4J121	uncultured_Caudovirales_phage	3.8e-15	43.1
WP_010926425.1\|2673386_2675987_+\|tail	phage tail tape measure protein	A0A1V0E821	Vibrio_phage	4.5e-103	36.4
WP_010926426.1\|2675996_2676356_+	hypothetical protein	NA	NA	NA	NA
WP_033448593.1\|2676422_2676956_+	DUF1833 family protein	A0A0B5A6T7	Achromobacter_phage	1.2e-47	56.5
WP_004566282.1\|2676952_2677342_+	C40 family peptidase	A0A0G3EYJ9	Achromobacter_phage	3.3e-34	49.2
WP_004566281.1\|2677334_2681291_+	DUF1983 domain-containing protein	A0A0B5A1N2	Achromobacter_phage	1.2e-219	41.1

DBSCAN-SWA_3

3532601 : 3540661

uncultured_Mediterranean_phage(28.57%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010926718.1\|3532601_3533480_-	peptidoglycan DD-metalloendopeptidase family protein	A0A292GJG6	Xanthomonas_phage	4.6e-15	49.5
WP_010928874.1\|3533497_3534277_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	4.8e-32	46.9
WP_003811017.1\|3534261_3535020_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	6.2e-69	51.2
WP_023852762.1\|3535157_3535793_+	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_003811013.1\|3535837_3536878_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	9.3e-92	51.6
WP_003811011.1\|3537012_3538305_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	1.7e-66	36.0
WP_003811009.1\|3538510_3539536_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_010926719.1\|3539671_3540055_+	thioredoxin family protein	V9SJ74	Achromobacter_phage	8.1e-09	25.8
WP_003811006.1\|3540073_3540661_-	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	2.1e-16	46.8

DBSCAN-SWA_4

4042743 : 4060748

Pseudomonas_phage(21.05%)

terminase,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004566282.1\|4042743_4043133_-	C40 family peptidase	A0A0G3EYJ9	Achromobacter_phage	3.3e-34	49.2
WP_033448593.1\|4043129_4043663_-	DUF1833 family protein	A0A0B5A6T7	Achromobacter_phage	1.2e-47	56.5
WP_010926426.1\|4043729_4044089_-	hypothetical protein	NA	NA	NA	NA
WP_010926425.1\|4044098_4046699_-\|tail	phage tail tape measure protein	A0A1V0E821	Vibrio_phage	4.5e-103	36.4
WP_003813411.1\|4046726_4047017_-	DUF1799 domain-containing protein	A0A2H4JBP7	uncultured_Caudovirales_phage	6.3e-14	41.9
WP_010926424.1\|4047034_4047364_-\|tail	phage tail assembly chaperone	A0A2H4J121	uncultured_Caudovirales_phage	3.8e-15	43.1
WP_003813414.1\|4047376_4047892_-\|tail	phage tail protein	A0A1S5R1H0	Pseudomonas_phage	1.2e-23	38.3
WP_157835999.1\|4047890_4048046_+	hypothetical protein	NA	NA	NA	NA
WP_004566286.1\|4048146_4048647_-	HNH endonuclease	A0A1I9SEX5	Klebsiella_phage	7.5e-31	45.1
WP_004566287.1\|4048654_4049077_-	DUF4128 domain-containing protein	NA	NA	NA	NA
WP_004566288.1\|4049073_4049472_-	HK97 gp10 family phage protein	S4SIM9	Salmonella_phage	2.1e-23	44.9
WP_004566289.1\|4049468_4049864_-	hypothetical protein	A0A2D2W284	Stenotrophomonas_phage	7.8e-07	35.0
WP_004566290.1\|4049863_4050064_-	hypothetical protein	NA	NA	NA	NA
WP_004566291.1\|4050065_4050548_-	hypothetical protein	A0A2H4JE38	uncultured_Caudovirales_phage	2.6e-12	38.5
WP_003813425.1\|4050610_4050868_-	hypothetical protein	NA	NA	NA	NA
WP_004566292.1\|4050877_4051846_-	hypothetical protein	R9TJ64	Synechococcus_phage	6.6e-124	71.7
WP_004566293.1\|4051872_4052475_-	hypothetical protein	R9TF81	Synechococcus_phage	5.5e-28	44.3
WP_033448595.1\|4052598_4052841_-	hypothetical protein	A0A0H5AUE5	Pseudomonas_phage	1.9e-16	51.9
WP_004566294.1\|4052846_4053899_-	hypothetical protein	A0A0H5BBX3	Pseudomonas_phage	6.3e-96	50.8
WP_004566295.1\|4053927_4055346_-	DUF4055 domain-containing protein	R9TF43	Synechococcus_phage	1.2e-97	41.5
WP_004566296.1\|4055348_4056626_-\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	9.2e-150	64.2
WP_004566297.1\|4056612_4056984_-	DNA-binding protein	A0A090DCM3	Clostridium_phage	6.2e-06	36.7
WP_004566298.1\|4057301_4057742_-	hypothetical protein	NA	NA	NA	NA
WP_004566301.1\|4058617_4059559_-	AAA family ATPase	A0A0U4B0G9	Pseudomonas_phage	8.5e-52	36.5
WP_004566302.1\|4059555_4059927_-	hypothetical protein	NA	NA	NA	NA
WP_004566303.1\|4059923_4060748_-	hypothetical protein	R9TJW3	Synechococcus_phage	1.9e-07	45.3

