CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP012911	Streptococcus suis strain NSUI060 chromosome, complete genome	3 crisprs	DEDDh,RT,csn2,cas2,cas1,cas9,csa3,cas3,DinG	6	136
NZ_CP012912	Streptococcus suis strain NSUI060 plasmid pNSUI060a, complete sequence	0 crisprs	NA	0	1
NZ_CP012913	Streptococcus suis strain NSUI060 plasmid pNSUI060b, complete sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP012911_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012911_1

1371281-1371645

TypeII

Consensus_repeat	Method
GTTTTACTGTTACTTAAATCTTGAGAGTACAAAAA	CRISPRCasFinder
GTTTTACTGTTACTTAAATCTTGAGAGTACAAAAAC	CRT
GTTTTACTGTTACTTAAATCTTGAGAGTACAAAAAC	PILER-CR

5 spacers

csn2,cas2,cas1,cas9

The CRISPR arrays of NZ_CP012911_1

>merge|NZ_CP012911|1|1371281-1371645|CRISPRCasFinder,CRT,PILER-CR
TGATTACGATAATATAAATCTTGAGAGTACAAAAACTACAAATGTTATGGGGATAACTACCAGAAGGTTTTACTGTTACTTAAATCTTGAGAGTACAAAAACGACAAGGTCGAAAAGAAATACATTGATGTTGTTTTACTGTTACTTAAATCTTGAGAGTACAAAAATCCTGCAGATGTTAACCCACTCAATAATCCGTTTTACTGTTACTTAAATCTTGAGAGTACAAAAACTTTCCTCTTTTACTTCTTTATTTGTTACTAGTTTTACTGTTACTTAAATCTTGAGAGTACAAAAACCGAACCTATGAAATATACGTCACGTATTGAGTTTTACTGTTACTTAAATCTTGAGAGTACAAAAAC

>NZ_CP012911|1|1|1371281-1371644|CRISPRCasFinder
TGATTACGATAATATAAATCTTGAGAGTACAAAAA	CTACAAATGTTATGGGGATAACTACCAGAAG
GTTTTACTGTTACTTAAATCTTGAGAGTACAAAAA	CGACAAGGTCGAAAAGAAATACATTGATGTT
GTTTTACTGTTACTTAAATCTTGAGAGTACAAAAA	TCCTGCAGATGTTAACCCACTCAATAATCC
GTTTTACTGTTACTTAAATCTTGAGAGTACAAAAA	CTTTCCTCTTTTACTTCTTTATTTGTTACTA
GTTTTACTGTTACTTAAATCTTGAGAGTACAAAAA	CCGAACCTATGAAATATACGTCACGTATTGA
GTTTTACTGTTACTTAAATCTTGAGAGTACAAAAA

>NZ_CP012911|1|1|1371281-1371645|CRT
TGATTACGATAATATAAATCTTGAGAGTACAAAAAC	TACAAATGTTATGGGGATAACTACCAGAAG
GTTTTACTGTTACTTAAATCTTGAGAGTACAAAAAC	GACAAGGTCGAAAAGAAATACATTGATGTT
GTTTTACTGTTACTTAAATCTTGAGAGTACAAAAAT	CCTGCAGATGTTAACCCACTCAATAATCC
GTTTTACTGTTACTTAAATCTTGAGAGTACAAAAAC	TTTCCTCTTTTACTTCTTTATTTGTTACTA
GTTTTACTGTTACTTAAATCTTGAGAGTACAAAAAC	CGAACCTATGAAATATACGTCACGTATTGA
GTTTTACTGTTACTTAAATCTTGAGAGTACAAAAAC

>NZ_CP012911|1|1|1371347-1371645|PILER-CR
GTTTTACTGTTACTTAAATCTTGAGAGTACAAAAAC	GACAAGGTCGAAAAGAAATACATTGATGTT
GTTTTACTGTTACTTAAATCTTGAGAGTACAAAAAT	CCTGCAGATGTTAACCCACTCAATAATCC
GTTTTACTGTTACTTAAATCTTGAGAGTACAAAAAC	TTTCCTCTTTTACTTCTTTATTTGTTACTA
GTTTTACTGTTACTTAAATCTTGAGAGTACAAAAAC	CGAACCTATGAAATATACGTCACGTATTGA
GTTTTACTGTTACTTAAATCTTGAGAGTACAAAAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012911.1\|WP_002935618.1\|1384284_1385748_-\|flotillin-family-protein	unknown	unknown	gnl\|CDD\|259798
NZ_CP012911.1\|WP_002935600.1\|1374648_1375563_-\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|274694
NZ_CP012911.1\|WP_002935577.1\|1364598_1366866_-\|glycogen/starch/alpha-glucan-family-phosphorylase	unknown	unknown	gnl\|CDD\|340853
NZ_CP012911.1\|WP_002935602.1\|1377152_1380521_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	cd09643_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|273840
NZ_CP012911.1\|WP_002935587.1\|1368608_1368965_-\|ArsC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|239332
NZ_CP012911.1\|WP_002935599.1\|1374328_1374652_-\|CRISPR-associated-endonuclease-Cas2	cas2	COG3512_cas2_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|226043
NZ_CP012911.1\|WP_009910392.1\|1383887_1384196_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012911.1\|WP_002935598.1\|1373285_1374332_-\|hypothetical-protein	csn2	cd12217_csn2_CAS-II-A	gnl\|CDD\|213410
NZ_CP012911.1\|WP_014637063.1\|1368964_1370176_-\|phosphopentomutase	unknown	unknown	gnl\|CDD\|235430
NZ_CP012911.1\|WP_002935569.1\|1361088_1361706_-\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|240029
NZ_CP012911.1\|WP_002935571.1\|1362663_1363791_-\|oxygen-independent-coproporphyrinogen-III-oxidase	unknown	unknown	gnl\|CDD\|236309
NZ_CP012911.1\|WP_002935583.1\|1367041_1367755_-\|purine-nucleoside-phosphorylase	unknown	unknown	gnl\|CDD\|180275
NZ_CP012911.1\|WP_053866422.1\|1361692_1362433_-\|acyl-ACP-thioesterase	unknown	unknown	gnl\|CDD\|366738
NZ_CP012911.1\|WP_002935611.1\|1382689_1383766_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012911.1\|WP_002935608.1\|1381204_1382578_+\|tRNA-uridine-5-carboxymethylaminomethyl(34)-synthesis-GTPase-MnmE	unknown	unknown	gnl\|CDD\|235392
NZ_CP012911.1\|WP_002936184.1\|1375783_1377040_+\|ISL3-family-transposase	unknown	unknown	gnl\|CDD\|225995
NZ_CP012911.1\|WP_002935572.1\|1363885_1364464_+\|VanZ-family-protein	unknown	unknown	gnl\|CDD\|377417
NZ_CP012911.1\|WP_002935597.1\|1370504_1371179_-\|ribose-5-phosphate-isomerase-RpiA	unknown	unknown	gnl\|CDD\|234816
NZ_CP012911.1\|WP_002935585.1\|1367787_1368597_-\|purine-nucleoside-phosphorylase	unknown	unknown	gnl\|CDD\|236183
NZ_CP012911.1\|WP_002935134.1\|1371792_1373082_-\|IS4-like-element-ISSsu2-family-transposase	unknown	unknown	gnl\|CDD\|376573

Protein	Function_ID	Function_description	E-value
NZ_CP012911.1\|WP_002935618.1\|1384284_1385748_-\|flotillin-family-protein	gnl\|CDD\|259798	cd03399, SPFH_flotillin, Flotillin or reggie family; SPFH (stomatin, prohibitin, flotillin, and HflK/C) superfamily. The flotillin (reggie) like proteins are lipid raft-associated. Individual proteins of this SPFH family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. In addition, microdomains formed from flotillin proteins may be dynamic units with their own regulatory functions. Flotillins have been implicated in signal transduction, vesicle trafficking, cytoskeleton rearrangement and interact with a variety of proteins. They may play a role in the progression of prion disease, in the pathogenesis of neurodegenerative diseases such as Parkinson's and Alzheimer's disease and in cancer invasion, and metastasis.	7.80101e-47
NZ_CP012911.1\|WP_002935600.1\|1374648_1375563_-\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274694	TIGR03639, cas1_NMENI, CRISPR-associated endonuclease Cas1, subtype II/NMENI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is a prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 variant of the NMENI subtype of CRISPR/Cas system.	2.0775e-122
NZ_CP012911.1\|WP_002935577.1\|1364598_1366866_-\|glycogen/starch/alpha-glucan-family-phosphorylase	gnl\|CDD\|340853	cd04300, GT35_Glycogen_Phosphorylase, glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.	0
NZ_CP012911.1\|WP_002935602.1\|1377152_1380521_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|273840	TIGR01865, conserved_hypothetical_protein, CRISPR subtype II/NMENI RNA-guided endonuclease Cas9/Csn1. CRISPR loci appear to be mobile elements with a wide host range. This model represents a protein found only in CRISPR-containing species, near other CRISPR-associated proteins (cas), as part of the NMENI subtype of CRISPR/Cas locus. The species range so far for this protein is animal pathogens and commensals only.	3.20638e-178
NZ_CP012911.1\|WP_002935587.1\|1368608_1368965_-\|ArsC-family-transcriptional-regulator	gnl\|CDD\|239332	cd03034, ArsC_ArsC, Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli. E. coli ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], the first step in the detoxification of arsenic, using reducing equivalents derived from glutathione (GSH) via glutaredoxin (GRX). ArsC contains a single catalytic cysteine, within a thioredoxin fold, that forms a covalent thiolate-As(V) intermediate, which is reduced by GRX through a mixed GSH-arsenate intermediate. This family of predominantly bacterial enzymes is unrelated to two other families of arsenate reductases which show similarity to low-molecular-weight acid phosphatases and phosphotyrosyl phosphatases.	1.02902e-20
NZ_CP012911.1\|WP_002935599.1\|1374328_1374652_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	9.7745e-25
NZ_CP012911.1\|WP_002935598.1\|1373285_1374332_-\|hypothetical-protein	gnl\|CDD\|213410	cd12217, Stu0660_Csn2, Stu0660-like CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. This family of Csn2 proteins includes Stu0660, the proteins are larger than other (canonical) Csn2 proteins as they have an additional alpha-helical C-terminal domain. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	2.6417e-137
NZ_CP012911.1\|WP_014637063.1\|1368964_1370176_-\|phosphopentomutase	gnl\|CDD\|235430	PRK05362, PRK05362, phosphopentomutase; Provisional.	0
NZ_CP012911.1\|WP_002935569.1\|1361088_1361706_-\|NUDIX-hydrolase	gnl\|CDD\|240029	cd04672, Nudix_Hydrolase_14, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	3.31442e-61
NZ_CP012911.1\|WP_002935571.1\|1362663_1363791_-\|oxygen-independent-coproporphyrinogen-III-oxidase	gnl\|CDD\|236309	PRK08599, PRK08599, oxygen-independent coproporphyrinogen III oxidase.	0
NZ_CP012911.1\|WP_002935583.1\|1367041_1367755_-\|purine-nucleoside-phosphorylase	gnl\|CDD\|180275	PRK05819, deoD, DeoD-type purine-nucleoside phosphorylase.	4.90632e-151
NZ_CP012911.1\|WP_053866422.1\|1361692_1362433_-\|acyl-ACP-thioesterase	gnl\|CDD\|366738	pfam01643, Acyl-ACP_TE, Acyl-ACP thioesterase. This family consists of various acyl-acyl carrier protein (ACP) thioesterases (TE) these terminate fatty acyl group extension via hydrolysing an acyl group on a fatty acid.	4.45311e-87
NZ_CP012911.1\|WP_002935608.1\|1381204_1382578_+\|tRNA-uridine-5-carboxymethylaminomethyl(34)-synthesis-GTPase-MnmE	gnl\|CDD\|235392	PRK05291, trmE, tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE.	0
NZ_CP012911.1\|WP_002936184.1\|1375783_1377040_+\|ISL3-family-transposase	gnl\|CDD\|225995	COG3464, COG3464, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.18781e-111
NZ_CP012911.1\|WP_002935572.1\|1363885_1364464_+\|VanZ-family-protein	gnl\|CDD\|377417	pfam04892, VanZ, VanZ like family. This family contains several examples of the VanZ protein, but also contains examples of phosphotransbutyrylases.	9.00811e-06
NZ_CP012911.1\|WP_002935597.1\|1370504_1371179_-\|ribose-5-phosphate-isomerase-RpiA	gnl\|CDD\|234816	PRK00702, PRK00702, ribose-5-phosphate isomerase RpiA.	1.32327e-114
NZ_CP012911.1\|WP_002935585.1\|1367787_1368597_-\|purine-nucleoside-phosphorylase	gnl\|CDD\|236183	PRK08202, PRK08202, purine nucleoside phosphorylase; Provisional.	6.03224e-162
NZ_CP012911.1\|WP_002935134.1\|1371792_1373082_-\|IS4-like-element-ISSsu2-family-transposase	gnl\|CDD\|376573	pfam01609, DDE_Tnp_1, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. This family contains transposases for IS4, IS421, IS5377, IS427, IS402, IS1355, IS5, which was original isolated in bacteriophage lambda.	3.77236e-08

>NZ_CP012911.1|WP_002935597.1|1370504_1371179_-|ribose-5-phosphate-isomerase-RpiA
MTNLKEQVGIKAAEFVTDGMIVGLGTGSTAYYFVQEIGRRVAEEGLQITGVTTSHATAEHAASLGIPLKNIDEVEYVDLTVDGADEVDGDFNGIKGGGAALLMEKVVAVNSKDCIWIVDESKVVQTLGAFKLPVEVVQYGAENLFRLFEKKGYRPSFRMRNGEKHITDMQNFIIDLDLRRIEDTYALAEELDRTVGVVEHGLFIGLISKVIVGTPEGPNIIEKK
>NZ_CP012911.1|WP_014637063.1|1368964_1370176_-|phosphopentomutase
MPKFKRVHLVVMDSVGIGAAPDSDKFFNAGVADTESDTLGHISEKAGLEVPNMTKIGLGNIPRDTALATVPAESHPTGYVTKLEEVSLGKDTMTGHWEIMGLNITEPFDTFWDGFPEEILTKIEEFSGRKIIREANKPYSGTAVIDDFGPRQMETGELIVYTSADPVLQIAAHEDIIPLDELYRICEYARSITLERPALLGRIIARPYVGEPGNFSRTANRHDYAVSPFEETVLNKLADAGVPTYSVGKISDIFNGSGITNDMGHTKSNMHGVDVLIDTLKLSDFEEGFSFTNLVDFDAVYGHRRNIEGYRDCLQEFDARIPEIIDNMREDDLLLITADHGNDPSYAGTDHTREYVPLLAYSKVFKGSGVLPVGHFADISATVAENFGVDTAMIGESFLSQLV
>NZ_CP012911.1|WP_002935587.1|1368608_1368965_-|ArsC-family-transcriptional-regulator
MEKLTVYYNPDCSKCKKLRILLPSQDMEVKWVNYLETPLRGAELTALLEKMGSQPSAVTRLKEEERLALPEEEIFERLVKEPALLNRPIIEREQTAFLCRPLEIIKEKMPEYDWSDYL
>NZ_CP012911.1|WP_002935585.1|1367787_1368597_-|purine-nucleoside-phosphorylase
MSLLAKINETKTFLEEKGLVKPEFGLILGSGLGELAQEVENAIVIDYADIPNWGKSTVVGHAGKLVYGDLAGRKVLALQGRFHFYEGNPMEVVTFPVRVMKALGCEGVIVTNAAGGIGYGPGTLMAITDHINMTGQNPLIGENLEEFGPRFPDMSNAYTKEYREKAHAVAEKLGIKLDDGVYLGVTGPTYETPAEILAFKTMGAHAVGMSTVPEVIVAAHSGMKVLGISAITNFAAGFQSELNHEEVVEVTEQIKGNFKGLVKAILAEL
>NZ_CP012911.1|WP_002935583.1|1367041_1367755_-|purine-nucleoside-phosphorylase
MSIHISAKPGEIADKILLPGDPLRAKFIAENFLEDAVCFNEVRNMFGYTGTYKGHRVSVMGTGMGMPSISIYAHELINEYGVKKLIRVGTAGSLNEDVHVRELVLAQAAATNSRMINIDWPEYDLPQIADFDLLDKAYHIAKELNMTTHVGNVLSSDSFYSPKLFSRNLELGQLGVKAVEMEAAALYYLGAKFGVQTLAIMTISDSLVNPEENTTAEERQNTFTDMMKVGLETLIAE
>NZ_CP012911.1|WP_002935577.1|1364598_1366866_-|glycogen/starch/alpha-glucan-family-phosphorylase
MINLQNFVQSMYAKRIEDCTDQELYYALLAFTKQQSEAKYTNDQKKKVYYISAEFLIGKLLSNNLINLGLYDEVKSQLVAAGKDLIAIEDMELEPSLGNGGLGRLAACFLDSIASLGLNGDGVGLNYHFGLFRQLFEYHQQSAVPNEWITPRSWLTESPISYQVPFANFTLTSKLYDIDVPGYKMERKNRLRLFDLGSVDDNIIYDGIEFDKEDIFRNLTLFLYPDDSTDEGKVLRIFQQYFMVSNAAQLLIDEAVAKGSNLHDLPDYAVVQINDTHPSLVIPELIRLLELRGISFDEAVEIVKKMTAYTNHTILSEALEKWPLDFLNYVVPHLVPFIVELDRRAKEVKDDPAVNIIDEYGRVHMAHMDIHYGYSINGVAALHTEILKTSELKAFYELYPEKFNNKTNGITFRRWLMHANPSLASYLDGLLGHGYHHDASELEKLLDYKNDKELKSWLEKTKQDNKRKLQRHIAKTQGVHVNPESIFDVQIKRMHEYKRQQMNVLYVIHKYLDIKAGNIPTRPLTVFFGGKAAPAYTTAQDIIHLILVLSQVIKNDSEVAPHLQLVMIENYNVTEASFIIPAADISEQISLASKEASGTGNMKFMLNGALTIGTDDGANVEIHELVGDENIYIFGQDSQTVIEHYANRTYHPYSFYEREVIRPLIDFITSDTIRHAGGIDERLWRLQDNLKHNDHFMTLLDLEDYIVTKERMLADYEDRDSWLEKVIVNIAKAGFFSSDRTIQQYNEDIWHLEAK
>NZ_CP012911.1|WP_002935572.1|1363885_1364464_+|VanZ-family-protein
MKKEIIYDCINLILSFLLCRWLFMTFLFYQFSNIFMTIDFWPTLAAILLMTGFCFTLFRLVYKPHISRLTLWFFYACYGLLLVYLLFFKSMGVRGVNWNLLSTFSQDLFLNPTILVFNLLLFLPLGLLFSFSWKKLSLFVGAILLVEACQFFFSLGFFDLGDILLNTSGFALGNFLGQSAIAQSFKNRIQKK
>NZ_CP012911.1|WP_002935571.1|1362663_1363791_-|oxygen-independent-coproporphyrinogen-III-oxidase
MKKRPTSAYIHIPFCTQICYYCDFSKVFIKNQPVDEYLAALMEEVKFYDLPALRTLYIGGGTPSALSADQLDYLLTNLEDLLDLSQLEEFTIEANPGDLTADKIAVLKKSKCNRVSLGVQTFDDRMLKKIGRSHNQAQIYETIATLKEAGFYNISIDLIYALPGQTMEQVVDNVAKALELDIPHMSLYSLILENHTVFMNRQRRGNLHLPNEDVESDMFDYILQELEKNGFEHYEISNFTKPGFESRHNLMYWDNSEYYGLGAGASGYIDGMRYRNRGPIQHYLKSIREKGHSRLHEEFLSQTEQMEEEMFLGLRKKTGVSIERFEEKFGISFEDRYGQVVRDLKNEGLLQEEDRWLRMTKKGLFLGDTVAERFI
>NZ_CP012911.1|WP_053866422.1|1361692_1362433_-|acyl-ACP-thioesterase
MGLTYQEEFTIPFDMVDVKQEIKLPDFISYCLGVSGRQSEELGRSDLYVFQEFGLIWVVTDYELTIQRLPKYNETITIKTEAVAYNKFFCHRMFYIYDAAGNLLLDILCYFVLIDFETRKVAPVPEDLIAPYQSEQVKKLPRAPKYQLLENPSVQEFPVRYFDLDMNGHVNNGKYLEWMYEALGYDFLICHVPKKIQLKYLKEVEATSLVSSRMVAEAGGSQHEIVVDGHIHAQAVIEWRERHVAG
>NZ_CP012911.1|WP_002935569.1|1361088_1361706_-|NUDIX-hydrolase
MSQDKWLEWAVRLQALAQTGLAYGKDVYDMERFEEIRQIAAEMLVEPSGQPLEVVKDLFCNETGYQTPKLDTRAAIFQEDKILLVQENDGLWSLPGGWCDVDQSVKDNVVKEVKEEAGLDVEAQRVVAILDKHKNNPAKSAHRVTKVFILCRLLGGEFQPNSETVASGFFSLDDLPPLYLGKNTAEQLALCLEASRSEHWETRFD
>NZ_CP012911.1|WP_002935134.1|1371792_1373082_-|IS4-like-element-ISSsu2-family-transposase
MLDQIKAHLLDSINDIVSSANQFVLHPEKDFSRQSQLTMKTMIQAILTMGGNTLAKELLDLDLPVSQSAFVQRRYQIKHQAFKTLFRDITSKIPISDNLPILAVDGSDVILPRNRFDKTTSFQTGPHHTPYNLIHINALYTLEQEIYHDLRIQDNREVDERAAFIDMMKTSSFKQALVIMDRGYESYNVMAHCQERNWSYIIRIRDGNHSMKSGFNLPDTPCFDEAFDLNICRKQTNDMKELYRDFPNQYHFLPHNASFDFLLNSSRKSDPLQFYELHFRMVRLEIKPGFFETLVTNTDYSPEKLKELYAYRWGIETSFRDLKYSIGLTHFHAKKKEGILQEIYARFINFNVCKWLTSHVAIKTSKLKQTYKICFSDAVYACRKFLRNKLTSFQLETYIAKHLSIIRPNRTFQRKIKSKAPVSFTYRVT
>NZ_CP012911.1|WP_002935598.1|1373285_1374332_-|hypothetical-protein
MKWLITHHVLNNIPIHVGQFTQIVGQNYELKYYIWQILIWYFGGKKYSEEDLILFNQEEPVISQDSEAIKRNAFKIISIAEVGDILEQISYKKGTIGFSYLSLKMQNIEIIEELEILNYHLHKIAQKVNSSISLINDEIEYEVGTTDLLPEQILTKQLTPHFKKSRDEIAIEFISNEKKLCFLLQMLNAIMQEQTKPILLVLKNLDDYLTYDSFVRIAQYLEELSNKYPYFNTILFPSQEGYLYLTEATLETVNIVSDRIEHYPAFTFLYTRYQQSYPSTSPLGEKEFLNSLRKISSYLFSSDINRVVSLADIDLVTLKIVNSLYQYDIKMVYMYKGISKLEENYLSS
>NZ_CP012911.1|WP_002935599.1|1374328_1374652_-|CRISPR-associated-endonuclease-Cas2
MRYDAMRLLCFFDLPMETTQEKRQYRLFRKELIANGFEMLQFSVYYRTCPNRSFATKFYKKLQQSHLPAGNVRLLAVTEKQFSEMVLIVGGKTRQEEAISDRKLVII
>NZ_CP012911.1|WP_002935600.1|1374648_1375563_-|type-II-CRISPR-associated-endonuclease-Cas1
MTWRIVHIHQSEKMRLKLDNLVIKKQGDEFTIPLSDISIIVAEGGDTVVTLRLLSALSKYNIALIVCDNHHLPTGIYHSQNGHFRAYKKLQAQLSWAPLQKDKLWQIIIYFKITNQQDVLAMQEKSLSTIQLLSDYREHIELGDRTNREGHAAKVYFNELFGKQFVRLTQQETDAVNAGLNYGYTIFRAQMARIIAGYGLNALIGIFHKNEYNQFNLADDLMEPFRQIVDVWVYMNLREADFLTYQHRLELTNLLNAKIRYGKENCSVTVAMDKFVKGFIRCIEDKDTNQFFCPVVSSLEMEKL
>NZ_CP012911.1|WP_002936184.1|1375783_1377040_+|ISL3-family-transposase
MEQLNLITNFLRIKDKNIVITDEYDMGTHLELHGHLDYTAPKCPSCKGQMTKYDFQKASKIPYLETAGYPLLIRLRKRRFKCKDCGKIAVAETPLVKKNHQISVAVNQKIAQLLIENQAMTHIAHRLSISTSSVMRKLNEFKFETDWNTLPEVMSWDEYSFKKGKMSFIAQDFNSLNVITILDGRTQATIRNHFLRYPRKVRNQVKVITMDMFSPYYQLAKQLFPNAKIVLDRFHIVQHLSRAMNRIRIQIMNQFDRTSQEYRALKRYWKLIQQDSRKLSDKRFYRPMFRMHLTNKEILEKLLSFSEELRQHYELYQLLLFHFQEKNSDHFFDIVELEIATVNPIFQTVFKTFLKDKDKVLNALELPYSNAKLEATNNLIKVIKRNAFGFRNFENFKKRILIALNIKKERTKFVLSRC
>NZ_CP012911.1|WP_002935602.1|1377152_1380521_-|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MSNGKILGLDIGIASVGVGVIDAQTGEIIHASSRIFPSANAANNAERRTFRGSRRLIRRKKHRIKRLDDLFNDFHINLDGEMSTDNPYVLRVKGLSQKLTVEELYISIKNIMKRRGISYLDDAESDNEAGRSDYAKAIERNRQLLTSKTPGEIQLERLEKYGQLRGNFTIIDEEGQSQQIINVFSTSDYVKEVEKILDCQKMYHKFISDEFCDKLIELLREKRKYYVGPGNEKSRTDYGIYRTDGTTLENLFGILIGKCTFYPDQYRSSRASYTAQEFNFLNDLNNLTVPTETKKLSQEQKEFLVNYAKETSVLGAGKILQQIAKLADCKVEDIRGYRLDNKDKPELHTFETYRAMKGLVPLVDIGVLSREQLDILADILTLNTDFEGIREALKKQLPNVFDEKQVKGLASFRKSKSQLFAKGWHNLSQKIMLEVIPELYATSDEQMTILTRLGKFEKSSVAEYPSSINVDEITDEIYNPVVAKSIRQTIKIINASIKKWGEFDQIVIEMPRDRNEDEEKKRIADGQKANAKEKADSILRAAELYCAGKVLPDYVYNGHNQLATKIRLWYQQGERCIYTGQPISIHDLIHNQNQYEIDHILPLSLTFDDSLSNKVLVLATANQEKAQRTPYNYLKSATSAWSYREFKDYVTKRKGIGKKKCEYLTFEEDINGFEVRSKFIQRNLVDTRYASKVILNALQDYFKISGIQTKVSVVRGQFTSQLRHKWGIEKTRETYHHHAVDALIIAASSQLRLWKKQESPLVVDYQEGRQVDLETGEILELTDEQYKELVYQPPYQGFVNTISSSAFDNEILFSYQVDSKVNRKISDATIYATRNAQLGKDKTEGIYVLGKIKDIYTQAGYEAFLKRYTKDKTSFLMYHKDLDTWEKVIEIILRDYREYDEKGKEIGNPFERYRRENGYVKKYSRKGNGTAIKSLKYYDNKLGNHIDITPENSRNAVVLQSLKPWRTDVYFNKETGKYEFLGIKYSDLSFEKGTGEYGISQEKYDSIKIAEGVAKKSIFKFTLYKQDLLFIKDIENNFGKLLRFTSKNDTSKHYVELKPYDKNKFGTEEPLLPVLGNVAKSGQCIKGLNKSNISIYKVRTDILGYRHFIKQEGEHPQLKFKK
>NZ_CP012911.1|WP_002935608.1|1381204_1382578_+|tRNA-uridine-5-carboxymethylaminomethyl(34)-synthesis-GTPase-MnmE
MITKEFDTITAISTPLGEGAIGIVRLSGTDAFAIASKVFKGKDLATVPSHSLNYGHIIDPATGQVLDEVILGVMRSPKTFTREDVIEINTHGGIAVTNEILQLLIRQGARMAEPGEFTKRAFLNGRVDLTQAEAVMDVIRAKTDKAMHNAVRQLDGSLSQLINDTRQEILNTLAQVEVNIDYPEYDDVEEATTELVREKTLQFQALLENLLRTARRGKILREGIATAIIGRPNVGKSSLLNNLLREEKAIVTDIAGTTRDVIEEYVNIKGVPLKLIDTAGIRETDDIVEKIGVERSKKALEEADLILLVLNASEPLTEQDRNLLAISDLANRIVLLNKTDLEEQIEADQLPEDVIRISVLKNQNIDQIEEKINQLFFENAGLVEQDATYLSNSRHISLIEQAVQSLQAVNDGLEMGMPVDLLQVDLTRCWQILGEITGDAAPDELITQLFSQFCLGK
>NZ_CP012911.1|WP_002935611.1|1382689_1383766_+|hypothetical-protein
MKKLLICIVLLSCLVFPFIGWKLYAYQHNTITLTSEADFYLIYPGKVEAFQLNGQEPELLHTQKMNSEGYFGSGENYVIDSRYLVFANDQQKFINDNLISIDFNTGTVLRKPSQYSSYISGTDGQDFYTAGPYHILAQFDRNFDTIQTHVLNDDFIPNAPVMVDQTSVYLTGFVKDFTQEGPEENVLIVFDKKDFSKQEVFKYDNTIATGEGPWVNGTIYLPNLGKKTSEYTDIEQSSELLTFDTKTKTFSSVTLEHPSPSTLHALKDQKLLLIEHQNDMFSPISFTIYNTQTGQESYHRLDELNPRPYYIDHVRQLDGNRLLLILAGKALIYDWQAKKVLSQTILSENYVSGVWVND
>NZ_CP012911.1|WP_009910392.1|1383887_1384196_-|hypothetical-protein
MKMFRNSKKSKLFIQKINELLSDSELKLSKALKFQLLEAMELCEKGSKISYLSYKIYPWVLEELALNRIQSDKLKMFKRYLEQERWKYYFGSALGMAFTSIR
>NZ_CP012911.1|WP_002935618.1|1384284_1385748_-|flotillin-family-protein
MDFGFDILAIMIPIIVVVLFVLLFVFGYVSAKPNEAIVITGLGKPRTLIGRSGFMIPFIEKRSYISIEQFSTDVQTTDFVPTLDFINVKADAVVKVKVGISDELLNAAAQNFLNWKTADISASIQDVLEGNLREIIGQMELRDMVNNRQAFAEKVQSNAAPDLAKMGLEIIAFTVQSFTDDNDVIKNLGIDNIVTIQKDAANARAKAEREQAEVRAREDKAANDARVAADLEIAKKQNELAIEQANLKRQSDVQLAQANAAYGIEEQAQRKEIERATAEANIVKQQKEAEVKAEEVKVREQELSATIRKQAEAEKYARQQAAEADLIERQRKAEAELYETQREAEAQKARAEAAKYAAEQEAAGIEAKGRAEAEAIRLKLEAEAEGLSKKADAMAKFNDAAVTEMVVNVLPEIAKNIAAPLGNVDKITMYGEGNASKMVGDLMTTMDKTTEGLGLNVRDLISATLTGRAMSTGLLTAQETKEAEGDK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP012911_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012911_2

1423547-1423662

Orphan

Consensus_repeat	Method
CTAGCTCGGGGATAAAACAGTCTCCCAGAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP012911_2

>merge|NZ_CP012911|2|1423547-1423662|CRISPRCasFinder
CTAGCTCGGGGATAAAACAGTCTCCCAGACATTGAAAAACAAGTCCGAATATTTCCAGACTTGTTCTTATTATAACCTTCGCTATTCTAGCTCAGGGATAAAACAGTCTCCCAGAC

>NZ_CP012911|2|2|1423547-1423662|CRISPRCasFinder
CTAGCTCGGGGATAAAACAGTCTCCCAGAC	ATTGAAAAACAAGTCCGAATATTTCCAGACTTGTTCTTATTATAACCTTCGCTATT
CTAGCTCAGGGATAAAACAGTCTCCCAGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012911.1\|WP_002935693.1\|1422555_1422741_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012911.1\|WP_002935700.1\|1422773_1423415_-\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|223943
NZ_CP012911.1\|WP_002935690.1\|1420185_1421352_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NZ_CP012911.1\|WP_002935691.1\|1421487_1422492_+\|lactonase-family-protein	unknown	unknown	gnl\|CDD\|378416
NZ_CP012911.1\|WP_002935725.1\|1428406_1430131_-\|septation-ring-formation-regulator-EzrA	unknown	unknown	gnl\|CDD\|179877
NZ_CP012911.1\|WP_002939430.1\|1432353_1432893_-\|DJ-1/PfpI-family-protein	unknown	unknown	gnl\|CDD\|153229
NZ_CP012911.1\|WP_002935708.1\|1425585_1425813_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012911.1\|WP_002935688.1\|1418246_1418963_-\|acetolactate-decarboxylase	unknown	unknown	gnl\|CDD\|226058
NZ_CP012911.1\|WP_002935689.1\|1418966_1420196_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|274350
NZ_CP012911.1\|WP_012027447.1\|1432906_1434136_-\|FtsW/RodA/SpoVE-family-cell-cycle-protein	unknown	unknown	gnl\|CDD\|223843
NZ_CP012911.1\|WP_002935706.1\|1425123_1425576_+\|DUF1694-domain-containing-protein	unknown	unknown	gnl\|CDD\|377952
NZ_CP012911.1\|WP_002935704.1\|1423666_1424974_-\|phosphopyruvate-hydratase	unknown	unknown	gnl\|CDD\|234617
NZ_CP012911.1\|WP_002939427.1\|1430219_1432172_-\|DNA-topoisomerase-(ATP-hydrolyzing)-subunit-B	unknown	unknown	gnl\|CDD\|235542
NZ_CP012911.1\|WP_002935685.1\|1413565_1415407_-\|PTS-glucose-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|273919
NZ_CP012911.1\|WP_002935684.1\|1412126_1413551_-\|glycoside-hydrolase-family-1-protein	unknown	unknown	gnl\|CDD\|225343
NZ_CP012911.1\|WP_002935686.1\|1415417_1416257_-\|PRD-domain-containing-protein	unknown	unknown	gnl\|CDD\|170086
NZ_CP012911.1\|WP_002935718.1\|1425803_1426931_-\|glycerate-kinase	unknown	unknown	gnl\|CDD\|376844
NZ_CP012911.1\|WP_002935687.1\|1416562_1418221_+\|fibronectin/fibrinogen-binding-protein	unknown	unknown	gnl\|CDD\|336217
NZ_CP012911.1\|WP_002935722.1\|1427038_1427689_+\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|319798
NZ_CP012911.1\|WP_002935723.1\|1427719_1428355_-\|phosphoserine-phosphatase-SerB	unknown	unknown	gnl\|CDD\|319803

Protein	Function_ID	Function_description	E-value
NZ_CP012911.1\|WP_002935700.1\|1422773_1423415_-\|HAD-family-hydrolase	gnl\|CDD\|223943	COG1011, COG1011, Predicted hydrolase (HAD superfamily) [General function prediction only].	1.03377e-35
NZ_CP012911.1\|WP_002935690.1\|1420185_1421352_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	1.75293e-63
NZ_CP012911.1\|WP_002935691.1\|1421487_1422492_+\|lactonase-family-protein	gnl\|CDD\|378416	pfam10282, Lactonase, Lactonase, 7-bladed beta-propeller. This entry contains bacterial 6-phosphogluconolactonases (6PGL)YbhE-type (EC:3.1.1.31) which hydrolyze 6-phosphogluconolactone to 6-phosphogluconate. The entry also contains the fungal muconate lactonising enzyme carboxy-cis,cis-muconate cyclase (EC:5.5.1.5) and muconate cycloisomerase (EC:5.5.1.1), which convert cis,cis-muconates to muconolactones and vice versa as part of the microbial beta-ketoadipate pathway. Structures of proteins in this family have revealed a 7-bladed beta-propeller fold.	1.41544e-152
NZ_CP012911.1\|WP_002935725.1\|1428406_1430131_-\|septation-ring-formation-regulator-EzrA	gnl\|CDD\|179877	PRK04778, PRK04778, septation ring formation regulator EzrA; Provisional.	0
NZ_CP012911.1\|WP_002939430.1\|1432353_1432893_-\|DJ-1/PfpI-family-protein	gnl\|CDD\|153229	cd03135, GATase1_DJ-1, Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1. Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1. DJ-1 is involved in multiple physiological processes including cancer, Parkinson's disease and male fertility. It is unclear how DJ-1 functions in these. DJ-1 has been shown to possess chaperone activity. DJ-1 is preferentially expressed in the testis and moderately in other tissues; it is induced together with genes involved in oxidative stress response. The Drosophila homologue (DJ-1A) plays an essential role in oxidative stress response and neuronal maintenance. Inhibition of DJ-1A function through RNAi, results in the cellular accumulation of reactive oxygen species, organismal hypersensitivity to oxidative stress, and dysfunction and degeneration of dopaminergic and photoreceptor neurons. DJ-1 has lacks enzymatic activity and the catalytic triad of typical GATase1 domains, however it does contain the highly conserved cysteine located at the nucelophile elbow region typical of these domains. This cysteine been proposed to be a site of regulation of DJ-1 activity by oxidation. DJ-1 is a dimeric enzyme.	5.38585e-62
NZ_CP012911.1\|WP_002935718.1\|1425803_1426931_-\|glycerate-kinase	gnl\|CDD\|376844	pfam02595, Gly_kinase, Glycerate kinase family. This is family of Glycerate kinases.	2.86537e-154
NZ_CP012911.1\|WP_002935688.1\|1418246_1418963_-\|acetolactate-decarboxylase	gnl\|CDD\|226058	COG3527, AlsD, Alpha-acetolactate decarboxylase [Secondary metabolites biosynthesis, transport, and catabolism].	3.01144e-111
NZ_CP012911.1\|WP_002935689.1\|1418966_1420196_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|274350	TIGR02917, TPR_domain_protein, putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.	9.28795e-09
NZ_CP012911.1\|WP_012027447.1\|1432906_1434136_-\|FtsW/RodA/SpoVE-family-cell-cycle-protein	gnl\|CDD\|223843	COG0772, FtsW, Bacterial cell division membrane protein [Cell division and chromosome partitioning].	1.24152e-94
NZ_CP012911.1\|WP_002935706.1\|1425123_1425576_+\|DUF1694-domain-containing-protein	gnl\|CDD\|377952	pfam07997, DUF1694, Protein of unknown function (DUF1694). This family contains many hypothetical proteins.	4.17193e-27
NZ_CP012911.1\|WP_002935704.1\|1423666_1424974_-\|phosphopyruvate-hydratase	gnl\|CDD\|234617	PRK00077, eno, enolase; Provisional.	0
NZ_CP012911.1\|WP_002939427.1\|1430219_1432172_-\|DNA-topoisomerase-(ATP-hydrolyzing)-subunit-B	gnl\|CDD\|235542	PRK05644, gyrB, DNA gyrase subunit B; Validated.	0
NZ_CP012911.1\|WP_002935685.1\|1413565_1415407_-\|PTS-glucose-transporter-subunit-IIA	gnl\|CDD\|273919	TIGR01995, beta-glucosides_PTS_EIIBCA, PTS system, beta-glucoside-specific IIABC component. This model represents a family of PTS enzyme II proteins in which all three domains are found in the same polypeptide chain and which appear to have a broad specificity for beta-glucosides including salicin (beta-D-glucose-1-salicylate) and arbutin (Hydroquinone-O-beta-D-glucopyranoside). These are distinct from the closely related sucrose-specific and trehalose-specific PTS transporters.	0
NZ_CP012911.1\|WP_002935684.1\|1412126_1413551_-\|glycoside-hydrolase-family-1-protein	gnl\|CDD\|225343	COG2723, BglB, Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].	0
NZ_CP012911.1\|WP_002935686.1\|1415417_1416257_-\|PRD-domain-containing-protein	gnl\|CDD\|170086	PRK09772, PRK09772, transcriptional antiterminator BglG; Provisional.	5.00398e-63
NZ_CP012911.1\|WP_002935723.1\|1427719_1428355_-\|phosphoserine-phosphatase-SerB	gnl\|CDD\|319803	cd07500, HAD_PSP, phosphoserine phosphatase (PSP), similar to Methanococcus Jannaschii PSP and Saccharomyces cerevisiae SER2p. This family includes Methanococcus jannaschii PSP, and Saccharomyces cerevisiae phosphoserine phosphatase SER2p, EC 3.1.3.3, which participates in a pathway whereby serine and glycine are synthesized from the glycolytic intermediate 3-phosphoglycerate; phosphoserine phosphatase catalyzes the hydrolysis of phospho-L-serine to L-serine and inorganic phosphate, the third reaction in this pathway. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	3.26206e-100
NZ_CP012911.1\|WP_002935687.1\|1416562_1418221_+\|fibronectin/fibrinogen-binding-protein	gnl\|CDD\|336217	pfam05833, FbpA, Fibronectin-binding protein A N-terminus (FbpA). This family consists of the N-terminal region of the prokaryotic fibronectin-binding protein. Fibronectin binding is considered to be an important virulence factor in streptococcal infections. Fibronectin is a dimeric glycoprotein that is present in a soluble form in plasma and extracellular fluids; it is also present in a fibrillar form on cell surfaces. Both the soluble and cellular forms of fibronectin may be incorporated into the extracellular tissue matrix. While fibronectin has critical roles in eukaryotic cellular processes, such as adhesion, migration and differentiation, it is also a substrate for the attachment of bacteria. The binding of pathogenic Streptococcus pyogenes and Staphylococcus aureus to epithelial cells via fibronectin facilitates their internalisation and systemic spread within the host.	0
NZ_CP012911.1\|WP_002935722.1\|1427038_1427689_+\|HAD-family-hydrolase	gnl\|CDD\|319798	cd04302, HAD_5NT, haloacid dehalogenase (HAD)-like 5'-nucleotidases similar to the Pseudomonas aeruginosa PA0065. 5'-nucleotidases dephosphorylate nucleoside 5'-monophosphates to nucleosides and inorganic phosphate. Purified Pseudomonas aeruginosa PA0065 displayed high activity toward 5'-UMP and 5'-IMP, significant activity against 5'-XMP and 5'-TMP, and low activity against 5'-CMP. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	5.72815e-119

>NZ_CP012911.1|WP_002935700.1|1422773_1423415_-|HAD-family-hydrolase
MIEWIFFDLGSTLLDEEAAYGYYIDKCVKKLESLDIEVSSDSYKKKMVEYAHKSLDPIRATWHYFAPTEPRPLWTNEGVSLYPETIDALEKLSQNYRLGIIANQSSSIRELLKEWGIESYFQLIILSEEVGLSKPNTAIFTLALQKTNIPADRVVYVGDRYDNDILPAKSLGMWTVRILTGFGKHASENEKLKSDWVIPSLQEITNIFEQTKN
>NZ_CP012911.1|WP_002935693.1|1422555_1422741_+|hypothetical-protein
MNPVDLFNQVKELIANKDFDGAKQFIEENKDQFGEYLEQAKGLLSGSEGVNGLLDKVKGLF
>NZ_CP012911.1|WP_002935691.1|1421487_1422492_+|lactonase-family-protein
MAIYFGTYTKRESKGIYKANFDSETGQLSNLELVTEEPNPTYLAFDKAGHLYSVGAENGLGGIAAFNAEYTLLNHVVSEGAPLCYVAVDEARDLVYGSNFHKGQLLVYKRLADGSLELADVAQHEGSGPHENQASAHIHFSDLTPDKFLVTCDLGCDQVVTYKVSDQGKVEKIATYQAAPGSGPRHIVFHPVAKIAYLICELNSTIEVLIYDGWGQFEHLQTVSTLPEDHTGFNGTAAIRITKDGKFIYGSNRGNDSIAVYKTLADASLELVEIVPTNGKTPRDFTLSPDEKHLIVVHQDSDNATVFERDAENGCLTELSHDFYVPEAVCVTFL
>NZ_CP012911.1|WP_002935690.1|1420185_1421352_-|AI-2E-family-transporter
MEDKHQKFSLTWFFRLFLNSQAVTFLLVTLLTFLTIFIFSKISFLFRPIGSFLEIVLLPMILTGLLYYLLNPMVDWMEKHKISRTVGISILFVLISLLIIWGLAVAIPSIQEQVTSFAQNLPSNIQKIEGQVTGLLQDQRFEQFRPTALEMLNKVNDQIVAYAQKFSSSAVNWASNLISTASQIIVAILIMPFILFYLLRDGQYLNKHITQYLPTKWREPIGTVLSDVNGQLSNYVRGQVTVAIIVALMFSVMFSIIGLSYPITLGVMAGFLNLIPYLGSFLAMIPAVILGLIAGPIMLIKVLVVFMIEQTIEGRFVTPLIIGSSLSIHPITILFVLLTAGQMYGVLGVLLGIPIYASIKVLVKAAFEWYKAHSSLYEDEENEVVNEQ
>NZ_CP012911.1|WP_002935689.1|1418966_1420196_-|tetratricopeptide-repeat-protein
MNNSEKMLVCLDQQDLDKADKYFKRALVQDDSETLLSLAAYLEGIGFFPQARQIYEQVKEEFPEVLINLAQIAFEDGLVEEAFRYLEEISEDSSIYVEALLVKADLYQAEGLSDVAREKLLEASHLSDKPIILFGLAELDMELELFNEAISYYAQLDNREIYELTGISTYQRIGIAYASLGKFEAAIEFLEKAVELEYDDQTVFELAALLFEREEYQKANLYFKQLDTINPDFEGYEYAYAQSLHAEHKIDDALAMTQKGLAKNDFDANLLFQASQYAYELHDEAGAEDYLLRAKEVADDSNELALRLSNLYLEQERFEEVVALFDEEVDNVLARWNKAKAYQALERDDEAIALYDELAGELAENPEFLADYVAVLRQLGRLDEAKEQASRYIQLVPDDLAMQEFLNEE
>NZ_CP012911.1|WP_002935688.1|1418246_1418963_-|acetolactate-decarboxylase
MQVNRLFQYNTLGALMAGLYGGSLTVGELLEHGDLGLGTLDSIDGELIVLDGKAYQAKGAGEKPEVVEVPADMKVPYAAVIFHEAEVIFKQRFEMTSDELHQRIESYYDGENLFRSIKIKGTFSHMHVRMIPKSAFDVRFAEVASRQPEYTAENISGTIVGIWTPEIFHGVSVAGYHLHFISDDLTFGGHVMDYVISEGMVEVGPVDQLDQRFPVQDRQYLFAKFNAKEVREDIDKAE
>NZ_CP012911.1|WP_002935687.1|1416562_1418221_+|fibronectin/fibrinogen-binding-protein
MSFDGFFLHHMTAELKANLEGGRIQKINQPFEQEIILNIRSNRQSHKLLLSAHSVFGRVQLTQSDFTNPKVPNTFTMILRKYLQGAIIEEIRQLDNDRILEFSVSNKDEIGDHTQATLIVEIMGKHSNIILVDKSEQKIIEAIKHVGFSQNSYRTILPGSTYIRPPETHSLNPYTVSDEKLFEILSTQELSPKNLQQVFQGLGRDTASELASHLQTDRLKNFRAFFDQATQPSLTAKSYAALPFANSPENQPHFESLSSLLDFYYQDKAERDRVAQQANELIKRVASELEKNRKKLVKQEQELADTETAELVRQKGELLTTYLHQVPNDQASVTLDNYYTGQELEIELDVALTPSQNAQRYFKKYQKLKEAVKHLTNLIEETKATIVYLESVDTMLGQASLAEIDEIREELIETGYLKRRHREKIHKRQKPERYLATDGKTIILVGKNNLQNDELTFKMAKKGELWFHTKDIPGSHVVITDNLDPSDEVKTDAAELAAYFSKARHSNLVQVDMIEAKKLHKPTGGKPGFVTYRGQKTLRVTPTEDKIKSMKI
>NZ_CP012911.1|WP_002935686.1|1415417_1416257_-|PRD-domain-containing-protein
MIIKRVLNHNAIIAQSNKNVDILLFGKGIAFGKKVGDAIPPSSIEKSFLLKNSDNMNRFTELFIDVPIELVYVCEKIINLGKITLGNHFDEIIYINLTDHINSSIERHKEGVVVTNPLRWEIAKYYKEEFELGKKALSIIKKDLHVELPVDEAAFIALHFVNANLENIFQESYRITGIIMKIEQIIQDYYSTEFNQDSIDYYRFITHVKLFAHRLVEGNEYNDEDDVDLLELMKKKYPREYQCGTRVADFIRLEYDYLLSPSELVYLIAHIRRLTKNLS
>NZ_CP012911.1|WP_002935685.1|1413565_1415407_-|PTS-glucose-transporter-subunit-IIA
MKYKNTALAILEAVGGEKNVLRATHCVTRLRLELKDENIVSDERVKSISGVLGIMKKNGQYQIILGNDVANYYKEFTALGKFDSDSVQQVKKANVLEQVIEYIAGSMTPLIPAMLGGGMIKVLVIVLPMLGLLKADSQSISFLAFFGDAPYHFMPIFLAYSASQKLKVTPALAMSVAGILLHPNFVQMVSSGDPLHFLGAPVTPASYGSSVIPILIMVWLMKYIEAVFNKVTPAITKSFLQPTLVLLVSGFIALVLVGPLGVIVGEGLSQLVEQMHGVAGWLTLAVLGAIMPFIVMTGMHWAFAPIFLAASIATPDVLILPAMLGSNLAQGAASMAVAFKSKNSNTKQIAFAAGFSALFAGVTEPALYGVTLKYKKPLYAAMIGGGLAGLFVGLTGVKAYLFAVPSLIALPQFIYSEAASNITNAMIAAAISIIVTFILAYFLGIDEETSTVNLEKVAPGISSRKNVFSPLSGQILPLEKVNDATFSKKMLGEGVAIIPKDGKVYAPFDGAITSLFPTKHAIGLTSDEGVELLIHFGLETVELKGRGFVSHVSDGEKVEKGQLMLEVDVEMLVAEGYDIVTPVVVTNTQEYLDVLLLSTKEEVNYADDLLAVL
>NZ_CP012911.1|WP_002935684.1|1412126_1413551_-|glycoside-hydrolase-family-1-protein
MSIFPDNFLWGGAVAANQVEGAYNEGGKGLSVQDVLPNGGLGEATQEPTEDNLKLQAIDFYHRYKEDIALFSELGFKVFRTSIAWSRIFPNGDEEFPNEEGLQFYDELFDELLKNGIEPLVTLSHYETPLYLARKYHGWVDRKMIQFFEKFARTVFERYKDKVKYWLTFNEVNSVLELPFTSGGIDLPNEELSKQDLYQAIHHELVASSLVTKIAHEIIPDCKVGCMVLAMPTYPMTPNPEDVWAAHAYENLNYLFSDIHVRGYYPNYAKRYFKENGIKITFMEGDEELLKNNTVDFLSFSYYMSITQAADPSKYSSGRGNILGGLVNPYLEASDWGWQIDPIGLRLTLNRYYDRYQIPLFIVENGLGAKDQLVKDEAGGLTVHDDYRIQYMQEHLLQVAEAIQDGVEVMGYTSWGCIDCVSMSTAQLSKRYGLIYVDRNDDGSGSLTRYRKKSFYWYKEVIQSNGSILGNSSK
>NZ_CP012911.1|WP_002935704.1|1423666_1424974_-|phosphopyruvate-hydratase
MSIITDVYAREVLDSRGNPTLEVEVYTESGAFGRGMVPSGASTGEHEAVELRDGDKSRYLGLGTQKAVDNVNNVIADAIIGFDVRDQQAIDRAMIALDGTPNKGKLGANAILGVSIAVARAAADYLEVPLYTYLGGFNTKVLPTPMMNIINGGSHSDAPIAFQEFMILPVGAPSFKEGLRWGAEVFHALKKILKARGLVTAVGDEGGFAPKFEGTEDGVETIIEAIEAAGYEAGENGIMIGFDCASSEFYDKERKVYDYTKFEGEGAAVRTSAEQIDYLEELVNKYPIITIEDGMDENDWDGWKALTERLGKRVQLVGDDFFVTNTDYLARGIKEGAANSILIKVNQIGTLTETFEAIEMAKEAGYTAVVSHRSGETEDSTIADIAVATNAGQIKTGSLSRTDRIAKYNQLLRIEDQLGEVAVYKGLNSFYNLKK
>NZ_CP012911.1|WP_002935706.1|1425123_1425576_+|DUF1694-domain-containing-protein
MNDLNTTILQKASGETRLNPDEQRLYMGTYRERVVLIVSFDDLSSEVVGNKFDTICQKLANSYSPLFLKLSPALSDKQQISLLKIAQTFGITTAIIDEKIGQSPYALVFHTNHAVDNEEVSLESIFPNIISKPEEKKEDAKPSFWKKLFG
>NZ_CP012911.1|WP_002935708.1|1425585_1425813_-|hypothetical-protein
MELVKDVAIILFIFICLAKLVSVMRLSEKERGMEMNVIKANGAMFFFNEKNERGRLLGILCLTCIIFSLIFILLY
>NZ_CP012911.1|WP_002935718.1|1425803_1426931_-|glycerate-kinase
MHILIAPDSFKESLSATKVAEAIKKGFSKVYPQAGYDLIPLGDGGEGTVESLMQALSLDGTQTWVTGPFGDKIKVSYAVKDDLAVFEMAEIVGLASIPHERRSPLFIKTQGVGELIVELVQNGVKRIFIGVGGSASHDGGIGMAAGLGVKFYNREGKEVEAIGAHIGEIVSFSTEDMLVDLSQVRIDLVTDVENPLCGPAGATFVFAGQKGLAPAEFELVDKKMESFYKLVNPMLLDLAGAGAGGGMAAGLVQFAGARIQKGIDFVLDQLDFAHRVTKADLVVVGEGRMDAQSLSGKTPIGVARRTPTGIPIIAICGSLKDDLPEFPFENICAAFPIIASVESLEDTLQKAEKNLVRTAEQVARILQLGGQQRWN
>NZ_CP012911.1|WP_002935722.1|1427038_1427689_+|HAD-family-hydrolase
MYQTILFDLDGTLTDSGQGILNSVAYALEKMGIEEPDTANLNRFIGPPLYESFSRFYQLNPEDTQSAVDTFRVYFKEKGMFENQLYPGIIPLLEELRTAGKTLVIATSKPEIFAKQILEHFGIAHYFDIIAGASLDSSRISKADVIGYAINQLEAFPKHAVMIGDREHDIEGARMHQLPAIGVLYGYGNKQEFEKAGATMIVETVQDLKRVLLTTE
>NZ_CP012911.1|WP_002935723.1|1427719_1428355_-|phosphoserine-phosphatase-SerB
MTTGLLVMDVDSTLILEEGIDLLGEEAGLGAQVAAITERAMRGELDFEEALRERVALLKGLPVSVFDRIIKKIHFTPGAAELVSELKMRGYKVAVVSGGFHETVDRLAAQLELDYVRANRLEVVDGVLTGQVLGEIVTKDTKKACLEEWAAENGLSLSQTIAMGDGANDLPMIQRAGIGVAFCAKPIVQEQAPYQINEKNLYKLIEILDSK
>NZ_CP012911.1|WP_002935725.1|1428406_1430131_-|septation-ring-formation-regulator-EzrA
MPTGTIILIVSIVIILIIAYVACLIVRKRNDNLLVALEERKEELFNLPVNEEVEAVKALHLIGQSQVSFREWNQKWVDLSLNSFADIENHIFEAEGYNNAFRFVSAKNAIDSIESQIDLIEEDIASIRHGLMELKEQEEKNSGRVKHALNLFDSLQEAVRENPDSYGETLPELEKQLKNIEVEFSEFVMLNSSGDPIEASEILDKTEEHMIALNQIMDRIPSLIERVTKDFPEQLEDLESGYRKLVEQNYLFTEANIESQFQNIRVSIRENTALIVSFDLDAAEAENEGIQAKIDHLYKVFNREIEANKEAVKISKNLPKFLEHVVQNTQLLDEESQRLNATYLLADSKLSRINQLKARLESIEIVVTESVEDIENPQVAYSILEERLDHSLASLKEIEEEQFVLADYLKSQELSENTARKKATLYINKLHTLKRYMEKRNLPGIPAEFLTNFFRTSDHVEALIAELDYKRINIEVVNRLLENATYDMNQLEELAYLIVQNATLTEQLLQYSNRYRSFDESVQKAFNRSLSIFEKDFDYQAAFEEISFALETVEPGVTERFVRSYEKTREAIRY
>NZ_CP012911.1|WP_002939427.1|1430219_1432172_-|DNA-topoisomerase-(ATP-hydrolyzing)-subunit-B
MTEEIKDLQEKAQEYDASQIQVLEGLEAVRMRPGMYIGSTSKEGLHHLVWEIVDNSIDEALAGFADKIEVYIEPDNSITVIDNGRGIPVDIQEKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVHVYKNGQVYFQEYKRGEVVADLEVVGETDRSGTTVHFTPDPEIFTETTEFDFAKLNKRIQELAFLNRGLNLSITDKREGVEQTKEYHYEGGIASYVEYLNENKDVIFETPIYTEGEMDDITVEVAMQYTTSYHENVVSFANNIHTHEGGTHEQGFRTALTRVINDYAKKNKILKENEDNLTGEDVREGLTAVISVKHPGPQFEGQTKTKLGNSEVVKITNRLFSDAFAEFLLENPQIARRIVEKGILASKARIAAKRAREVTRKKSGLEISNLPGKLADCSSNDATKTELFIVEGDSAGGSAKSGRDREFQAILPIRGKILNVEKASMDKILANEEIRSLFTAMGTGFGADFDVSKARYQKLVIMTDADVDGAHIRTLLLTLFYRYMRPVVEAGYVYIAQPPIYGIKVGSEIKEYIQPGVNQEQELQDALERHSTGRSKPTIQRYKGLGEMDDHQLWETTMNPENRLMARVSVDDAAEADKIFDMLMGDKVEPRREFIEENAVYSTLDV
>NZ_CP012911.1|WP_002939430.1|1432353_1432893_-|DJ-1/PfpI-family-protein
MTRVAVVLADGFEEIEALAPVDVFRRAHFDCQIVGLDSHEVEGSHGIRVQTDQVFDGDLSSFDLIVLPGGMPGSVHLRDSESLITELQRAVASGKSVAAICAAPIVLDKAGLLDSRHYTCFPGKEKDIPSGILLEEDVVVDGPIITSRGAGTSLDFAYKLVDLFGGDGESLAQTMVYHS
>NZ_CP012911.1|WP_012027447.1|1432906_1434136_-|FtsW/RodA/SpoVE-family-cell-cycle-protein
MRKLMKNRGTIDSRVDYSLILPVFFLLVVGIISLYIAVSQDYPDNVVQMVGQQIAWIGIGTVAAFLVMFFSTKFLWQITPYLYVLGLGLMVLPLFFYSPDLVASTGAKNWVTIGGMTLFQPSEFMKIAYIIMLSRVIVTFHKYYPNRKIREDFMLIGYMTLFTIPVLILLALQKDLGTSLVFVAIFSGMLLLSGVSWKILLPTALTGIVLVGGFMLIFISPGGTTFLHNLGMDTYKINRIAAWLDPFKNAQSTTYQQAQSLIAIGSGGLKGLGFNKTNLLIPVRESDMIFTVIGEDFGFIGGTVLIGLYLLLIYRMLRVTLKSNNRYYTYISTGYIMMLLFHVFENVGAATGLLPLTGIPLPFISQGGSSMVSNLIGVGLVLSMGYQSRLADEKETNRSRRYRKITIKR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP012911_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012911_3

1989190-1989299

Orphan

Consensus_repeat	Method
ACTTGATTGGTTGTTAGGTCAACAGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP012911_3

>merge|NZ_CP012911|3|1989190-1989299|CRISPRCasFinder
ACTTGATTGGTTGTTAGGTCAACAGTTGCCTGAACGGTCTCATTTGTGTTTCCCTGAACAGGAGCTTCAATCTCAACCTGAGTCACTTGATTGGTTGTTAGGTCAACAGT

>NZ_CP012911|3|3|1989190-1989299|CRISPRCasFinder
ACTTGATTGGTTGTTAGGTCAACAGT	TGCCTGAACGGTCTCATTTGTGTTTCCCTGAACAGGAGCTTCAATCTCAACCTGAGTC
ACTTGATTGGTTGTTAGGTCAACAGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012911.1\|WP_002935958.1\|1991054_1991945_+\|ribonuclease-HIII	unknown	unknown	gnl\|CDD\|234886
NZ_CP012911.1\|WP_002935962.1\|1995175_1996117_-\|HAD-IC-family-P-type-ATPase	unknown	unknown	gnl\|CDD\|319783
NZ_CP012911.1\|WP_002935957.1\|1989986_1990970_-\|Gfo/Idh/MocA-family-oxidoreductase	unknown	unknown	gnl\|CDD\|223745
NZ_CP012911.1\|WP_002935973.1\|2000147_2000906_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223673
NZ_CP012911.1\|WP_002935969.1\|1999371_2000163_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224041
NZ_CP012911.1\|WP_002935940.1\|1978444_1978822_-\|DUF1310-family-protein	unknown	unknown	gnl\|CDD\|369168
NZ_CP012911.1\|WP_002935959.1\|1991954_1992584_+\|signal-peptidase-I	unknown	unknown	gnl\|CDD\|274044
NZ_CP012911.1\|WP_053866400.1\|1986480_1988106_+\|alpha,alpha-phosphotrehalase	unknown	unknown	gnl\|CDD\|274115
NZ_CP012911.1\|WP_002935939.1\|1978140_1978398_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012911.1\|WP_002935966.1\|1997409_1998219_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|238693
NZ_CP012911.1\|WP_002935948.1\|1983090_1983402_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012911.1\|WP_002935965.1\|1997069_1997249_-\|cation-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|225127
NZ_CP012911.1\|WP_014636769.1\|1992647_1995137_+\|ATP-dependent-RecD-like-DNA-helicase	unknown	unknown	gnl\|CDD\|273632
NZ_CP012911.1\|WP_053866399.1\|1984405_1986400_+\|PTS-system-trehalose-specific-EIIBC-component	unknown	unknown	gnl\|CDD\|273916
NZ_CP012911.1\|WP_012774930.1\|1983459_1984173_-\|trehalose-operon-repressor	unknown	unknown	gnl\|CDD\|274116
NZ_CP012911.1\|WP_002935945.1\|1982545_1983094_-\|CvpA-family-protein	unknown	unknown	gnl\|CDD\|224205
NZ_CP012911.1\|WP_002935967.1\|1998312_1999341_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270279
NZ_CP012911.1\|WP_002935938.1\|1977656_1978046_-\|DUF1310-family-protein	unknown	unknown	gnl\|CDD\|369168
NZ_CP012911.1\|WP_014636774.1\|1979103_1979496_-\|DUF1310-family-protein	unknown	unknown	gnl\|CDD\|369168
NZ_CP012911.1\|WP_002935942.1\|1979661_1981995_-\|endonuclease-MutS2	unknown	unknown	gnl\|CDD\|234750

Protein	Function_ID	Function_description	E-value
NZ_CP012911.1\|WP_053866400.1\|1986480_1988106_+\|alpha,alpha-phosphotrehalase	gnl\|CDD\|274115	TIGR02403, Trehalose-6-phosphate_hydrolase, alpha,alpha-phosphotrehalase. Trehalose is a glucose disaccharide that serves in many biological systems as a compatible solute for protection against hyperosmotic and thermal stress. This family describes trehalose-6-phosphate hydrolase, product of the treC (or treA) gene, which is often found together with a trehalose uptake transporter and a trehalose operon repressor.	0
NZ_CP012911.1\|WP_002935962.1\|1995175_1996117_-\|HAD-IC-family-P-type-ATPase	gnl\|CDD\|319783	cd02094, P-type_ATPase_Cu-like, P-type heavy metal-transporting ATPase, similar to human copper-transporting ATPases, ATP7A and ATP7B. The mammalian copper-transporting P-type ATPases, ATP7A and ATP7B are key molecules required for the regulation and maintenance of copper homeostasis. Menkes and Wilson diseases are caused by mutation in ATP7A and ATP7B respectively. This subfamily includes other copper-transporting ATPases such as: Bacillus subtilis CopA , Archeaoglobus fulgidus CopA, and Saccharomyces cerevisiae Ccc2p. This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	4.50967e-133
NZ_CP012911.1\|WP_002935957.1\|1989986_1990970_-\|Gfo/Idh/MocA-family-oxidoreductase	gnl\|CDD\|223745	COG0673, MviM, Predicted dehydrogenases and related proteins [General function prediction only].	5.03365e-57
NZ_CP012911.1\|WP_002935969.1\|1999371_2000163_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224041	COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism].	2.55864e-128
NZ_CP012911.1\|WP_002935940.1\|1978444_1978822_-\|DUF1310-family-protein	gnl\|CDD\|369168	pfam07006, DUF1310, Protein of unknown function (DUF1310). This family consists of several hypothetical proteins of around 125 residues in length. Members of this family seem to be specific to Listeria and Streptococcus species. The function of this family is unknown.	3.6891e-32
NZ_CP012911.1\|WP_002935958.1\|1991054_1991945_+\|ribonuclease-HIII	gnl\|CDD\|234886	PRK00996, PRK00996, ribonuclease HIII; Provisional.	1.5574e-152
NZ_CP012911.1\|WP_002935973.1\|2000147_2000906_-\|ABC-transporter-permease	gnl\|CDD\|223673	COG0600, TauC, ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism].	3.03791e-53
NZ_CP012911.1\|WP_002935966.1\|1997409_1998219_-\|hypothetical-protein	gnl\|CDD\|238693	cd01399, GlcN6P_deaminase, GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium. The reaction is an aldo-keto isomerization coupled with an amination or deamination. It is the last step of the metabolic pathway of N-acetyl-D-glucosamine-6-phosphate (GlcNAc6P). GlcN6P deaminase is a hexameric enzyme that is allosterically activated by GlcNAc6P.	1.10807e-36
NZ_CP012911.1\|WP_002935965.1\|1997069_1997249_-\|cation-translocating-P-type-ATPase	gnl\|CDD\|225127	COG2217, ZntA, Cation transport ATPase [Inorganic ion transport and metabolism].	1.12154e-15
NZ_CP012911.1\|WP_014636769.1\|1992647_1995137_+\|ATP-dependent-RecD-like-DNA-helicase	gnl\|CDD\|273632	TIGR01448, recD_rel, helicase, putative, RecD/TraA family. This model describes a family similar to RecD, the exodeoxyribonuclease V alpha chain of TIGR01447. Members of this family, however, are not found in a context of RecB and RecC and are longer by about 200 amino acids at the amino end. Chlamydia muridarum has both a member of this family and a RecD. [Unknown function, Enzymes of unknown specificity].	0
NZ_CP012911.1\|WP_002935942.1\|1979661_1981995_-\|endonuclease-MutS2	gnl\|CDD\|234750	PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed.	0
NZ_CP012911.1\|WP_002935967.1\|1998312_1999341_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270279	cd13561, PBP2_SsuA_like_4, Putative substrate binding domain of sulfonate binding protein-like, the type 2 periplasmic binding protein fold. This subfamily includes the periplasmic component of putative ABC-type sulfonate transport system similar to SsuA. These domains are found in eubacterial SsuA proteins that serve as initial receptors in the ABC transport of bicarbonate, nitrate, taurine, or a wide range of aliphatic sulfonates, while other closest homologs are involved in thiamine (vitamin B1) biosynthetic pathway and desulfurization (DszB). After binding the ligand, SsuA interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The SsuA proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	4.7942e-91
NZ_CP012911.1\|WP_012774930.1\|1983459_1984173_-\|trehalose-operon-repressor	gnl\|CDD\|274116	TIGR02404, Trehalose_operon_transcriptional_repressor, trehalose operon repressor, B. subtilis-type. This family consists of repressors of the GntR family typically associated with trehalose utilization operons. Trehalose is imported as trehalose-6-phosphate and then hydrolyzed by alpha,alpha-phosphotrehalase to glucose and glucose-6-P. This family includes repressors mostly from Gram-positive lineages and does not include the TreR from E. coli. [Regulatory functions, DNA interactions].	1.26063e-96
NZ_CP012911.1\|WP_002935945.1\|1982545_1983094_-\|CvpA-family-protein	gnl\|CDD\|224205	COG1286, CvpA, Uncharacterized membrane protein, required for colicin V production [General function prediction only].	2.35799e-17
NZ_CP012911.1\|WP_053866399.1\|1984405_1986400_+\|PTS-system-trehalose-specific-EIIBC-component	gnl\|CDD\|273916	TIGR01992, phosphotransferase_system_trehalose_permease, PTS system, trehalose-specific IIBC component. This model represents the fused enzyme II B and C components of the trehalose-specific PTS sugar transporter system. Trehalose is converted to trehalose-6-phosphate in the process of translocation into the cell. These transporters lack their own IIA domains and instead use the glucose IIA protein (IIAglc or Crr). The exceptions to this rule are Staphylococci and Streptococci which contain their own A domain as a C-terminal fusion. This family is closely related to the sucrose transporting PTS IIBC enzymes and the B and C domains of each are described by subfamily-domain level TIGRFAMs models (TIGR00826 and TIGR00852, respectively). In E. coli, B. subtilis and P. fluorescens the presence of this gene is associated with the presence of trehalase which degrades T6P to glucose and glucose-6-P. Trehalose may also be transported (in Salmonella) via the mannose PTS or galactose permease systems, or (in Sinorhizobium, Thermococcus and Sulfolobus, for instance) by ABC transporters.	0
NZ_CP012911.1\|WP_002935938.1\|1977656_1978046_-\|DUF1310-family-protein	gnl\|CDD\|369168	pfam07006, DUF1310, Protein of unknown function (DUF1310). This family consists of several hypothetical proteins of around 125 residues in length. Members of this family seem to be specific to Listeria and Streptococcus species. The function of this family is unknown.	5.29709e-28
NZ_CP012911.1\|WP_014636774.1\|1979103_1979496_-\|DUF1310-family-protein	gnl\|CDD\|369168	pfam07006, DUF1310, Protein of unknown function (DUF1310). This family consists of several hypothetical proteins of around 125 residues in length. Members of this family seem to be specific to Listeria and Streptococcus species. The function of this family is unknown.	9.01056e-26
NZ_CP012911.1\|WP_002935959.1\|1991954_1992584_+\|signal-peptidase-I	gnl\|CDD\|274044	TIGR02227, Inactive_signal_peptidase_IA., signal peptidase I, bacterial type. This model represents signal peptidase I from most bacteria. Eukaryotic sequences are likely organellar. Several bacteria have multiple paralogs, but these represent isozymes of signal peptidase I. Virtually all known bacteria may be presumed to A related model finds a simlar protein in many archaea and a few bacteria, as well as a microsomal (endoplasmic reticulum) protein in eukaryotes. [Protein fate, Protein and peptide secretion and trafficking].	3.57008e-39

>NZ_CP012911.1|WP_053866400.1|1986480_1988106_+|alpha,alpha-phosphotrehalase
MTIDKRKVVYQIYPKSYKDTTGNGVGDLRGIIEKLPYLKELGIDMIWLNPFYPSPQRDNGYDISDYTAVNPDFGTMADFEDMVAVGKELGIEFMLDMVLNHCSTDHEWFQKALAGDKYYQDFFILRDQPTDWVSKFGGNAWAPFGDTGKYYLHLFDVTQADLNWRNPHVREELFKVVNFWKDKGVKGFRFDVINLIGKDEVLEDCPINDGKPAYTDRPITHDYLKMMNNATFGSEKGFMTVGEMSATTIENCILYTAPEREELSMAFNFHHLKVDYKDGQKWTIMDFDFEELKRLFHTWGEEMSAGNGWNALFYNNHDQPRALNRFVDVENFRNEGATMLAASIHLSRGTPYIYMGEEIGMIDPDYDSMDDYVDVESINAYQMLLDQGHTPEQAFKIIQAKSRDNSRTPMQWDSSDNTGFSTGAPWLKAGKSYPTINVEQEKTGPIFTFYQELIRLRKELPLISEGDYKAAYNDSQKVYAFERLLNGEKLLVLNNFFAEEVELDLADDYAHGQVLISNYPDNKLGKKIILKPYQALAIQVK
>NZ_CP012911.1|WP_053866399.1|1984405_1986400_+|PTS-system-trehalose-specific-EIIBC-component
MGKFEKEAKQLLEAIGGKENVNAVTHCATRMRFVLADEKKANVKVIEDIPAVKGTFTNAGQFQVIIGNDIPIFYNDFTAVSGIEGVSKEAAKSAAKSNQNAIQRVMTMLAEIFTPIIPALIVGGLILGFRNVLEGVQMEWLGQAMKDGQLVFDADGNPVWNTIVQVSPFWNGVNHFLWLPGEAIFHFLPVGITWSVSRKMGTSQILGIVLGICLVSPQLLNAYAVPGTDAATIASDWSWNFGAFSIARIGYQAQVIPALLAGLALSYLEIFWRKVVPEVVSMIFVPFLSLLPAIILAHTVLGPIGWTIGQWLSTVVLAGLTGPLKWLFGAIFGALYAPFVITGLHHMTNAIDTQLIADAGGTGLWPMIALSNIAQGSAVFAYFLMNRHNEKEAQVSLPATISAYLGVTEPALFGVNVKYVYPFVAAMIGSSIVGLLSVTFNIQAASIGIGGLPGILSIKAEYWGAFFMTMIVAIVVPMILTAVFKRTGAFSKKEETVEEVVAPTEAVVETGAAIELISPLTGQTKELSQATDPVFASGVMGQGVLIDPTEGLLVAPVDGEISVLFPTNHAVGITATNGVEFLMHIGMDTVGLEGKGFTAHVKQGDKVKAGDKLISFDIDVIKAAGLVAETPVIVTNQTDFDTQVIGNLPRAISQGEAILTVTKN
>NZ_CP012911.1|WP_012774930.1|1983459_1984173_-|trehalose-operon-repressor
MKKYQEIYNDLKEKIRTNVYPAESSLPTEQQLQEIYGVSRDTVRKALAILTEGGLIQKVQGRGSMVLKQEILNFPVSGLTSYQELTNVLQLSTKTDVVSLDMITVNSSLSHLTGFEPYSKVWKVVRTRSIDGKVSVVDTDYLAVDVVPELTTAIAEKSIYEYLENKLGLDIAYAQKEITVEPTNREERELMQSKDDYLVLIKSRVYLGDTQQFQYTESKHKIDKFRFVDFARRKHSL
>NZ_CP012911.1|WP_002935948.1|1983090_1983402_-|hypothetical-protein
MANLNRYKFTFGEKQLTLTTEHDNLFMEEIERIAQEKYQAIKEKMPTADPETLALLLAINALSVQLTREMAFEQKEQELASVKEKVLKKNVTLIDLDELEDKV
>NZ_CP012911.1|WP_002935945.1|1982545_1983094_-|CvpA-family-protein
MISLAIILILAWSFYIGYSRGLVLQAFYSMGSIIALVVATATYKKLASFLYLWVPFANATQGSSNYYFDEKYLFDLDMVFYAGLAFLLIYVLVYAIVRFIGIFVHLLEAFNPDTKTTNLISGALAVLVTFISLQIVMVLLSTIPLAMIQDKLHSSFLANIMIQYTPFTSSFLKSLWLSNIAG
>NZ_CP012911.1|WP_002935942.1|1979661_1981995_-|endonuclease-MutS2
MNNKIIETLEFHKVRQKIEPYLLTEQGFEELRQLEPMVEVQRIQQAFDELTDIAQIFVENPYFSLSATSDIGPAMRRLELDTDLNIAELLAVKKVLEVSKSLLDFYGNLENVSLSQLDKLFEKIELFPHLQGSLQSINDAGFVEDFASEKLARIRRKIREAEDQVRQVMQDILKTKGDMLSDSILASRNGRNVLPVKNTYRNKIAGVVHDISASGSTVYIEPRAVVTLNEEISHLRAEERHELNRILQELSDMLRPHSGVIRNNAWLIGHIDFVRAKHLFAREHQAVVPKLSEKQDIALLNVRHPLIAKPVPNDLYFGSQLTAIVITGPNTGGKTIMLKTLGLTHLMAQSGLPILADKGSRVAIFKEIFADIGDEQSIEQSLSTFSSHMTHTVQILAEADQDSLILFDELGAGTDPQEGASLAMAILDDLRLRGIKTMATTHYPELKAYGIETSGIENASMEFDTNSLRPTYKFMQGVPGRSNAFEIARRLGLSDIIIQSAQSWTDTDSDVNRIIEKLESQTVESRQRLDKIRDVEQENYKMNRALRKLYDELNRERENELNKARLEAKEIVDMALAESEDILKNLHAAASLKPHQIIEAKAELKKLAPEVVDLSKNKVLKKAKIQREAKVGDDIIVTAYGQRGTLTNQLKDGRWEAQVGLIKMTLAKDEFELVKAEKAEQPKKRQVHTVKRANVRGPKARLDLRGKRYEEAMMELDEFIDQALLNNLAQVDIVHGIGTGVIREGVTKYLRRNKQVKEFGYAPQNAGGSGCTIVTFK
>NZ_CP012911.1|WP_014636774.1|1979103_1979496_-|DUF1310-family-protein
MKKVMKVIIGILLVIGIGIGGIKLMQKIEHDQMVEIVKSEEVREIVEEQLKYLDNEALSEDGLIKTYEIDDSSIIHSPMGGISFNVFLNSDRKLRVVFELEKDSNTGKIEYSGGGYSSEVKKLVGEINND
>NZ_CP012911.1|WP_002935940.1|1978444_1978822_-|DUF1310-family-protein
MKKVMKVIIGILLVIGIGIGGFVYMQHKEHEKMVAIATSEEARAVYEKHMKANDPKALTADGIIKTYEIDTETLEYNPMGGMIVRVYVNGDEDFGFHFNLLQNEDGKFKSGSYVIKSKLADLLGK
>NZ_CP012911.1|WP_002935939.1|1978140_1978398_-|hypothetical-protein
MTEYNNLGKGDAVITQYDDIVGRVTLDFDNENGNGEQVYAVVKDPNLPEDQVTEVMVLFRGSTGSNEVLTKPADVWNDWGESILS
>NZ_CP012911.1|WP_002935938.1|1977656_1978046_-|DUF1310-family-protein
MKIVVKILVGILIAIAIGIGGFKLMQKIEHDQMVEIVKGEEVRKMVEERLISYDAKALTEEGIIRSYSIDSASIRRNPMGGINFSVYLNNDDTLYINYRIEKIRDDIVKLVGGGKSSDLTRLLGEEANE
>NZ_CP012911.1|WP_002935957.1|1989986_1990970_-|Gfo/Idh/MocA-family-oxidoreductase
MEVQMKYKWATLGTGVIANELVQALQDMGGNLYSVANRTYDKGVEFAQKYGIEKVYREIDEVFEDPEVDIIYISTPHNTHINYLRKALKAGKHVLCEKSITLNSEELAEAIQLAEENQVVLAEAMTIFHMPIYRQLSEVIASGKLGDLKMIQMNFGSYKEYDMTNRFFNKNLAGGALLDIGVYALSFVRWFMTEKPNQVLSQVKLAPTGVDEQVGILLSNDAGEMATTALTLHAKQPKRGTIAYDKGYIELYEYPRGQKAVITYTEDGSQEVIEAGETARALSYEVADMEKAVAGIENTMHLAFTQDVMEIMTQLRKEWGLVYPEEM
>NZ_CP012911.1|WP_002935958.1|1991054_1991945_+|ribonuclease-HIII
MNTVVLKASAQQKQAMMAHYDRYRQTSKNPYIEAFFKLTGASLSIYTSGKVVFQGEMAEQEAGLWGYGPESSGQTTIPGQNLPMIGTDEVGNGSYFGGLAVVASFVRPEDHAFLKSLGVDDSKKMTDQKICQIAPLLKEKIPHQALLLSPKKYNEVIEQGYNAVSVKVALHNQAIFLLLQKGVQPEKIVIDAFTSSQNYQKYLKKEANQFANPVTLEEKAEGKYLAVAVSSIIARAMFLENLVQLGQLVGMNLPSGAGSKSDQVAASILKQYGMAGLNQTAKLHFANTQKAQKLLK
>NZ_CP012911.1|WP_002935959.1|1991954_1992584_+|signal-peptidase-I
MGAIQKTKRSPLVAFLAEWGIFLLFMAAFFASRYFIWNPVSVDGHSMDPTLQHQEKLIMLKTTSIDRFDIVVASETDSDGKEKLIVKRVIGMPGDTIRYENDVLYVNDQKVDEPYLDEYLAAFQKDKLQEVYSYNKQFQAVAQSAEAFTQDANGYVDFTVTVPEGQYYLMGDDRLVSLDSRSVGTFSRENIKGEVVFRMWPLNRIGTVD
>NZ_CP012911.1|WP_014636769.1|1992647_1995137_+|ATP-dependent-RecD-like-DNA-helicase
MNEVYFTGTIDRIIFENPSNFYKILLLEIEETDADYDDYEIIVTGTIADVIEGEDYRFYGNLVTHPKYGQQLQISRYERSKPTSAGLVKYFSSEHFKGIGRKTAEKIVELYGEDTIDKILAEPEKLTQITGLSSKNMQAFVEKLRLNYGTELILAKLAEYGIPNKLAFQIQDQYKEKTLQIIEENPYQLVEDVQGLGFTIADRIAENLGIASDSPQRFRAGMLFSLIHRSMETGDTYVEARDLLEATLELLEKSRHTELDPAAVAKELTGLIADDKVQQEGTKIFDNSLYFAEHGIHTNLTRLMGKNGFKPFPRADVEAAIAELESISSLTYDNIQKEAIVQAITNPLFILTGGPGTGKTTVINGIIAVYAILHKIDLTRNREECPVLLAAPTGRAARRMNELTGLPSATIHRHLGLVEGQEESYRDDYLDADFIIVDEFSMVDTWLANQLFQNISSQTQVLIVGDAEQLPSVSPGQVLADLLKIDKLPSITLERIYRQSDDSTIVTLASQIRQGALPSDFREKKADRSYFEAQNEQIPALIERIVGAAIKSGIPANEVQILAPMYRGAAGIDQLNTMTQALLNPLEEGELEFLHNEQAFRQGDRVIHLVNDAEANVFNGDLGYITDLLPAKYTDSKQDEITINFDGSEVTYPRNEWYKITLAYAMSIHKSQGSEFQVVILPITRTSHRMLQRNLVYTAITRSKSKLILLGEISAFDYAVKNAGTVRKTYLVPRFQGEMAEQESKESLIKKDESKTATTTQTQPPTQPDRKEQVKVVKENNQQLSLLDQDQPKKTSPQPTEYILTVDNLLTIDPMIGIEQADIEEFFKA
>NZ_CP012911.1|WP_002935962.1|1995175_1996117_-|HAD-IC-family-P-type-ATPase
MFSLSITISVLVIACPCALGLATPTAIMVGTGKGAENGLLFKSGQTIKTLQGVNTIVFDKTGTITEGKPQVTDIHLLSTKNREQVLQLAASSEQYSEHPLAQALLRSAEEESIPLLASQDFQALSGRGLSVTIAEQTIYLGNERLMREQGIDVSKGRAVAETFAHQAKTPVFLASQQEVLAVIAIADKVKETSRQAVQALQTMELEVVMLTGDNEKTAQAIAKEVGIEQVVSQVLPDDKANQVKFLQEQGKTVAMVGDYDHAFGKSYGVLMREWNLLARAVFVLNADNEIVYVEYLDNVNEHPDYKAALEAVK
>NZ_CP012911.1|WP_002935965.1|1997069_1997249_-|cation-translocating-P-type-ATPase
MKQASYPIQGVTCASCAMTVEKALNKLDGIQNASVNLATEKTNIQYDPAHLSLSDIDSC
>NZ_CP012911.1|WP_002935966.1|1997409_1998219_-|hypothetical-protein
MIEYYNFNKSELEKHSRIPLIVKKNNEEIFISLALEMVELIKENNEKNEKTVIICPVGPVGQYPHFVRLVNQFKIDLSNVWFINMDEYLLEDLHWIDVVHPLSFRGFMQKNVYSQIHPTLIMSEEQRIFPDPLDIDSISNKIKELGKIDLCIGGIGLNGHIAFNEPDSTLTVQEFLKLGSRVLPISVETKVMNGLTVLKGAVEEVPNYCVTIGMSEIFQAKKIRLAVFRDWHHAVIRKTVCSKPDTGFPSTLMQIHTNCSIYLNESLAN
>NZ_CP012911.1|WP_002935967.1|1998312_1999341_-|ABC-transporter-substrate-binding-protein
MIKFVKNKYFNWIISLITLIILVACSSNQTLIRDNSANIDKIRIAYMPNFASLHDIITGINSGIFKEEGLEVELIEFADGPTIIASLESGSIDIGNIGPGAHKLAIEGRAEVVAFSQLGNADELIARSDRGIDSIKDLRGKKIGTASGTSAETILKLALLDANLSEKDVEIIDMDASAIVTAMLSGSIDVAATWSPNTTLIKRELKEKVVVLADNSRYRDQSPAIASYVTFPGYSEKNNEKISKFLKGLYRAMDYRAEHMKEVSKWVATQIGSDITAVQDQLQDGEWLTSRQMIQLINTGILQQYYEKQQKNLIVSGIVDISRNINEYVLIDQMSSILKEIK
>NZ_CP012911.1|WP_002935969.1|1999371_2000163_-|ABC-transporter-ATP-binding-protein
MATEVKKIKVKIEEVSKSFQSIHGEVVALNQINLEIFENEIVTVVGPSGCGKSTLLNLVAGLEPVTSGKIYCDDNEIVGVGVERGVVFQQYALFPWMSVQQNVMFGPEMQGKSKLEASEIANKYIKMVGLQEFSNHYPKELSGGMKQRVAIARAYAVNPTILLMDEPFGALDAQTRIQLQDELIEMLEHERKTCLFITHDIEEAILLGNRVIIMSSRPGEIKEIVNVDLPFPRSQSIKFENDFIDIKNHIWSLVYKDFLNIKK
>NZ_CP012911.1|WP_002935973.1|2000147_2000906_-|ABC-transporter-permease
MKSNKEQKYFWLTFSLIVALMIWWFLSNYDRTSRSFPNIILVWNALLIMIDKGFIFEDIFSSLTSVFFGFTSGFLLSVPNALFMSWYSPYRNIVYPWIQYIRNIPPLAYVPLVVISAGVGLLPQVIVIAIATFLTMTVTIYQGIINIDPNLIKAARILGASDFEIFKRILVPASIPFIMTAVRLGTSISLTTIIAAESTGATSGMGMRIRSLNNSFDSSGMLLYIILIGVIGLLLNKLVDLIERKLTGWQQK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP012911_1	1.7\|1371383\|30\|NZ_CP012911\|CRT,PILER-CR	1371383-1371412	30	MK448982	Streptococcus phage Javan554, complete genome	21889-21918	0	1.0
NZ_CP012911_1	1.2\|1371382\|31\|NZ_CP012911\|CRISPRCasFinder	1371382-1371412	31	MK448982	Streptococcus phage Javan554, complete genome	21888-21918	1	0.968
NZ_CP012911_1	1.4\|1371513\|31\|NZ_CP012911\|CRISPRCasFinder	1371513-1371543	31	NZ_AP014865	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence	95334-95364	6	0.806
NZ_CP012911_1	1.9\|1371514\|30\|NZ_CP012911\|CRT,PILER-CR	1371514-1371543	30	NZ_AP014865	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence	95334-95363	6	0.8
NZ_CP012911_1	1.9\|1371514\|30\|NZ_CP012911\|CRT,PILER-CR	1371514-1371543	30	MT773554	Myoviridae sp. isolate BML_2 genomic sequence	208851-208880	6	0.8
NZ_CP012911_1	1.9\|1371514\|30\|NZ_CP012911\|CRT,PILER-CR	1371514-1371543	30	MH830362	Enterococcus faecalis plasmid p4, complete sequence	59075-59104	6	0.8
NZ_CP012911_1	1.9\|1371514\|30\|NZ_CP012911\|CRT,PILER-CR	1371514-1371543	30	NC_006979	Streptococcus pyogenes plasmid pSM19035, complete sequence	4622-4651	6	0.8
NZ_CP012911_1	1.9\|1371514\|30\|NZ_CP012911\|CRT,PILER-CR	1371514-1371543	30	NC_006979	Streptococcus pyogenes plasmid pSM19035, complete sequence	12800-12829	6	0.8
NZ_CP012911_1	1.9\|1371514\|30\|NZ_CP012911\|CRT,PILER-CR	1371514-1371543	30	NZ_LR135180	Enterococcus faecium isolate E0595 plasmid 2	49583-49612	6	0.8
NZ_CP012911_1	1.9\|1371514\|30\|NZ_CP012911\|CRT,PILER-CR	1371514-1371543	30	NZ_CP023514	Enterococcus sp. FDAARGOS_375 plasmid unnamed1, complete sequence	115465-115494	6	0.8
NZ_CP012911_1	1.9\|1371514\|30\|NZ_CP012911\|CRT,PILER-CR	1371514-1371543	30	NZ_CP049777	Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence	4829-4858	6	0.8
NZ_CP012911_1	1.9\|1371514\|30\|NZ_CP012911\|CRT,PILER-CR	1371514-1371543	30	NC_006978	S.pyogenes plasmid pMD101 DNA	4622-4651	6	0.8
NZ_CP012911_1	1.9\|1371514\|30\|NZ_CP012911\|CRT,PILER-CR	1371514-1371543	30	NC_006978	S.pyogenes plasmid pMD101 DNA	12800-12829	6	0.8
NZ_CP012911_1	1.9\|1371514\|30\|NZ_CP012911\|CRT,PILER-CR	1371514-1371543	30	NZ_CP045673	Bacillus subtilis strain 2014-3557 plasmid pGMrib, complete sequence	9754-9783	6	0.8
NZ_CP012911_1	1.9\|1371514\|30\|NZ_CP012911\|CRT,PILER-CR	1371514-1371543	30	NZ_CP038866	Vagococcus sp. CF-49 plasmid punnamed1, complete sequence	19477-19506	6	0.8
NZ_CP012911_1	1.9\|1371514\|30\|NZ_CP012911\|CRT,PILER-CR	1371514-1371543	30	NZ_AP018541	Enterococcus faecalis strain KUB3006 plasmid pKUB3006-3, complete sequence	4029-4058	6	0.8
NZ_CP012911_1	1.9\|1371514\|30\|NZ_CP012911\|CRT,PILER-CR	1371514-1371543	30	NZ_CP028728	Enterococcus faecium strain FSIS1608820 plasmid pFSIS1608820, complete sequence	4980-5009	6	0.8
NZ_CP012911_1	1.9\|1371514\|30\|NZ_CP012911\|CRT,PILER-CR	1371514-1371543	30	NZ_CP033741	Enterococcus sp. FDAARGOS_553 plasmid unnamed2, complete sequence	58987-59016	6	0.8
NZ_CP012911_1	1.9\|1371514\|30\|NZ_CP012911\|CRT,PILER-CR	1371514-1371543	30	JN638751	Bacillus phage G, complete genome	457897-457926	6	0.8
NZ_CP012911_1	1.2\|1371382\|31\|NZ_CP012911\|CRISPRCasFinder	1371382-1371412	31	NZ_CP013208	Paenibacillus sp. IHB B 3084 plasmid pHD05, complete sequence	11447-11477	7	0.774
NZ_CP012911_1	1.4\|1371513\|31\|NZ_CP012911\|CRISPRCasFinder	1371513-1371543	31	NZ_CP050184	Bacillus thuringiensis strain HER1410 plasmid pLUSID1, complete sequence	168570-168600	7	0.774
NZ_CP012911_1	1.4\|1371513\|31\|NZ_CP012911\|CRISPRCasFinder	1371513-1371543	31	MT773554	Myoviridae sp. isolate BML_2 genomic sequence	208851-208881	7	0.774
NZ_CP012911_1	1.4\|1371513\|31\|NZ_CP012911\|CRISPRCasFinder	1371513-1371543	31	JN638751	Bacillus phage G, complete genome	457897-457927	7	0.774
NZ_CP012911_1	1.6\|1371317\|30\|NZ_CP012911\|CRT	1371317-1371346	30	AJ609634	Bacteriophage EJ-1 proviral DNA, complete genome	6909-6938	7	0.767
NZ_CP012911_1	1.6\|1371317\|30\|NZ_CP012911\|CRT	1371317-1371346	30	NC_005294	Streptococcus prophage EJ-1, complete genome	6909-6938	7	0.767
NZ_CP012911_1	1.6\|1371317\|30\|NZ_CP012911\|CRT	1371317-1371346	30	KY065449	Streptococcus phage IPP5, complete genome	7026-7055	7	0.767
NZ_CP012911_1	1.7\|1371383\|30\|NZ_CP012911\|CRT,PILER-CR	1371383-1371412	30	NZ_CP013208	Paenibacillus sp. IHB B 3084 plasmid pHD05, complete sequence	11448-11477	7	0.767
NZ_CP012911_1	1.7\|1371383\|30\|NZ_CP012911\|CRT,PILER-CR	1371383-1371412	30	NZ_MG205643	Paeniclostridium sordellii strain S0804018 plasmid pCS1-5, complete sequence	56962-56991	7	0.767
NZ_CP012911_1	1.9\|1371514\|30\|NZ_CP012911\|CRT,PILER-CR	1371514-1371543	30	NZ_CP050184	Bacillus thuringiensis strain HER1410 plasmid pLUSID1, complete sequence	168570-168599	7	0.767
NZ_CP012911_1	1.9\|1371514\|30\|NZ_CP012911\|CRT,PILER-CR	1371514-1371543	30	MN698241	Pelagibacter phage HTVC027P, complete genome	2493-2522	7	0.767
NZ_CP012911_1	1.9\|1371514\|30\|NZ_CP012911\|CRT,PILER-CR	1371514-1371543	30	NZ_KP342511	Enterococcus faecium isolate N12-493 plasmid pEfm12493, complete sequence	110379-110408	7	0.767
NZ_CP012911_1	1.9\|1371514\|30\|NZ_CP012911\|CRT,PILER-CR	1371514-1371543	30	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	25618-25647	7	0.767
NZ_CP012911_1	1.9\|1371514\|30\|NZ_CP012911\|CRT,PILER-CR	1371514-1371543	30	NC_018146	Zymomonas mobilis subsp. mobilis ATCC 29191 plasmid pZZ6.01, complete sequence	12440-12469	7	0.767
NZ_CP012911_1	1.9\|1371514\|30\|NZ_CP012911\|CRT,PILER-CR	1371514-1371543	30	MK448723	Streptococcus phage Javan271, complete genome	40059-40088	7	0.767
NZ_CP012911_1	1.9\|1371514\|30\|NZ_CP012911\|CRT,PILER-CR	1371514-1371543	30	MN694526	Marine virus AFVG_250M936, complete genome	24666-24695	7	0.767
NZ_CP012911_1	1.9\|1371514\|30\|NZ_CP012911\|CRT,PILER-CR	1371514-1371543	30	MF417925	Uncultured Caudovirales phage clone 3F_9, partial genome	23924-23953	7	0.767
NZ_CP012911_1	1.1\|1371316\|31\|NZ_CP012911\|CRISPRCasFinder	1371316-1371346	31	AJ609634	Bacteriophage EJ-1 proviral DNA, complete genome	6908-6938	8	0.742
NZ_CP012911_1	1.1\|1371316\|31\|NZ_CP012911\|CRISPRCasFinder	1371316-1371346	31	NC_005294	Streptococcus prophage EJ-1, complete genome	6908-6938	8	0.742
NZ_CP012911_1	1.1\|1371316\|31\|NZ_CP012911\|CRISPRCasFinder	1371316-1371346	31	KY065449	Streptococcus phage IPP5, complete genome	7025-7055	8	0.742
NZ_CP012911_1	1.4\|1371513\|31\|NZ_CP012911\|CRISPRCasFinder	1371513-1371543	31	MN698241	Pelagibacter phage HTVC027P, complete genome	2493-2523	8	0.742
NZ_CP012911_1	1.4\|1371513\|31\|NZ_CP012911\|CRISPRCasFinder	1371513-1371543	31	NZ_KP342511	Enterococcus faecium isolate N12-493 plasmid pEfm12493, complete sequence	110379-110409	8	0.742
NZ_CP012911_1	1.4\|1371513\|31\|NZ_CP012911\|CRISPRCasFinder	1371513-1371543	31	NC_018146	Zymomonas mobilis subsp. mobilis ATCC 29191 plasmid pZZ6.01, complete sequence	12440-12470	8	0.742
NZ_CP012911_1	1.4\|1371513\|31\|NZ_CP012911\|CRISPRCasFinder	1371513-1371543	31	MK448723	Streptococcus phage Javan271, complete genome	40058-40088	8	0.742
NZ_CP012911_1	1.4\|1371513\|31\|NZ_CP012911\|CRISPRCasFinder	1371513-1371543	31	MN694526	Marine virus AFVG_250M936, complete genome	24665-24695	8	0.742
NZ_CP012911_1	1.4\|1371513\|31\|NZ_CP012911\|CRISPRCasFinder	1371513-1371543	31	KM236242	Escherichia phage Pollock, complete genome	39296-39326	8	0.742
NZ_CP012911_1	1.9\|1371514\|30\|NZ_CP012911\|CRT,PILER-CR	1371514-1371543	30	NZ_CP016746	Lactococcus lactis subsp. cremoris strain JM1 plasmid pMPJM1, complete sequence	94403-94432	8	0.733
NZ_CP012911_1	1.9\|1371514\|30\|NZ_CP012911\|CRT,PILER-CR	1371514-1371543	30	NZ_MG973074	Clostridioides difficile strain HSJD-312 plasmid pHSJD-312, complete sequence	26275-26304	8	0.733
NZ_CP012911_1	1.9\|1371514\|30\|NZ_CP012911\|CRT,PILER-CR	1371514-1371543	30	KM236242	Escherichia phage Pollock, complete genome	39297-39326	8	0.733
NZ_CP012911_1	1.4\|1371513\|31\|NZ_CP012911\|CRISPRCasFinder	1371513-1371543	31	NZ_CP016746	Lactococcus lactis subsp. cremoris strain JM1 plasmid pMPJM1, complete sequence	94403-94433	9	0.71
NZ_CP012911_1	1.4\|1371513\|31\|NZ_CP012911\|CRISPRCasFinder	1371513-1371543	31	NZ_MG973074	Clostridioides difficile strain HSJD-312 plasmid pHSJD-312, complete sequence	26275-26305	9	0.71
NZ_CP012911_1	1.9\|1371514\|30\|NZ_CP012911\|CRT,PILER-CR	1371514-1371543	30	MK613349	Roseobacter phage CRP-7, complete genome	9357-9386	9	0.7

1. spacer 1.7|1371383|30|NZ_CP012911|CRT,PILER-CR matches to MK448982 (Streptococcus phage Javan554, complete genome) position: , mismatch: 0, identity: 1.0

gacaaggtcgaaaagaaatacattgatgtt	CRISPR spacer
gacaaggtcgaaaagaaatacattgatgtt	Protospacer
******************************

2. spacer 1.2|1371382|31|NZ_CP012911|CRISPRCasFinder matches to MK448982 (Streptococcus phage Javan554, complete genome) position: , mismatch: 1, identity: 0.968

cgacaaggtcgaaaagaaatacattgatgtt	CRISPR spacer
ggacaaggtcgaaaagaaatacattgatgtt	Protospacer
 ******************************

3. spacer 1.4|1371513|31|NZ_CP012911|CRISPRCasFinder matches to NZ_AP014865 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence) position: , mismatch: 6, identity: 0.806

ctttcctcttttacttctttatttgttacta	CRISPR spacer
cagtattcttttaattctttatttgttactg	Protospacer
*  * .******* ****************.

4. spacer 1.9|1371514|30|NZ_CP012911|CRT,PILER-CR matches to NZ_AP014865 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence) position: , mismatch: 6, identity: 0.8

tttcctcttttacttctttatttgttacta	CRISPR spacer
agtattcttttaattctttatttgttactg	Protospacer
  * .******* ****************.

5. spacer 1.9|1371514|30|NZ_CP012911|CRT,PILER-CR matches to MT773554 (Myoviridae sp. isolate BML_2 genomic sequence) position: , mismatch: 6, identity: 0.8

tttcctcttttacttctttatttgttacta	CRISPR spacer
tttcctcttttaactctttatttgcaagaa	Protospacer
************ .**********. *  *

6. spacer 1.9|1371514|30|NZ_CP012911|CRT,PILER-CR matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 6, identity: 0.8

tttcctcttttacttcttta-tttgttacta	CRISPR spacer
cgtcctctttttcttctttattttgttgtt-	Protospacer
. ********* ******** ******..*

7. spacer 1.9|1371514|30|NZ_CP012911|CRT,PILER-CR matches to NC_006979 (Streptococcus pyogenes plasmid pSM19035, complete sequence) position: , mismatch: 6, identity: 0.8

tttcctcttttacttcttta-tttgttacta	CRISPR spacer
cgtcctctttttcttctttattttgttgtt-	Protospacer
. ********* ******** ******..*

8. spacer 1.9|1371514|30|NZ_CP012911|CRT,PILER-CR matches to NC_006979 (Streptococcus pyogenes plasmid pSM19035, complete sequence) position: , mismatch: 6, identity: 0.8

tttcctcttttacttcttta-tttgttacta	CRISPR spacer
cgtcctctttttcttctttattttgttgtt-	Protospacer
. ********* ******** ******..*

9. spacer 1.9|1371514|30|NZ_CP012911|CRT,PILER-CR matches to NZ_LR135180 (Enterococcus faecium isolate E0595 plasmid 2) position: , mismatch: 6, identity: 0.8

tttcctcttttacttcttta-tttgttacta	CRISPR spacer
cgtcctctttttcttctttattttgttgtt-	Protospacer
. ********* ******** ******..*

10. spacer 1.9|1371514|30|NZ_CP012911|CRT,PILER-CR matches to NZ_CP023514 (Enterococcus sp. FDAARGOS_375 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

tttcctcttttacttcttta-tttgttacta	CRISPR spacer
cgtcctctttttcttctttattttgttgtt-	Protospacer
. ********* ******** ******..*

11. spacer 1.9|1371514|30|NZ_CP012911|CRT,PILER-CR matches to NZ_CP049777 (Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

tttcctcttttacttcttta-tttgttacta	CRISPR spacer
cgtcctctttttcttctttattttgttgtt-	Protospacer
. ********* ******** ******..*

12. spacer 1.9|1371514|30|NZ_CP012911|CRT,PILER-CR matches to NC_006978 (S.pyogenes plasmid pMD101 DNA) position: , mismatch: 6, identity: 0.8

tttcctcttttacttcttta-tttgttacta	CRISPR spacer
cgtcctctttttcttctttattttgttgtt-	Protospacer
. ********* ******** ******..*

13. spacer 1.9|1371514|30|NZ_CP012911|CRT,PILER-CR matches to NC_006978 (S.pyogenes plasmid pMD101 DNA) position: , mismatch: 6, identity: 0.8

tttcctcttttacttcttta-tttgttacta	CRISPR spacer
cgtcctctttttcttctttattttgttgtt-	Protospacer
. ********* ******** ******..*

14. spacer 1.9|1371514|30|NZ_CP012911|CRT,PILER-CR matches to NZ_CP045673 (Bacillus subtilis strain 2014-3557 plasmid pGMrib, complete sequence) position: , mismatch: 6, identity: 0.8

tttcctcttttacttcttta-tttgttacta	CRISPR spacer
cgtcctctttttcttctttattttgttgtt-	Protospacer
. ********* ******** ******..*

15. spacer 1.9|1371514|30|NZ_CP012911|CRT,PILER-CR matches to NZ_CP038866 (Vagococcus sp. CF-49 plasmid punnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

tttcctcttttacttcttta-tttgttacta	CRISPR spacer
cgtcctctttttcttctttattttgttgtt-	Protospacer
. ********* ******** ******..*

16. spacer 1.9|1371514|30|NZ_CP012911|CRT,PILER-CR matches to NZ_AP018541 (Enterococcus faecalis strain KUB3006 plasmid pKUB3006-3, complete sequence) position: , mismatch: 6, identity: 0.8

tttcctcttttacttcttta-tttgttacta	CRISPR spacer
cgtcctctttttcttctttattttgttgtt-	Protospacer
. ********* ******** ******..*

17. spacer 1.9|1371514|30|NZ_CP012911|CRT,PILER-CR matches to NZ_CP028728 (Enterococcus faecium strain FSIS1608820 plasmid pFSIS1608820, complete sequence) position: , mismatch: 6, identity: 0.8

tttcctcttttacttcttta-tttgttacta	CRISPR spacer
cgtcctctttttcttctttattttgttgtt-	Protospacer
. ********* ******** ******..*

18. spacer 1.9|1371514|30|NZ_CP012911|CRT,PILER-CR matches to NZ_CP033741 (Enterococcus sp. FDAARGOS_553 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

tttcctcttttacttcttta-tttgttacta	CRISPR spacer
cgtcctctttttcttctttattttgttgtt-	Protospacer
. ********* ******** ******..*

19. spacer 1.9|1371514|30|NZ_CP012911|CRT,PILER-CR matches to JN638751 (Bacillus phage G, complete genome) position: , mismatch: 6, identity: 0.8

tttcctcttttacttctttatttgttacta	CRISPR spacer
tttcttcttttagttctttattttcaactg	Protospacer
****.******* ********** . ***.

20. spacer 1.2|1371382|31|NZ_CP012911|CRISPRCasFinder matches to NZ_CP013208 (Paenibacillus sp. IHB B 3084 plasmid pHD05, complete sequence) position: , mismatch: 7, identity: 0.774

cgacaaggtcgaaaagaaatacattgatgtt	CRISPR spacer
caagcaggacgaaaagaaatccattgatgca	Protospacer
*.*  *** *********** ********.

21. spacer 1.4|1371513|31|NZ_CP012911|CRISPRCasFinder matches to NZ_CP050184 (Bacillus thuringiensis strain HER1410 plasmid pLUSID1, complete sequence) position: , mismatch: 7, identity: 0.774

ctttcctcttttacttctttatttgttacta	CRISPR spacer
cagtattcctttaattctttatttgttactg	Protospacer
*  * .**.**** ****************.

22. spacer 1.4|1371513|31|NZ_CP012911|CRISPRCasFinder matches to MT773554 (Myoviridae sp. isolate BML_2 genomic sequence) position: , mismatch: 7, identity: 0.774

ctttcctcttttacttctttatttgttacta	CRISPR spacer
atttcctcttttaactctttatttgcaagaa	Protospacer
 ************ .**********. *  *

23. spacer 1.4|1371513|31|NZ_CP012911|CRISPRCasFinder matches to JN638751 (Bacillus phage G, complete genome) position: , mismatch: 7, identity: 0.774

ctttcctcttttacttctttatttgttacta	CRISPR spacer
ttttcttcttttagttctttattttcaactg	Protospacer
.****.******* ********** . ***.

24. spacer 1.6|1371317|30|NZ_CP012911|CRT matches to AJ609634 (Bacteriophage EJ-1 proviral DNA, complete genome) position: , mismatch: 7, identity: 0.767

tacaaatgttatggggataactaccagaag	CRISPR spacer
taaaaatgttaaggggataactaaagaaac	Protospacer
** ******** ***********  ..**

25. spacer 1.6|1371317|30|NZ_CP012911|CRT matches to NC_005294 (Streptococcus prophage EJ-1, complete genome) position: , mismatch: 7, identity: 0.767

tacaaatgttatggggataactaccagaag	CRISPR spacer
taaaaatgttaaggggataactaaagaaac	Protospacer
** ******** ***********  ..**

26. spacer 1.6|1371317|30|NZ_CP012911|CRT matches to KY065449 (Streptococcus phage IPP5, complete genome) position: , mismatch: 7, identity: 0.767

tacaaatgttatggggataactaccagaag	CRISPR spacer
taaaaatgttaaggggataactaaagaaac	Protospacer
** ******** ***********  ..**

27. spacer 1.7|1371383|30|NZ_CP012911|CRT,PILER-CR matches to NZ_CP013208 (Paenibacillus sp. IHB B 3084 plasmid pHD05, complete sequence) position: , mismatch: 7, identity: 0.767

gacaaggtcgaaaagaaatacattgatgtt	CRISPR spacer
aagcaggacgaaaagaaatccattgatgca	Protospacer
.*  *** *********** ********.

28. spacer 1.7|1371383|30|NZ_CP012911|CRT,PILER-CR matches to NZ_MG205643 (Paeniclostridium sordellii strain S0804018 plasmid pCS1-5, complete sequence) position: , mismatch: 7, identity: 0.767

gacaaggtcgaaaagaaatacattgatgtt	CRISPR spacer
gatacacccgaaaagaaagacattgatgtc	Protospacer
**.* . .********** **********.

29. spacer 1.9|1371514|30|NZ_CP012911|CRT,PILER-CR matches to NZ_CP050184 (Bacillus thuringiensis strain HER1410 plasmid pLUSID1, complete sequence) position: , mismatch: 7, identity: 0.767

tttcctcttttacttctttatttgttacta	CRISPR spacer
agtattcctttaattctttatttgttactg	Protospacer
  * .**.**** ****************.

30. spacer 1.9|1371514|30|NZ_CP012911|CRT,PILER-CR matches to MN698241 (Pelagibacter phage HTVC027P, complete genome) position: , mismatch: 7, identity: 0.767

tttcctcttttacttctttatttgttacta	CRISPR spacer
atatttcttttacttttttatttgatactt	Protospacer
 * ..**********.******** ****

31. spacer 1.9|1371514|30|NZ_CP012911|CRT,PILER-CR matches to NZ_KP342511 (Enterococcus faecium isolate N12-493 plasmid pEfm12493, complete sequence) position: , mismatch: 7, identity: 0.767

tttcctcttttacttctttatttgttacta	CRISPR spacer
ctgtatcttttacatctttacttgttacaa	Protospacer
.* . ******** ******.******* *

32. spacer 1.9|1371514|30|NZ_CP012911|CRT,PILER-CR matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 7, identity: 0.767

tttcctcttttacttctttatttgttacta-	CRISPR spacer
tttcctctattacttctttatct-ccatcat	Protospacer
******** ************.* ..*..*

33. spacer 1.9|1371514|30|NZ_CP012911|CRT,PILER-CR matches to NC_018146 (Zymomonas mobilis subsp. mobilis ATCC 29191 plasmid pZZ6.01, complete sequence) position: , mismatch: 7, identity: 0.767

tttcctcttttacttctttatttgttacta	CRISPR spacer
cattctcttttacttctttagttcttagtg	Protospacer
. *.**************** ** *** *.

34. spacer 1.9|1371514|30|NZ_CP012911|CRT,PILER-CR matches to MK448723 (Streptococcus phage Javan271, complete genome) position: , mismatch: 7, identity: 0.767

tttcctcttttacttctttatttgttacta	CRISPR spacer
tttcctcttttgcttatttattttatatac	Protospacer
***********.*** *******  **.

35. spacer 1.9|1371514|30|NZ_CP012911|CRT,PILER-CR matches to MN694526 (Marine virus AFVG_250M936, complete genome) position: , mismatch: 7, identity: 0.767

tttcctcttttacttctttatttgttacta	CRISPR spacer
tttcttcttttacttttttatttataggaa	Protospacer
****.**********.*******.* .  *

36. spacer 1.9|1371514|30|NZ_CP012911|CRT,PILER-CR matches to MF417925 (Uncultured Caudovirales phage clone 3F_9, partial genome) position: , mismatch: 7, identity: 0.767

tttcctcttttacttctttatttgttacta	CRISPR spacer
ttttctcttttacttctttataagattttt	Protospacer
***.*****************  * * .*

37. spacer 1.1|1371316|31|NZ_CP012911|CRISPRCasFinder matches to AJ609634 (Bacteriophage EJ-1 proviral DNA, complete genome) position: , mismatch: 8, identity: 0.742

ctacaaatgttatggggataactaccagaag	CRISPR spacer
ttaaaaatgttaaggggataactaaagaaac	Protospacer
.** ******** ***********  ..**

38. spacer 1.1|1371316|31|NZ_CP012911|CRISPRCasFinder matches to NC_005294 (Streptococcus prophage EJ-1, complete genome) position: , mismatch: 8, identity: 0.742

ctacaaatgttatggggataactaccagaag	CRISPR spacer
ttaaaaatgttaaggggataactaaagaaac	Protospacer
.** ******** ***********  ..**

39. spacer 1.1|1371316|31|NZ_CP012911|CRISPRCasFinder matches to KY065449 (Streptococcus phage IPP5, complete genome) position: , mismatch: 8, identity: 0.742

ctacaaatgttatggggataactaccagaag	CRISPR spacer
ttaaaaatgttaaggggataactaaagaaac	Protospacer
.** ******** ***********  ..**

40. spacer 1.4|1371513|31|NZ_CP012911|CRISPRCasFinder matches to MN698241 (Pelagibacter phage HTVC027P, complete genome) position: , mismatch: 8, identity: 0.742

ctttcctcttttacttctttatttgttacta	CRISPR spacer
aatatttcttttacttttttatttgatactt	Protospacer
  * ..**********.******** ****

41. spacer 1.4|1371513|31|NZ_CP012911|CRISPRCasFinder matches to NZ_KP342511 (Enterococcus faecium isolate N12-493 plasmid pEfm12493, complete sequence) position: , mismatch: 8, identity: 0.742

ctttcctcttttacttctttatttgttacta	CRISPR spacer
actgtatcttttacatctttacttgttacaa	Protospacer
 .* . ******** ******.******* *

42. spacer 1.4|1371513|31|NZ_CP012911|CRISPRCasFinder matches to NC_018146 (Zymomonas mobilis subsp. mobilis ATCC 29191 plasmid pZZ6.01, complete sequence) position: , mismatch: 8, identity: 0.742

ctttcctcttttacttctttatttgttacta	CRISPR spacer
tcattctcttttacttctttagttcttagtg	Protospacer
.. *.**************** ** *** *.

43. spacer 1.4|1371513|31|NZ_CP012911|CRISPRCasFinder matches to MK448723 (Streptococcus phage Javan271, complete genome) position: , mismatch: 8, identity: 0.742

ctttcctcttttacttctttatttgttacta	CRISPR spacer
ttttcctcttttgcttatttattttatatac	Protospacer
.***********.*** *******  **.

44. spacer 1.4|1371513|31|NZ_CP012911|CRISPRCasFinder matches to MN694526 (Marine virus AFVG_250M936, complete genome) position: , mismatch: 8, identity: 0.742

ctttcctcttttacttctttatttgttacta	CRISPR spacer
atttcttcttttacttttttatttataggaa	Protospacer
 ****.**********.*******.* .  *

45. spacer 1.4|1371513|31|NZ_CP012911|CRISPRCasFinder matches to KM236242 (Escherichia phage Pollock, complete genome) position: , mismatch: 8, identity: 0.742

ctttcctcttttacttctttatttgttacta	CRISPR spacer
cgtagtacttttacttctttctctgttactt	Protospacer
* *  . ************* *.*******

46. spacer 1.9|1371514|30|NZ_CP012911|CRT,PILER-CR matches to NZ_CP016746 (Lactococcus lactis subsp. cremoris strain JM1 plasmid pMPJM1, complete sequence) position: , mismatch: 8, identity: 0.733

tttcctcttttacttctttatttgttacta	CRISPR spacer
gtgcctcttttaattctttttttgttttct	Protospacer
 * ********* ****** ****** ..

47. spacer 1.9|1371514|30|NZ_CP012911|CRT,PILER-CR matches to NZ_MG973074 (Clostridioides difficile strain HSJD-312 plasmid pHSJD-312, complete sequence) position: , mismatch: 8, identity: 0.733

tttcctcttttacttctttatttgttacta	CRISPR spacer
aatatattttttcttctttattttttacta	Protospacer
  * . .**** *********** ******

48. spacer 1.9|1371514|30|NZ_CP012911|CRT,PILER-CR matches to KM236242 (Escherichia phage Pollock, complete genome) position: , mismatch: 8, identity: 0.733

tttcctcttttacttctttatttgttacta	CRISPR spacer
gtagtacttttacttctttctctgttactt	Protospacer
 *  . ************* *.*******

49. spacer 1.4|1371513|31|NZ_CP012911|CRISPRCasFinder matches to NZ_CP016746 (Lactococcus lactis subsp. cremoris strain JM1 plasmid pMPJM1, complete sequence) position: , mismatch: 9, identity: 0.71

ctttcctcttttacttctttatttgttacta	CRISPR spacer
agtgcctcttttaattctttttttgttttct	Protospacer
  * ********* ****** ****** ..

50. spacer 1.4|1371513|31|NZ_CP012911|CRISPRCasFinder matches to NZ_MG973074 (Clostridioides difficile strain HSJD-312 plasmid pHSJD-312, complete sequence) position: , mismatch: 9, identity: 0.71

ctttcctcttttacttctttatttgttacta	CRISPR spacer
aaatatattttttcttctttattttttacta	Protospacer
   * . .**** *********** ******

51. spacer 1.9|1371514|30|NZ_CP012911|CRT,PILER-CR matches to MK613349 (Roseobacter phage CRP-7, complete genome) position: , mismatch: 9, identity: 0.7

tttcctcttttacttctttatttgttacta	CRISPR spacer
ggattacttttacttctttctttgttagtt	Protospacer
   .. ************* ******* *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 4925

Aurantimonas_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194536.1\|454_1828_+	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
WP_004194538.1\|1981_3118_+	DNA polymerase III subunit beta	A0A0A8IL17	Aurantimonas_phage	5.3e-24	24.5
WP_004194540.1\|3361_4243_+	hypothetical protein	NA	NA	NA	NA
WP_004194541.1\|4252_4456_+	DUF951 domain-containing protein	NA	NA	NA	NA
WP_004194339.1\|4559_4925_+	helix-turn-helix transcriptional regulator	A0A0A7RUJ5	Clostridium_phage	1.6e-06	48.4

DBSCAN-SWA_2

12453 : 16264

Acanthocystis_turfacea_chlorella_virus(33.33%)

tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194320.1\|12453_13722_+\|tRNA	tRNA lysidine(34) synthetase TilS	A7K9Y8	Acanthocystis_turfacea_chlorella_virus	4.1e-09	24.6
WP_004194316.1\|13729_14272_+	hypoxanthine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	8.5e-12	27.6
WP_004194314.1\|14293_16264_+\|protease	ATP-dependent zinc metalloprotease FtsH	A0A0P0BXI2	Ostreococcus_lucimarinus_virus	7.4e-106	40.8

DBSCAN-SWA_3

24207 : 25560

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194110.1\|24207_25560_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	E4ZFI6	Streptococcus_phage	1.6e-75	34.6

DBSCAN-SWA_4

35925 : 48003

Oenococcus_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194070.1\|35925_36315_+	VOC family protein	V5UQY3	Oenococcus_phage	1.1e-32	51.6
WP_004194068.1\|36311_36887_+	hypothetical protein	NA	NA	NA	NA
WP_004194066.1\|37050_37824_+	hypothetical protein	NA	NA	NA	NA
WP_004194064.1\|37820_38252_+	hypothetical protein	NA	NA	NA	NA
WP_004194062.1\|38427_41079_+\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	2.9e-153	41.3
WP_004194058.1\|41165_42428_+	hypothetical protein	NA	NA	NA	NA
WP_004194056.1\|42512_45386_+	DEAD/DEAH box helicase	A0A0A1ENT0	Lactobacillus_phage	3.1e-28	28.2
WP_004194051.1\|45409_45802_-	(deoxy)nucleoside triphosphate pyrophosphohydrolase	NA	NA	NA	NA
WP_013730202.1\|45876_46926_+	MmcQ/YjbR family DNA-binding protein	NA	NA	NA	NA
WP_014636819.1\|47010_48003_+	aspartate--ammonia ligase	A0A1C9C5F0	Heterosigma_akashiwo_virus	3.4e-51	37.9

DBSCAN-SWA_5

57578 : 63389

Wolbachia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194473.1\|57578_59516_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	3.8e-70	31.9
WP_004194470.1\|59554_60145_+	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_004194469.1\|60398_60968_+	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_004194467.1\|61004_62186_+	competence/damage-inducible protein A	NA	NA	NA	NA
WP_011922545.1\|62237_63389_+	recombinase RecA	A0A0S2MVG1	Bacillus_phage	1.4e-120	62.9

DBSCAN-SWA_6

82023 : 83280

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002936184.1\|82023_83280_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.4e-173	73.6

DBSCAN-SWA_7

93671 : 95999

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935338.1\|93671_94928_+	CHAP domain-containing protein	M4I0L3	Staphylococcus_phage	5.0e-07	39.8
WP_002935337.1\|95030_95999_+	ribose-phosphate diphosphokinase	A0A1V0SHF7	Hokovirus	2.0e-43	34.8

DBSCAN-SWA_8

99395 : 110175

Synechococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935328.1\|99395_100103_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A1D7SE76	Cyanophage	8.1e-47	42.6
WP_002935327.1\|100115_103835_+	phosphoribosylformylglycinamidine synthase	A6N228	Microbacterium_phage	1.0e-39	26.4
WP_002935326.1\|103837_105292_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	7.2e-58	35.4
WP_002935325.1\|105347_106370_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3FGG1	Synechococcus_phage	3.9e-58	41.1
WP_002935324.1\|106366_106918_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.1e-26	38.5
WP_002935323.1\|106927_108475_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	8.5e-73	47.0
WP_002935322.1\|108539_109370_+	DNA adenine methylase	A0A1S5PRR3	Streptococcus_phage	7.7e-89	59.3
WP_032499218.1\|109359_110175_+	site-specific DNA-methyltransferase	A0A1W6JJW1	Lactococcus_phage	1.1e-26	33.5

DBSCAN-SWA_9

113392 : 139188

Bacillus_phage(18.18%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935317.1\|113392_113881_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	1.9e-18	42.4
WP_002935314.1\|113867_114953_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_002935313.1\|114939_115863_+	DUF4268 domain-containing protein	NA	NA	NA	NA
WP_002935312.1\|115897_117190_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	2.2e-18	33.2
WP_002935311.1\|117698_118523_+	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	2.6e-20	29.8
WP_002935310.1\|118515_119250_+	ABC transporter permease	NA	NA	NA	NA
WP_002935309.1\|119584_120313_+	hypothetical protein	NA	NA	NA	NA
WP_002935308.1\|120322_120901_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_053866406.1\|120915_121344_+	hypothetical protein	NA	NA	NA	NA
WP_002935305.1\|121336_122209_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.0e-27	38.8
WP_002935304.1\|122214_122985_+	membrane protein	NA	NA	NA	NA
WP_002935303.1\|122987_124700_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.5e-59	29.8
WP_002935301.1\|124801_124975_+	hypothetical protein	NA	NA	NA	NA
WP_002935300.1\|125269_126271_+	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	6.8e-07	30.8
WP_002935299.1\|126270_127017_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002935298.1\|127018_127657_+	HAD-IA family hydrolase	NA	NA	NA	NA
WP_002935296.1\|127903_128821_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_162096930.1\|129229_130522_-\|transposase	IS110-like element ISSsu7 family transposase	A0A1X9I619	Streptococcus_phage	8.8e-225	99.8
WP_013730659.1\|131385_132129_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.5e-30	39.2
WP_002939131.1\|132434_134606_+	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	1.7e-281	65.5
WP_009910991.1\|134834_136181_+	5'-nucleotidase C-terminal domain-containing protein	NA	NA	NA	NA
WP_002939125.1\|136182_136677_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002939123.1\|136863_137421_+	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	6.0e-53	57.8
WP_002939120.1\|137901_139188_-	replication-associated recombination protein A	A0A127AWE7	Bacillus_phage	1.0e-92	44.7

DBSCAN-SWA_10

145412 : 151668

Streptococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002936184.1\|145412_146669_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.4e-173	73.6
WP_024394201.1\|149466_151668_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2I2L310	Orpheovirus	1.0e-10	37.2

DBSCAN-SWA_11

155051 : 162059

Planktothrix_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009910969.1\|155051_155822_+	metal ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.4e-12	30.1
WP_013730648.1\|155814_156675_+	metal ABC transporter permease	NA	NA	NA	NA
WP_013730647.1\|156667_157507_+	metal ABC transporter permease	NA	NA	NA	NA
WP_013730646.1\|157562_159455_+	endopeptidase	E3T4I7	Cafeteria_roenbergensis_virus	8.2e-70	30.7
WP_002938575.1\|159557_162059_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	64.9

DBSCAN-SWA_12

173384 : 174131

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013730643.1\|173384_174131_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.6e-35	42.0

DBSCAN-SWA_13

195871 : 196600

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013730636.1\|195871_196600_+	serine/threonine protein phosphatase	A0A0C5JZB3	Enterococcus_phage	2.3e-28	32.1

DBSCAN-SWA_14

200703 : 207365

Bacillus_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004298345.1\|200703_201603_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.6e-76	51.2
WP_004298347.1\|201648_202665_-	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_004298348.1\|202886_203336_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_004298350.1\|203328_205035_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.4e-38	29.1
WP_053866393.1\|205035_206820_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	5.8e-41	27.4
WP_004298354.1\|206921_207365_+	dUTP diphosphatase	Q332E8	Clostridium_botulinum_C_phage	1.3e-31	48.0

DBSCAN-SWA_15

232893 : 291440

Streptococcus_phage(28.57%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_161802282.1\|232893_234186_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	7.3e-211	92.8
WP_024394285.1\|234580_236158_+	ABC transporter ATP-binding protein	F2Y1V5	Organic_Lake_phycodnavirus	1.4e-19	32.1
WP_024394284.1\|236192_237785_+	ABC transporter ATP-binding protein	F2Y302	Organic_Lake_phycodnavirus	2.1e-10	25.9
WP_161802282.1\|237938_239231_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	7.3e-211	92.8
WP_002938446.1\|239665_240541_+	ribosome small subunit-dependent GTPase A	NA	NA	NA	NA
WP_002938443.1\|240555_241215_+	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_002938442.1\|241207_241840_+	thiamine diphosphokinase	NA	NA	NA	NA
WP_002938441.1\|241840_243079_+	DNA recombination protein RmuC	NA	NA	NA	NA
WP_002938440.1\|243068_244010_+	3'-5' exoribonuclease YhaM family protein	NA	NA	NA	NA
WP_002938439.1\|244009_244876_+	phosphotransferase	NA	NA	NA	NA
WP_002938438.1\|244977_245790_+	pur operon repressor	A0A1V0SKE5	Klosneuvirus	1.4e-05	24.7
WP_002938437.1\|245884_246754_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002938433.1\|247026_249246_+	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	1.9e-41	26.3
WP_002938432.1\|249238_249706_+	hypothetical protein	NA	NA	NA	NA
WP_002938418.1\|249702_251106_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_002938413.1\|251246_251555_+	hypothetical protein	NA	NA	NA	NA
WP_002938408.1\|252011_252329_+	hypothetical protein	NA	NA	NA	NA
WP_002938407.1\|252334_253234_+	hypothetical protein	NA	NA	NA	NA
WP_002938405.1\|253396_254272_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_002938404.1\|254273_255242_-	NAD(P)/FAD-dependent oxidoreductase	Q9JRK7	Streptococcus_phage	7.2e-46	69.4
WP_024394249.1\|255394_257608_+	penicillin-binding protein	NA	NA	NA	NA
WP_002940258.1\|257641_257794_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_002940255.1\|257803_257980_+	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_002940254.1\|258089_258629_+	transcription termination/antitermination protein NusG	G3MAW2	Bacillus_virus	3.5e-10	28.2
WP_061286097.1\|258772_263857_+	S8 family serine peptidase	NA	NA	NA	NA
WP_061286099.1\|263961_265245_+\|transposase	IS4-like element ISSsu2 family transposase	NA	NA	NA	NA
WP_002936184.1\|265249_266506_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.4e-173	73.6
WP_002937818.1\|267165_267942_+	30S ribosomal protein S2	NA	NA	NA	NA
WP_002937816.1\|268137_269178_+	elongation factor Ts	NA	NA	NA	NA
WP_002937813.1\|269333_270035_-	hypothetical protein	NA	NA	NA	NA
WP_002937812.1\|270034_270373_-	thiol reductase thioredoxin	NA	NA	NA	NA
WP_002937810.1\|270642_271101_+	CtsR family transcriptional regulator	NA	NA	NA	NA
WP_002937803.1\|271104_273558_+\|protease	ATP-dependent Clp protease ATP-binding subunit	H6X3M6	Enterobacteria_phage	9.8e-124	39.9
WP_002937801.1\|273676_274168_+	adenylyltransferase/cytidyltransferase family protein	A0A291I9M1	Lactobacillus_phage	1.5e-23	39.4
WP_002937798.1\|274365_274749_+	hypothetical protein	NA	NA	NA	NA
WP_002937793.1\|274768_275002_+	hypothetical protein	NA	NA	NA	NA
WP_002937789.1\|274998_275241_+	hypothetical protein	NA	NA	NA	NA
WP_002937787.1\|275354_276359_-\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_053866407.1\|276351_277218_-	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_002937783.1\|280970_283202_-	bifunctional glutamate--cysteine ligase GshA/glutathione synthetase GshB	NA	NA	NA	NA
WP_002937782.1\|283566_284859_+	adenylosuccinate synthase	L7Y4J5	Megavirus	2.8e-69	36.2
WP_013730587.1\|284968_285292_+	preprotein translocase subunit YajC	NA	NA	NA	NA
WP_013730586.1\|285405_286161_+	isoprenyl transferase	R9W0U9	Flavobacterium_phage	2.8e-21	41.3
WP_002938748.1\|286170_286977_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_002938752.1\|286986_288246_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_002938755.1\|288529_290392_+\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_002938756.1\|290729_291440_-	aquaporin family protein	M1HBN0	Acanthocystis_turfacea_Chlorella_virus	1.0e-28	34.9

DBSCAN-SWA_16

295212 : 299604

Clostridium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002938764.1\|295212_299604_+	PolC-type DNA polymerase III	A0A0A7RWA3	Clostridium_phage	7.6e-18	31.2

DBSCAN-SWA_17

303961 : 305524

Micromonas_sp._RCC1109_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002938397.1\|303961_305524_+	2-isopropylmalate synthase	E5EQ69	Micromonas_sp._RCC1109_virus	2.3e-09	31.9

DBSCAN-SWA_18

309492 : 318347

Synechococcus_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002938371.1\|309492_310107_-	peptide deformylase	E3SLL2	Synechococcus_phage	1.0e-13	39.7
WP_002938367.1\|310236_311400_+	MFS transporter	NA	NA	NA	NA
WP_009910851.1\|311614_312064_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002938364.1\|312054_312783_+	rRNA pseudouridine synthase	NA	NA	NA	NA
WP_105152558.1\|312865_314216_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	3.3e-65	51.8
WP_002938355.1\|314628_315138_+	hypothetical protein	NA	NA	NA	NA
WP_002938352.1\|315560_316838_+	uracil transporter	Q9KX94	Enterobacteria_phage	3.0e-60	37.7
WP_161802282.1\|317054_318347_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	7.3e-211	92.8

DBSCAN-SWA_19

321442 : 322084

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002938850.1\|321442_322084_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.7e-33	38.1

DBSCAN-SWA_20

326778 : 330609

Catovirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002938843.1\|326778_328122_+\|tRNA	cysteine--tRNA ligase	A0A1V0SAQ2	Catovirus	6.5e-53	35.8
WP_002938842.1\|328114_328513_+	Mini-ribonuclease 3	NA	NA	NA	NA
WP_002938840.1\|328514_329369_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002938838.1\|329478_330609_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	3.6e-20	32.6

DBSCAN-SWA_21

336615 : 337908

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162096930.1\|336615_337908_-\|transposase	IS110-like element ISSsu7 family transposase	A0A1X9I619	Streptococcus_phage	8.8e-225	99.8

DBSCAN-SWA_22

341421 : 342855

Gordonia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002937373.1\|341421_342855_+	putative DNA binding domain-containing protein	A0A1B3AYT3	Gordonia_phage	6.2e-70	36.6

DBSCAN-SWA_23

353775 : 355479

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002937421.1\|353775_355479_+	acetolactate synthase large subunit	A0A0P0CDR3	Ostreococcus_lucimarinus_virus	4.2e-65	32.4

DBSCAN-SWA_24

358644 : 360712

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002937414.1\|358644_359547_+	SPFH domain-containing protein	A0A1V0SL90	Klosneuvirus	7.2e-32	32.7
WP_009910800.1\|359632_359842_+	hypothetical protein	NA	NA	NA	NA
WP_024389055.1\|359968_360712_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.5e-30	40.8

DBSCAN-SWA_25

365731 : 369012

Cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002938165.1\|365731_366505_+	Fe-S cluster assembly ATPase SufC	A0A1M7XV31	Cedratvirus	2.8e-08	26.5
WP_002938159.1\|366521_367784_+	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_024390431.1\|367788_369012_+	cysteine desulfurase	Q2XUY6	environmental_halophage	7.3e-104	44.4

DBSCAN-SWA_26

375098 : 377041

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002938146.1\|375098_376097_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.9e-19	32.0
WP_002938145.1\|376099_377041_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.0e-20	36.9

DBSCAN-SWA_27

385355 : 386566

Mycobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002939203.1\|385355_385769_-	HIT family protein	B5LJ12	Mycobacterium_phage	2.6e-05	29.7
WP_002939204.1\|385831_386566_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.1e-27	32.6

DBSCAN-SWA_28

391650 : 394473

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194727.1\|391650_394473_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	2.4e-17	22.6

DBSCAN-SWA_29

411859 : 413341

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002937750.1\|411859_413341_+	family 1 glycosylhydrolase	A0A0B5JD41	Pandoravirus	3.3e-26	24.6

DBSCAN-SWA_30

423185 : 436838

Lactococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002937724.1\|423185_423788_+	histidine phosphatase family protein	A0A1X9IGJ2	Lactococcus_phage	2.1e-27	38.2
WP_002937720.1\|423799_424417_+	histidine phosphatase family protein	A0A1X9IGJ2	Lactococcus_phage	2.9e-32	43.7
WP_002937719.1\|424413_425853_+	6-phospho-beta-glucosidase	NA	NA	NA	NA
WP_013730534.1\|425936_426926_+	lipoate--protein ligase	NA	NA	NA	NA
WP_002942403.1\|427097_427388_+	30S ribosomal protein S6	NA	NA	NA	NA
WP_002942409.1\|427399_427894_+	single-stranded DNA-binding protein	A0A2H4J1H8	uncultured_Caudovirales_phage	4.5e-60	72.5
WP_002939250.1\|427926_428166_+	30S ribosomal protein S18	NA	NA	NA	NA
WP_002939249.1\|428400_429057_-	DUF1129 family protein	NA	NA	NA	NA
WP_002939248.1\|429072_430017_-	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_002939245.1\|430358_433184_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	1.4e-304	55.1
WP_013730532.1\|433282_434344_+	aminopeptidase P family protein	A0A0P0I8D7	Acinetobacter_phage	7.0e-18	30.6
WP_002942436.1\|434407_434965_+	elongation factor P	NA	NA	NA	NA
WP_002938280.1\|434992_435385_+	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_002938276.1\|435374_435794_+	transcription antitermination factor NusB	NA	NA	NA	NA
WP_002938271.1\|435872_436838_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	4.7e-21	26.9

DBSCAN-SWA_31

449813 : 453562

Streptococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002936184.1\|449813_451070_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.4e-173	73.6
WP_002938246.1\|451388_452744_-	aspartate kinase	NA	NA	NA	NA
WP_009910719.1\|452920_453562_+	HAD family phosphatase	A7J6N1	Paramecium_bursaria_Chlorella_virus	2.6e-07	27.7

DBSCAN-SWA_32

458631 : 459366

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002938885.1\|458631_459366_+	3-oxoacyl-[acyl-carrier-protein] reductase	W8CYX9	Bacillus_phage	4.5e-08	39.8

DBSCAN-SWA_33

468088 : 469381

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_161802282.1\|468088_469381_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	7.3e-211	92.8

DBSCAN-SWA_34

475106 : 479306

Brochothrix_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194690.1\|475106_475775_+	Fic family protein	D7RWK9	Brochothrix_phage	2.0e-10	26.6
WP_112493960.1\|475951_476347_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_002938961.1\|476391_477981_+	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	4.9e-132	51.3
WP_002938957.1\|478031_479306_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.0e-91	52.6

DBSCAN-SWA_35

484096 : 485557

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024390847.1\|484096_485557_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	8.4e-38	29.1

DBSCAN-SWA_36

489574 : 490867

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_161802282.1\|489574_490867_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	7.3e-211	92.8

DBSCAN-SWA_37

494230 : 495295

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002939276.1\|494230_495295_+	methionine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-29	36.9

DBSCAN-SWA_38

519632 : 525007

Bacillus_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002936184.1\|519632_520889_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.4e-173	73.6
WP_002937982.1\|521540_523268_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.4e-39	25.9
WP_002937979.1\|523267_525007_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	5.4e-44	28.5

DBSCAN-SWA_39

532613 : 540057

Bacillus_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009910298.1\|532613_533441_+	DNA-formamidopyrimidine glycosylase	G3MA33	Bacillus_virus	2.4e-26	33.9
WP_002935763.1\|533433_534036_+	dephospho-CoA kinase	NA	NA	NA	NA
WP_002935765.1\|534022_535228_+	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_012775228.1\|535227_535377_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_002935768.1\|535423_535657_+	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_002935770.1\|536087_538457_+	ribonuclease R	Q0GXV6	Lactococcus_phage	6.0e-94	40.8
WP_002935771.1\|538459_538927_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	4.7e-43	55.7
WP_024390437.1\|539013_540057_-	Zn-dependent alcohol dehydrogenase	K7Z7U2	Megavirus	3.0e-05	21.7

DBSCAN-SWA_40

543207 : 547442

uncultured_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935780.1\|543207_545658_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	3.9e-96	35.0
WP_002935783.1\|545736_546222_+	thiol peroxidase	NA	NA	NA	NA
WP_002935785.1\|546316_546652_+	hypothetical protein	NA	NA	NA	NA
WP_002935794.1\|546740_547442_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.2e-37	39.8

DBSCAN-SWA_41

551275 : 560819

Streptococcus_phage(33.33%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935801.1\|551275_552448_-\|transposase	IS110 family transposase	A0A1X9I5G9	Streptococcus_phage	2.1e-31	95.9
WP_009910275.1\|552722_554048_+	hypothetical protein	NA	NA	NA	NA
WP_053866419.1\|554123_556760_+	DNA polymerase I	A0A218MKQ4	uncultured_virus	1.9e-56	33.0
WP_009910268.1\|556746_557529_+	hypothetical protein	NA	NA	NA	NA
WP_002935805.1\|557648_558086_+	CoA-binding protein	NA	NA	NA	NA
WP_002935807.1\|558380_559223_-	DUF975 family protein	NA	NA	NA	NA
WP_002935810.1\|559676_560819_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	3.5e-84	42.3

DBSCAN-SWA_42

569622 : 580633

Bacillus_phage(28.57%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935825.1\|569622_571575_+\|tRNA	threonine--tRNA ligase	A0A1V0SKZ9	Klosneuvirus	2.3e-67	34.6
WP_002935828.1\|571646_572306_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_002935835.1\|572320_573019_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_002935837.1\|573033_573873_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_002935839.1\|573883_574645_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.0e-34	38.4
WP_002935840.1\|574838_575543_+	response regulator transcription factor	W8CYM9	Bacillus_phage	8.1e-39	39.8
WP_002935841.1\|575535_576885_+	cell wall metabolism sensor histidine kinase VicK	W8CYF6	Bacillus_phage	2.1e-35	34.5
WP_002935843.1\|576891_577695_+	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	3.6e-35	35.6
WP_002935596.1\|578736_579939_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	6.8e-211	92.8
WP_002935846.1\|580177_580633_+	ABC-F family ATP-binding cassette domain-containing protein	A0A1B0RXA0	Streptococcus_phage	2.6e-14	31.9

DBSCAN-SWA_43

586111 : 595985

Streptococcus_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935856.1\|586111_586780_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.1e-32	37.9
WP_002935858.1\|587148_588510_+	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase	NA	NA	NA	NA
WP_002935860.1\|588600_589299_+	TIGR02206 family membrane protein	NA	NA	NA	NA
WP_002935861.1\|589329_591666_-	cation-translocating P-type ATPase	M1I547	Acanthocystis_turfacea_Chlorella_virus	7.3e-36	23.3
WP_002935863.1\|591902_593447_+	peptide chain release factor 3	A0A1B0RXH7	Streptococcus_phage	2.2e-36	28.3
WP_053338620.1\|593746_595051_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.2e-166	72.1
WP_002935869.1\|595181_595985_-	peptidylprolyl isomerase	A0A1V0S9I2	Catovirus	9.0e-26	41.2

DBSCAN-SWA_44

603868 : 606232

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935886.1\|603868_606232_+	DNA translocase FtsK	S5VNE3	Mycobacterium_phage	7.8e-86	52.0

DBSCAN-SWA_45

616025 : 620490

Erwinia_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002938591.1\|616025_617048_+	PhoH family protein	W8D063	Erwinia_phage	3.3e-49	48.6
WP_161802282.1\|617719_619012_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	7.3e-211	92.8
WP_024394246.1\|619341_620490_-	cobalamin-independent methionine synthase II family protein	A0A218MNE0	uncultured_virus	8.0e-44	33.3

DBSCAN-SWA_46

631765 : 649045

Escherichia_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002937139.1\|631765_633979_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	1.4e-76	31.3
WP_002937137.1\|633957_635088_+	DUF3114 domain-containing protein	NA	NA	NA	NA
WP_002937136.1\|635141_635654_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	1.2e-31	47.6
WP_002937134.1\|635757_636699_+	homoserine O-succinyltransferase	NA	NA	NA	NA
WP_002937132.1\|636708_637383_+	DnaD domain-containing protein	Q938N2	Temperate_phage	1.8e-11	43.4
WP_002937128.1\|637384_638068_+\|tRNA	tRNA (adenine-N(1))-methyltransferase	NA	NA	NA	NA
WP_002937125.1\|638057_638852_+	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
WP_002937123.1\|639027_639852_+	ZIP family metal transporter	NA	NA	NA	NA
WP_002937121.1\|639949_640819_+	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	3.0e-99	62.2
WP_002937119.1\|640818_641412_+	dTDP-4-dehydrorhamnose 3,5-epimerase family protein	H9NC63	Sphingomonas_phage	5.1e-10	33.1
WP_002937118.1\|641411_641897_+	hypothetical protein	NA	NA	NA	NA
WP_002937117.1\|642084_643131_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	1.3e-69	44.5
WP_002937114.1\|643185_644037_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	2.1e-25	34.4
WP_002937113.1\|644053_645094_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_061286106.1\|645131_648539_+	GBS Bsp-like repeat-containing protein	M4ZRP4	Bacillus_phage	4.8e-20	33.5
WP_074390297.1\|648616_649045_+	glucosaminidase domain-containing protein	Q938J4	Temperate_phage	3.4e-16	42.1

DBSCAN-SWA_47

654751 : 655966

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002937100.1\|654751_655966_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.4e-09	23.9

DBSCAN-SWA_48

661321 : 662302

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002937088.1\|661321_662302_+	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	1.6e-05	31.1

DBSCAN-SWA_49

669809 : 670331

Agrobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032497583.1\|669809_670331_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	9.0e-11	32.1

DBSCAN-SWA_50

674087 : 682346

Streptococcus_phage(83.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194722.1\|674087_676262_-	LTA synthase family protein	W6LM83	Streptococcus_phage	1.1e-230	60.3
WP_004194720.1\|676377_677541_+	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	2.1e-140	64.7
WP_004194719.1\|677537_678212_+	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	7.7e-79	64.6
WP_004194717.1\|678215_679382_+	chorismate synthase	A0A291AU41	Pandoravirus	3.5e-39	34.9
WP_004194716.1\|679389_680493_+	prephenate dehydrogenase	NA	NA	NA	NA
WP_002938966.1\|680502_680841_+	YlbF/YmcA family competence regulator	A0A1X9I5Y8	Streptococcus_phage	1.9e-54	100.0
WP_002935153.1\|681143_682346_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	3.2e-213	93.8

DBSCAN-SWA_51

686299 : 686932

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935147.1\|686299_686932_+	nicotinate-nucleotide adenylyltransferase	G3MA22	Bacillus_virus	2.0e-20	33.8

DBSCAN-SWA_52

701942 : 706448

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044686434.1\|701942_703301_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	E4ZFI6	Streptococcus_phage	2.9e-250	98.0
WP_002938616.1\|703859_704972_+	UDP-galactopyranose mutase	E4ZFQ1	Streptococcus_phage	2.3e-213	96.5
WP_002936070.1\|705191_706448_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	4.5e-173	73.6

DBSCAN-SWA_53

709542 : 716727

Streptococcus_phage(60.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013730302.1\|709542_710889_+\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	4.8e-56	31.4
WP_002938604.1\|711160_711388_+	hypothetical protein	NA	NA	NA	NA
WP_011922754.1\|711377_711647_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A1S5S8E8	Streptococcus_phage	1.8e-18	51.2
WP_002937278.1\|712052_713372_+	MATE family efflux transporter	NA	NA	NA	NA
WP_002937263.1\|713555_713933_+	RidA family protein	NA	NA	NA	NA
WP_002937261.1\|713954_714842_+	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	3.9e-06	29.0
WP_002937257.1\|714838_715813_+	YvcK family protein	A1IMD5	Streptococcus_phage	1.8e-145	78.1
WP_002937252.1\|715809_716727_+	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	1.8e-110	68.0

DBSCAN-SWA_54

734099 : 735392

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162492403.1\|734099_735392_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	4.7e-210	92.5

DBSCAN-SWA_55

738421 : 739381

Cronobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002937228.1\|738421_739381_+	glycosyltransferase family 2 protein	F1C5B0	Cronobacter_phage	5.3e-49	37.1

DBSCAN-SWA_56

746435 : 749209

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002937207.1\|746435_747971_+	D-alanine--poly(phosphoribitol) ligase subunit DltA	A0A2K9KZV5	Tupanvirus	5.7e-37	26.6
WP_002937200.1\|747967_749209_+	D-alanyl-lipoteichoic acid biosynthesis protein DltB	A0A125RNP0	Pseudomonas_phage	6.0e-21	29.3

DBSCAN-SWA_57

755739 : 758506

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002937183.1\|755739_756765_-	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	1.2e-14	27.3
WP_002937175.1\|756778_757708_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_014636900.1\|757720_758506_-	ABC transporter ATP-binding protein	M1I1A6	Acanthocystis_turfacea_Chlorella_virus	2.7e-06	23.7

DBSCAN-SWA_58

761708 : 830507

Streptococcus_phage(76.0%)

protease,transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935350.1\|761708_763946_+	DNA internalization-related competence protein ComEC/Rec2	M1PSD2	Streptococcus_phage	1.4e-97	94.0
WP_002935351.1\|763947_764091_+\|transposase	transposase	NA	NA	NA	NA
WP_002935353.1\|764269_764926_+	CBS domain-containing protein	M1NSC5	Streptococcus_phage	2.1e-113	99.1
WP_002935354.1\|765019_765847_+	hypothetical protein	M1PFV6	Streptococcus_phage	6.6e-133	97.8
WP_002935355.1\|765852_767124_+	toxic anion resistance protein	M1PLC8	Streptococcus_phage	1.7e-212	100.0
WP_002935357.1\|767160_768027_-	YitT family protein	M1Q1P6	Streptococcus_phage	4.6e-153	99.7
WP_002935358.1\|768201_768840_+	dTMP kinase	M1PSC7	Streptococcus_phage	2.6e-113	98.6
WP_002935359.1\|768836_769721_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	3.6e-153	98.3
WP_002935361.1\|769740_770058_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	3.1e-54	100.0
WP_002935362.1\|770059_770923_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	2.1e-158	99.7
WP_002935363.1\|771322_772414_+	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	1.5e-204	98.6
WP_002935364.1\|772413_772971_+	GNAT family acetyltransferase	M1PSC3	Streptococcus_phage	4.5e-93	98.4
WP_002935365.1\|773344_774526_+	phosphoglycerate dehydrogenase	M1NSB9	Streptococcus_phage	2.7e-220	99.7
WP_002935366.1\|774528_775035_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	1.2e-92	97.0
WP_002935368.1\|775018_775372_+	arsenate reductase family protein	M1PLC0	Streptococcus_phage	1.9e-60	100.0
WP_002935369.1\|775388_776288_-	cation transporter	M1Q1N9	Streptococcus_phage	2.8e-161	98.0
WP_002935370.1\|776587_777415_-	exodeoxyribonuclease III	M1PSC0	Streptococcus_phage	8.3e-152	99.6
WP_002935371.1\|777570_779232_+	hypothetical protein	NA	NA	NA	NA
WP_002935372.1\|779391_780780_+	amino acid permease	NA	NA	NA	NA
WP_002935373.1\|780902_781784_+	DUF975 family protein	NA	NA	NA	NA
WP_002935375.1\|781976_782813_+	DUF975 family protein	NA	NA	NA	NA
WP_002935376.1\|782830_783706_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_002935377.1\|783828_784440_+	DUF3885 domain-containing protein	NA	NA	NA	NA
WP_061286113.1\|787397_789320_+	DEAD/DEAH box helicase family protein	NA	NA	NA	NA
WP_029694137.1\|789596_790475_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_002935387.1\|790799_791546_+	hypothetical protein	NA	NA	NA	NA
WP_002935389.1\|792397_794116_-	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	0.0e+00	99.0
WP_002935390.1\|794206_794776_-	ECF transporter S component	NA	NA	NA	NA
WP_002935392.1\|794762_795311_-	phosphopantothenoylcysteine decarboxylase	A0A068EHP1	Penguinpox_virus	2.8e-23	37.8
WP_022540619.1\|795303_795999_-	phosphopantothenate--cysteine ligase	NA	NA	NA	NA
WP_002935394.1\|796502_798173_+	formate--tetrahydrofolate ligase	NA	NA	NA	NA
WP_002935395.1\|798216_799026_-\|protease	PrsW family intramembrane metalloprotease	NA	NA	NA	NA
WP_002935400.1\|800800_801652_-\|protease	PrsW family intramembrane metalloprotease	NA	NA	NA	NA
WP_002935402.1\|801809_802427_+	DUF5052 family protein	A0A2K9VCV0	Lactobacillus_phage	3.8e-48	51.5
WP_002935404.1\|802427_802937_+	N-acetyltransferase	NA	NA	NA	NA
WP_002935405.1\|802926_803580_+	DNA alkylation repair protein	NA	NA	NA	NA
WP_002935406.1\|803590_803878_+	DUF1905 domain-containing protein	NA	NA	NA	NA
WP_002935416.1\|804174_804951_-	glycyl-radical enzyme activating protein	NA	NA	NA	NA
WP_002935421.1\|805082_805826_+	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_002935426.1\|805838_806813_+	sugar-binding transcriptional regulator	NA	NA	NA	NA
WP_002935429.1\|807001_807325_+	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_002935430.1\|807357_807663_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002935431.1\|807675_808977_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002935432.1\|809128_811573_+	glycyl radical protein	A0A2H4YEI2	Aeromonas_phage	4.9e-06	47.2
WP_002935438.1\|811587_812256_+	fructose-6-phosphate aldolase	E3SKN5	Synechococcus_phage	1.5e-21	31.0
WP_002935440.1\|812287_813244_+	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_002935441.1\|813364_814459_+	glycerol dehydrogenase	NA	NA	NA	NA
WP_002935442.1\|814627_815704_+	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_002935444.1\|815776_816712_+	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_087013902.1\|817312_818664_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	9.7e-65	51.8
WP_002935451.1\|818742_820533_-	oligoendopeptidase F	A0A1X9I5X5	Streptococcus_phage	0.0e+00	100.0
WP_002935455.1\|820699_821038_+	hypothetical protein	NA	NA	NA	NA
WP_002935458.1\|821222_822590_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_002935459.1\|822879_825159_+	DNA helicase PcrA	A7KV33	Bacillus_phage	5.5e-129	41.1
WP_002935460.1\|825600_826356_+	hypothetical protein	NA	NA	NA	NA
WP_002935463.1\|827535_828300_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_002935464.1\|828542_828794_+\|holin	holin	NA	NA	NA	NA
WP_002935596.1\|829304_830507_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	6.8e-211	92.8

DBSCAN-SWA_59

833870 : 834614

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935470.1\|833870_834614_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	8.3e-26	29.4

DBSCAN-SWA_60

847426 : 858088

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935480.1\|847426_851080_+	helicase-exonuclease AddAB subunit AddA	G3MA40	Bacillus_virus	5.5e-22	23.6
WP_024394247.1\|851089_851734_-	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_053866396.1\|851876_853826_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	3.5e-124	42.7
WP_002935485.1\|853849_854452_+	Fic family protein	NA	NA	NA	NA
WP_002935487.1\|854484_854979_+	DUF1232 domain-containing protein	NA	NA	NA	NA
WP_002935488.1\|854981_855434_+	hypothetical protein	NA	NA	NA	NA
WP_009909731.1\|855634_858088_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	2.0e-92	32.3

DBSCAN-SWA_61

869513 : 871914

Streptococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_161802282.1\|869513_870806_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	7.3e-211	92.8
WP_002939454.1\|870999_871914_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	8.1e-07	29.5

DBSCAN-SWA_62

875137 : 877388

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002939139.1\|875137_876061_+	aspartate carbamoyltransferase catalytic subunit	M1HGA5	Paramecium_bursaria_Chlorella_virus	6.7e-25	31.0
WP_002939138.1\|876308_877388_+	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	3.0e-61	37.0

DBSCAN-SWA_63

883584 : 887099

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013730350.1\|883584_885321_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.6e-35	24.8
WP_002938582.1\|885329_887099_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	5.5e-60	32.1

DBSCAN-SWA_64

890589 : 895063

Mycoplasma_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002938590.1\|890589_891792_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	2.5e-213	93.8
WP_002938670.1\|892177_893086_+	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_002938664.1\|893124_894279_+	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	4.0e-35	40.7
WP_002938659.1\|894262_895063_+	ABC transporter permease	Q6GZ02	Mycoplasma_phage	1.3e-11	23.5

DBSCAN-SWA_65

906185 : 911005

Bacillus_virus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012775084.1\|906185_907169_+	GMP reductase	G3MBI2	Bacillus_virus	9.6e-139	75.1
WP_014636922.1\|907238_908588_+	MATE family efflux transporter	NA	NA	NA	NA
WP_002934950.1\|908685_909204_+	ribosome maturation factor RimM	NA	NA	NA	NA
WP_002934953.1\|909193_909919_+\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_002934954.1\|909949_911005_+	histidinol-phosphate aminotransferase family protein	A0A1X6WGT4	Pacmanvirus	1.1e-10	25.1

DBSCAN-SWA_66

916813 : 939365

Bacillus_phage(23.08%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002934964.1\|916813_918025_+\|tRNA	CCA tRNA nucleotidyltransferase	H7BUW3	unidentified_phage	2.2e-39	47.1
WP_002934965.1\|918017_919886_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	2.7e-57	30.3
WP_002934966.1\|919886_920222_+	hypothetical protein	NA	NA	NA	NA
WP_002934967.1\|920317_921277_+	ROK family glucokinase	NA	NA	NA	NA
WP_002934968.1\|921403_921682_+	hypothetical protein	NA	NA	NA	NA
WP_002934969.1\|921693_921996_+	hypothetical protein	NA	NA	NA	NA
WP_002934970.1\|922048_922888_+	thymidylate synthase	U5J9N5	Bacillus_phage	3.0e-88	55.7
WP_002934971.1\|923225_923738_+	dihydrofolate reductase	A0A076GDN3	Bacillus_phage	1.4e-19	35.4
WP_002934974.1\|923935_925162_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.2e-133	59.2
WP_002934975.1\|925217_925805_+	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_002934976.1\|925827_926241_+	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	1.5e-24	44.4
WP_002934977.1\|926336_928169_+	elongation factor 4	E4ZFJ7	Streptococcus_phage	4.4e-20	24.4
WP_002934978.1\|928218_928401_-	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_002934980.1\|928535_929843_+	excalibur calcium-binding domain-containing protein	NA	NA	NA	NA
WP_161802282.1\|930335_931628_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	7.3e-211	92.8
WP_002934983.1\|931851_932433_+	thymidine kinase	A0A249XZX5	Enterococcus_phage	2.1e-48	53.5
WP_002934984.1\|932713_933793_+	peptide chain release factor 1	NA	NA	NA	NA
WP_002934985.1\|933792_934626_+	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_009909811.1\|934612_935221_+	threonylcarbamoyl-AMP synthase	S4VW33	Pandoravirus	2.9e-16	31.5
WP_002934988.1\|935672_936932_+	serine hydroxymethyltransferase	A0A240F2Y9	Aeromonas_phage	7.3e-99	54.5
WP_002934989.1\|936931_937906_+	nucleoid-associated protein	NA	NA	NA	NA
WP_002934990.1\|937906_938506_+	lysozyme family protein	A0A223LKM8	Bacillus_phage	5.7e-25	40.4
WP_002934991.1\|938606_939365_+	SDR family NAD(P)-dependent oxidoreductase	A0A0N9R355	Chrysochromulina_ericina_virus	8.2e-05	21.5

DBSCAN-SWA_67

942447 : 946903

Acidithiobacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002934996.1\|942447_944145_+	AAA family ATPase	K4I1H4	Acidithiobacillus_phage	3.4e-22	29.5
WP_002934997.1\|944141_945191_+	5-methylcytosine-specific restriction endonuclease system specificity protein McrC	NA	NA	NA	NA
WP_002934999.1\|945352_946903_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	1.4e-19	31.6

DBSCAN-SWA_68

952258 : 953329

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935006.1\|952258_953329_+	tyrosine recombinase XerS	A0A1B1IQT7	uncultured_Mediterranean_phage	5.2e-05	29.7

DBSCAN-SWA_69

956624 : 959926

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935012.1\|956624_956882_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A1S5SCV8	Streptococcus_phage	7.8e-16	48.7
WP_002935014.1\|956871_957111_-	hypothetical protein	NA	NA	NA	NA
WP_002935016.1\|957202_959173_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_002935019.1\|959173_959926_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.9e-28	37.3

DBSCAN-SWA_70

965572 : 976088

Bacillus_phage(40.0%)

tRNA,integrase

attL 967919:967933|attR 982743:982757

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935037.1\|965572_966409_-	AraC family transcriptional regulator	D0R0F8	Streptococcus_phage	7.3e-79	52.1
WP_002935038.1\|966485_967820_-\|tRNA	methylenetetrahydrofolate--tRNA-(uracil(54)- C(5))-methyltransferase (FADH(2)-oxidizing) TrmFO	NA	NA	NA	NA
967919:967933	attL	NA	NA	NA	NA
WP_002935039.1\|968015_968765_-	HAD family hydrolase	NA	NA	NA	NA
WP_002935040.1\|968949_970149_-\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	7.1e-27	28.3
WP_001258320.1\|970171_970399_-	DUF3173 family protein	NA	NA	NA	NA
WP_002935042.1\|970676_970901_-	helix-turn-helix transcriptional regulator	A8ASM2	Listeria_phage	3.4e-07	39.3
WP_002935043.1\|971066_971801_-	ABC transporter permease	NA	NA	NA	NA
WP_002935044.1\|971784_972549_-	ABC transporter permease	NA	NA	NA	NA
WP_002935046.1\|972550_973459_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	8.6e-41	46.9
WP_002935048.1\|974695_974851_-	type A2 lantipeptide	NA	NA	NA	NA
WP_002935049.1\|974879_975035_-	type A2 lantipeptide	NA	NA	NA	NA
WP_002935052.1\|975389_976088_+	response regulator transcription factor	W8CYM9	Bacillus_phage	4.9e-28	33.9
982743:982757	attR	NA	NA	NA	NA

DBSCAN-SWA_71

980496 : 989803

Bacillus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053866460.1\|980496_983004_-	AAA family ATPase	A0A1B1IUG5	uncultured_Mediterranean_phage	1.7e-09	44.2
WP_002935066.1\|983039_983807_-	zeta toxin family protein	NA	NA	NA	NA
WP_002935067.1\|983806_984283_-	helix-turn-helix transcriptional regulator	X2CXD8	Lactobacillus_phage	3.6e-06	34.8
WP_002935069.1\|984352_984643_-	hypothetical protein	NA	NA	NA	NA
WP_002935071.1\|984692_985082_-	hypothetical protein	NA	NA	NA	NA
WP_002935073.1\|985078_985306_-	hypothetical protein	NA	NA	NA	NA
WP_002935075.1\|985359_986436_-	toprim domain-containing protein	NA	NA	NA	NA
WP_001820670.1\|986498_988355_-	recombinase family protein	Q2XVV3	Bacillus_phage	1.0e-24	25.9
WP_001820669.1\|988409_988601_-	hypothetical protein	NA	NA	NA	NA
WP_001206986.1\|988672_988903_-	hypothetical protein	A0A223LEC3	Bacillus_phage	3.2e-13	48.5
WP_000743700.1\|988948_989803_-	ParB/RepB/Spo0J family partition protein	S5VSZ7	Leptospira_phage	1.7e-06	30.2

DBSCAN-SWA_72

994559 : 1008110

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002779755.1\|994559_994733_-	cysteine-rich KTR domain-containing protein	D0R0F6	Streptococcus_phage	4.6e-28	100.0
WP_000691758.1\|994784_996704_-	tetracycline resistance ribosomal protection protein Tet(O)	A0A1B0RXH7	Streptococcus_phage	0.0e+00	98.9
WP_001129922.1\|997075_997450_-	TnpV protein	D0R0F4	Streptococcus_phage	6.6e-64	96.8
WP_002935082.1\|997389_998121_-	hypothetical protein	NA	NA	NA	NA
WP_002935084.1\|998216_998507_-	hypothetical protein	NA	NA	NA	NA
WP_024401832.1\|998520_998820_-	hypothetical protein	NA	NA	NA	NA
WP_024401833.1\|998890_1000234_-	hypothetical protein	H2DE57	Erwinia_phage	2.8e-56	32.0
WP_024402041.1\|1000371_1002150_-	reverse transcriptase/maturase family protein	A0A0U4J920	Pseudomonas_phage	4.4e-25	28.3
WP_061286114.1\|1002647_1008110_-	DEAD/DEAH box helicase family protein	A0A248SL14	Klebsiella_phage	3.5e-153	31.7

DBSCAN-SWA_73

1026232 : 1039475

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053866446.1\|1026232_1027588_-	DNA (cytosine-5-)-methyltransferase	A0A141E1L1	Streptococcus_phage	4.7e-128	56.3
WP_024401260.1\|1027736_1028555_-	replication initiator protein A	A0A286QNA4	Streptococcus_phage	4.9e-11	35.5
WP_032499127.1\|1028557_1028725_-	hypothetical protein	NA	NA	NA	NA
WP_002936483.1\|1028925_1029291_-	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_002936486.1\|1029356_1029851_-	50S ribosomal protein L10	NA	NA	NA	NA
WP_013730365.1\|1030427_1032521_-	type I DNA topoisomerase	A0A1V0SCS0	Indivirus	2.4e-102	36.5
WP_002936492.1\|1032613_1033456_-	DNA-protecting protein DprA	S6BFL3	Thermus_phage	1.5e-31	43.8
WP_009909865.1\|1033999_1034260_-	metal-sensitive transcriptional regulator	NA	NA	NA	NA
WP_002936495.1\|1034388_1034712_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_053866445.1\|1034708_1036409_+	FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	6.3e-13	24.3
WP_002936497.1\|1036464_1037016_+	DUF1836 domain-containing protein	NA	NA	NA	NA
WP_053866444.1\|1037005_1037656_+	hemolysin III family protein	NA	NA	NA	NA
WP_002936500.1\|1037688_1038699_-	YdcF family protein	NA	NA	NA	NA
WP_002936501.1\|1038695_1039475_-	ribonuclease HII	R4THQ2	Phaeocystis_globosa_virus	4.5e-22	38.3

DBSCAN-SWA_74

1045207 : 1047538

Beluga_whale_alphaherpesvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002936509.1\|1045207_1045861_-	uracil-DNA glycosylase	A0A286RUF9	Beluga_whale_alphaherpesvirus	1.0e-35	45.4
WP_013730366.1\|1045870_1046797_-	glycosyltransferase family 2 protein	V5USA4	Oenococcus_phage	1.1e-75	49.3
WP_013730367.1\|1046905_1047538_-	orotate phosphoribosyltransferase	Q58MW1	Prochlorococcus_phage	4.0e-05	34.1

DBSCAN-SWA_75

1050791 : 1051697

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014637013.1\|1050791_1051697_+	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	1.2e-05	40.0

DBSCAN-SWA_76

1071786 : 1121519

Leptospira_phage(20.0%)

transposase,integrase

attL 1076372:1076387|attR 1128055:1128070

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935170.1\|1071786_1072527_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.5e-32	40.1
WP_002935171.1\|1072582_1073074_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002935173.1\|1073373_1074906_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2H4UUX5	Bodo_saltans_virus	8.8e-30	23.2
1076372:1076387	attL	NA	NA	NA	NA
WP_014635984.1\|1076616_1076757_+	hypothetical protein	NA	NA	NA	NA
WP_094122540.1\|1077033_1077881_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	1.5e-07	26.6
WP_079739435.1\|1077929_1078520_+	recombinase family protein	M9Q1K0	Clostridium_phage	8.6e-10	28.0
WP_002935179.1\|1078704_1079514_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_002935182.1\|1081301_1081487_+	hypothetical protein	NA	NA	NA	NA
WP_002935183.1\|1081467_1081818_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_002935185.1\|1082028_1082781_+\|transposase	transposase	NA	NA	NA	NA
WP_145888480.1\|1084457_1085304_+\|transposase	IS630-like element ISSsu3 family transposase	S5VXX4	Leptospira_phage	1.1e-08	25.4
WP_061286118.1\|1085876_1087643_-	L-fucose isomerase	NA	NA	NA	NA
WP_002935195.1\|1088642_1090934_-	glycoside hydrolase family 95 protein	NA	NA	NA	NA
WP_002935197.1\|1090991_1091792_-	PTS mannose/fructose/sorbose transporter family subunit IID	NA	NA	NA	NA
WP_002935201.1\|1091788_1092562_-	PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC	NA	NA	NA	NA
WP_002935202.1\|1092584_1093055_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_014637023.1\|1093045_1093477_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_002935205.1\|1093469_1093910_-	RbsD/FucU family protein	NA	NA	NA	NA
WP_002935206.1\|1093921_1094560_-	L-fuculose-phosphate aldolase	NA	NA	NA	NA
WP_002935207.1\|1094670_1096074_-	rhamnulokinase	NA	NA	NA	NA
WP_002935208.1\|1096250_1097015_+	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_002935210.1\|1097995_1098949_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-38	33.2
WP_002935211.1\|1099185_1100190_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_002935214.1\|1101590_1102484_-	aldose 1-epimerase family protein	NA	NA	NA	NA
WP_002935218.1\|1102550_1103957_-	6-phospho-beta-galactosidase	NA	NA	NA	NA
WP_002935220.1\|1105875_1106193_-	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_002935221.1\|1106224_1107058_-	PRD domain-containing protein	NA	NA	NA	NA
WP_002935222.1\|1107245_1108223_-	tagatose-bisphosphate aldolase	NA	NA	NA	NA
WP_002935223.1\|1108224_1109157_-	tagatose-6-phosphate kinase	NA	NA	NA	NA
WP_002935224.1\|1109166_1109682_-	galactose-6-phosphate isomerase subunit LacB	NA	NA	NA	NA
WP_002935225.1\|1109708_1110131_-	galactose-6-phosphate isomerase subunit LacA	NA	NA	NA	NA
WP_053866428.1\|1110284_1111052_-	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_009909915.1\|1111330_1112086_+	hypothetical protein	NA	NA	NA	NA
WP_002935231.1\|1112454_1113486_+\|integrase	tyrosine-type recombinase/integrase	E3W8I1	Leuconostoc_phage	5.9e-30	27.3
WP_002935232.1\|1113711_1114254_-	hypothetical protein	NA	NA	NA	NA
WP_002935233.1\|1114273_1114744_-	hypothetical protein	NA	NA	NA	NA
WP_002935234.1\|1114875_1115676_+	helix-turn-helix transcriptional regulator	E8ZD74	Streptococcus_phage	2.6e-65	50.9
WP_013730386.1\|1116338_1117499_-	A/G-specific adenine glycosylase	NA	NA	NA	NA
WP_029694144.1\|1117677_1118070_-	PaaI family thioesterase	NA	NA	NA	NA
WP_002935237.1\|1118053_1119796_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.2e-52	29.0
WP_002935238.1\|1119782_1121519_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.8e-39	29.5
1128055:1128070	attR	NA	NA	NA	NA

DBSCAN-SWA_77

1125676 : 1127780

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013730387.1\|1125676_1126654_+	ribose-phosphate diphosphokinase	A0A2K9L2G2	Tupanvirus	9.2e-41	34.1
WP_002935247.1\|1126664_1127780_+	cysteine desulfurase	A0A141ZJV0	Faustovirus	2.2e-30	28.4

DBSCAN-SWA_78

1131346 : 1133791

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935255.1\|1131346_1133791_-	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	6.6e-104	34.7

DBSCAN-SWA_79

1139464 : 1144674

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935272.1\|1139464_1141000_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	5.7e-21	32.1
WP_002935274.1\|1141194_1142262_-	BMP family protein	NA	NA	NA	NA
WP_002935275.1\|1142342_1142732_-	cytidine deaminase	NA	NA	NA	NA
WP_002935276.1\|1142718_1143381_-	deoxyribose-phosphate aldolase	NA	NA	NA	NA
WP_002935277.1\|1143396_1144674_-	pyrimidine-nucleoside phosphorylase	A0A0H3UZD4	Geobacillus_virus	2.5e-115	53.3

DBSCAN-SWA_80

1148411 : 1155076

Bacillus_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935290.1\|1148411_1149791_-	HAMP domain-containing histidine kinase	Q8QNA2	Ectocarpus_siliculosus_virus	9.1e-10	32.4
WP_009909965.1\|1149783_1150455_-	response regulator transcription factor	W8CYM9	Bacillus_phage	2.8e-25	33.2
WP_002935294.1\|1150648_1151029_-	hypothetical protein	NA	NA	NA	NA
WP_162096930.1\|1151323_1152616_+\|transposase	IS110-like element ISSsu7 family transposase	A0A1X9I619	Streptococcus_phage	8.8e-225	99.8
WP_002937611.1\|1152817_1153474_-	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_002937614.1\|1153502_1154261_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.9e-19	29.3
WP_002937615.1\|1154272_1155076_-	phosphate ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.8e-11	30.6

DBSCAN-SWA_81

1160721 : 1161468

Streptomyces_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002937637.1\|1160721_1161468_-	potassium channel family protein	A0A2L1IVV9	Streptomyces_phage	3.9e-07	34.5

DBSCAN-SWA_82

1182876 : 1183440

Pneumococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002938082.1\|1182876_1183440_-	GTP cyclohydrolase I FolE	E7DN69	Pneumococcus_phage	3.0e-44	52.2

DBSCAN-SWA_83

1189832 : 1190876

Orpheovirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002938060.1\|1189832_1190876_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2I2L4E3	Orpheovirus	2.8e-27	32.0

DBSCAN-SWA_84

1200568 : 1202368

Vaccinia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002938035.1\|1200568_1202368_-	beta-glucuronidase	B9U1V4	Vaccinia_virus	5.0e-141	45.3

DBSCAN-SWA_85

1214264 : 1220831

Catovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002936023.1\|1214264_1215308_-	diacylglycerol kinase family lipid kinase	A0A1V0SBJ0	Catovirus	3.2e-15	26.9
WP_002936024.1\|1215318_1217277_-	NAD-dependent DNA ligase LigA	A0A1W6DX16	Sphingobium_phage	4.0e-96	35.1
WP_002936026.1\|1217399_1217546_+	hypothetical protein	NA	NA	NA	NA
WP_002936027.1\|1217547_1218453_+	permease	NA	NA	NA	NA
WP_002936028.1\|1218449_1219265_+	TIGR03943 family protein	NA	NA	NA	NA
WP_002936030.1\|1219343_1220831_+	glucose-6-phosphate dehydrogenase	E3SJC5	Synechococcus_phage	5.8e-71	36.3

DBSCAN-SWA_86

1228649 : 1229336

Powai_lake_megavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002936041.1\|1228649_1229336_-	ribonuclease III	A0A167RGU4	Powai_lake_megavirus	1.9e-24	31.4

DBSCAN-SWA_87

1242323 : 1245823

Enterococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002936054.1\|1242323_1242542_+	glutaredoxin-like protein NrdH	A0A0M7REK7	Lactobacillus_phage	1.7e-11	43.8
WP_002936055.1\|1242574_1244734_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	9.2e-259	61.5
WP_002936057.1\|1244863_1245823_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	1.1e-126	67.9

DBSCAN-SWA_88

1249441 : 1274568

Streptococcus_phage(66.67%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935134.1\|1249441_1250731_-\|transposase	IS4-like element ISSsu2 family transposase	NA	NA	NA	NA
WP_161802282.1\|1251234_1252527_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	7.3e-211	92.8
WP_013730412.1\|1252729_1256224_-	YSIRK-type signal peptide-containing protein	NA	NA	NA	NA
WP_002936070.1\|1256462_1257719_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	4.5e-173	73.6
WP_002936072.1\|1257734_1258052_-	preprotein translocase subunit YajC	NA	NA	NA	NA
WP_002936073.1\|1258058_1258874_-	PTS mannose/fructose/sorbose transporter family subunit IID	NA	NA	NA	NA
WP_002936077.1\|1258860_1259637_-	PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC	NA	NA	NA	NA
WP_002936080.1\|1259656_1260148_-	PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB	NA	NA	NA	NA
WP_053866435.1\|1260157_1261348_-	glycoside hydrolase family 88 protein	NA	NA	NA	NA
WP_002936085.1\|1261359_1261794_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_022540650.1\|1262079_1262721_-	bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase	NA	NA	NA	NA
WP_002936090.1\|1262731_1263733_-	sugar kinase	NA	NA	NA	NA
WP_002936092.1\|1263749_1264391_-	RpiB/LacA/LacB family sugar-phosphate isomerase	NA	NA	NA	NA
WP_002936093.1\|1264442_1265258_-	gluconate 5-dehydrogenase	NA	NA	NA	NA
WP_002936094.1\|1266168_1267263_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_002936095.1\|1267370_1268045_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_002936096.1\|1268054_1268372_-	hypothetical protein	NA	NA	NA	NA
WP_012775187.1\|1268381_1269071_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_009910094.1\|1269096_1269303_-	hypothetical protein	NA	NA	NA	NA
WP_013730414.1\|1269324_1270083_-	DUF3169 family protein	NA	NA	NA	NA
WP_009910096.1\|1270079_1270295_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013730415.1\|1270307_1270874_-	DUF3267 domain-containing protein	NA	NA	NA	NA
WP_002938096.1\|1271024_1271219_-	hypothetical protein	NA	NA	NA	NA
WP_002938097.1\|1271422_1271875_-	cytidine deaminase	NA	NA	NA	NA
WP_002938098.1\|1271949_1274568_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.5e-61	34.5

DBSCAN-SWA_89

1281497 : 1289620

Pandoravirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_074390814.1\|1281497_1283555_-\|tRNA	methionine--tRNA ligase	A0A1V0SEZ7	Hokovirus	5.8e-85	31.1
WP_002938116.1\|1283654_1284248_+	DUF1361 domain-containing protein	NA	NA	NA	NA
WP_002938119.1\|1284548_1285586_+	3-deoxy-7-phosphoheptulonate synthase	S4W5F1	Pandoravirus	2.2e-45	34.3
WP_002938121.1\|1285595_1286621_+	3-deoxy-7-phosphoheptulonate synthase	S4W5F1	Pandoravirus	3.2e-44	35.2
WP_002938123.1\|1286666_1287536_+	shikimate dehydrogenase	NA	NA	NA	NA
WP_002938125.1\|1287548_1288616_+	3-dehydroquinate synthase	NA	NA	NA	NA
WP_002938126.1\|1288819_1289620_-	ATP-binding cassette domain-containing protein	W6JKT0	Anomala_cuprea_entomopoxvirus	9.0e-10	23.8

DBSCAN-SWA_90

1296809 : 1311287

Streptococcus_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014637053.1\|1296809_1297442_-	amino acid ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.9e-32	39.3
WP_014637054.1\|1297451_1298093_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_014637055.1\|1298246_1300058_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	