DBSCAN-SWA_5

4139944 : 4179656

Pseudomonas_phage(29.41%)

tail,holin,capsid,plate,integrase,transposase,tRNA

attL 4130501:4130519|attR 4185515:4185533

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4130501:4130519	attL	NA	NA	NA	NA
WP_010926868.1\|4139944_4141300_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_162835035.1\|4141359_4141683_-	DUF3325 family protein	NA	NA	NA	NA
WP_003813605.1\|4141690_4143325_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_033447956.1\|4143321_4143603_-	DUF3649 domain-containing protein	NA	NA	NA	NA
WP_010926869.1\|4143875_4144877_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4JE37	uncultured_Caudovirales_phage	1.0e-23	31.4
WP_010926870.1\|4144879_4145671_-	DNA adenine methylase	Q5ZQW7	Pseudomonas_phage	1.2e-123	76.7
WP_010926871.1\|4145845_4146199_-	hypothetical protein	NA	NA	NA	NA
WP_104442495.1\|4146452_4147253_-\|tail	phage tail protein	A0A0A8J8U5	Ralstonia_phage	6.2e-27	36.9
WP_010926874.1\|4147249_4147828_-	DUF2313 domain-containing protein	F6MIL7	Haemophilus_phage	1.3e-29	36.5
WP_033452121.1\|4147824_4148892_-\|plate	baseplate J/gp47 family protein	A0A0M3LQN4	Mannheimia_phage	2.1e-75	44.2
WP_010926876.1\|4148891_4149242_-	phage GP46 family protein	A0A2H4JDR8	uncultured_Caudovirales_phage	9.9e-30	63.5
WP_010926877.1\|4149305_4149947_-\|plate	phage baseplate assembly protein	F6MIL4	Haemophilus_phage	2.5e-39	45.6
WP_010926878.1\|4149936_4151040_-\|tail	tail protein	A0A2H4J9E6	uncultured_Caudovirales_phage	2.1e-73	43.3
WP_010926879.1\|4151023_4152283_-	DNA circularization N-terminal domain-containing protein	A0A2H4JGT4	uncultured_Caudovirales_phage	8.5e-55	33.2
WP_010926880.1\|4152282_4154487_-\|tail	phage tail tape measure protein	A0A0M3LPB6	Mannheimia_phage	3.9e-87	42.9
WP_010926882.1\|4154630_4155023_-\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_010926883.1\|4155019_4155394_-	hypothetical protein	A0A2H4J9F8	uncultured_Caudovirales_phage	2.4e-18	41.6
WP_010926884.1\|4155409_4156837_-\|tail	phage tail sheath subtilisin-like domain-containing protein	A0A2H4JFT7	uncultured_Caudovirales_phage	1.6e-73	40.0
WP_010926885.1\|4156842_4157025_-	DUF2635 domain-containing protein	NA	NA	NA	NA
WP_104442499.1\|4157024_4157684_-	DUF1834 family protein	NA	NA	NA	NA
WP_033452139.1\|4157716_4158145_-	DUF1320 domain-containing protein	A0A2D1GNP0	Pseudomonas_phage	3.0e-12	35.9
WP_010926888.1\|4158245_4158518_-	hypothetical protein	NA	NA	NA	NA
WP_010926889.1\|4158589_4159537_-\|capsid	major capsid protein	G8GWE7	Rhodobacter_phage	5.0e-76	47.6
WP_010926890.1\|4159592_4159952_-	DUF2190 family protein	NA	NA	NA	NA
WP_010926891.1\|4159997_4161005_-	hypothetical protein	Q5ZQY0	Pseudomonas_phage	3.5e-35	53.5
WP_010926892.1\|4161239_4161797_-	phage virion morphogenesis protein	A0A0M3LSP9	Mannheimia_phage	1.1e-09	33.5
WP_010926893.1\|4161938_4163279_-\|capsid	minor capsid protein	A0A0M4UTA3	Ralstonia_phage	1.1e-63	40.1
WP_104442500.1\|4163271_4164726_-	DUF935 family protein	Q5ZQY4	Pseudomonas_phage	1.6e-145	56.2
WP_010926895.1\|4164806_4166489_-	hypothetical protein	A0A219VH72	Ochrobactrum_phage	1.2e-120	47.7
WP_010926896.1\|4166488_4167040_-	DUF3486 family protein	J9SH37	Pseudomonas_phage	1.6e-29	54.3
WP_010926897.1\|4167043_4167343_-	hypothetical protein	J9SNG3	Pseudomonas_phage	3.4e-23	61.2
WP_010926898.1\|4167353_4167650_-	DUF2730 family protein	J9STR5	Pseudomonas_phage	2.9e-14	44.7
WP_010926900.1\|4167752_4168169_-	hypothetical protein	NA	NA	NA	NA
WP_033452133.1\|4168165_4168798_-	transglycosylase SLT domain-containing protein	Q5ZQZ1	Pseudomonas_phage	1.3e-67	61.7
WP_010926902.1\|4168800_4169181_-\|holin	putative holin	Q6QIC8	Burkholderia_phage	9.1e-29	61.9
WP_010926904.1\|4169766_4170378_-	hypothetical protein	NA	NA	NA	NA
WP_085963112.1\|4170381_4170822_-	helix-turn-helix transcriptional regulator	Q6QID2	Burkholderia_phage	4.8e-21	43.4
WP_010926906.1\|4170923_4171148_+	DNA-binding protein	NA	NA	NA	NA
WP_033452116.1\|4171308_4171785_+	hypothetical protein	A0A0S4L5L2	Pseudomonas_phage	9.7e-36	48.1
WP_010926908.1\|4171781_4172087_+	helix-turn-helix domain-containing protein	Q5ZR02	Pseudomonas_phage	3.3e-21	51.0
WP_010926909.1\|4172105_4172999_+	DUF3102 domain-containing protein	A4JWN3	Burkholderia_virus	3.9e-70	53.6
WP_010926910.1\|4173001_4174777_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	Q6QIE0	Burkholderia_phage	2.1e-176	52.7
WP_010926911.1\|4174787_4175972_+	AAA family ATPase	Q6QIE1	Burkholderia_phage	2.5e-101	52.2
WP_010926912.1\|4175962_4176283_+	hypothetical protein	NA	NA	NA	NA
WP_104442501.1\|4176485_4177085_+	hypothetical protein	A0A0M5MXL4	Ralstonia_phage	5.6e-49	55.0
WP_010926915.1\|4177081_4177702_+	DUF3164 family protein	Q6QIE4	Burkholderia_phage	3.9e-61	58.6
WP_010926916.1\|4177821_4178103_+	HU family DNA-binding protein	Q6QIE5	Burkholderia_phage	5.7e-12	46.1
WP_146090596.1\|4178163_4178565_+	hypothetical protein	NA	NA	NA	NA
WP_010926918.1\|4178644_4179061_+	hypothetical protein	NA	NA	NA	NA
WP_010926919.1\|4179065_4179656_+	regulatory protein GemA	A4JWM5	Burkholderia_virus	1.5e-30	55.6
4185515:4185533	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP014013

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection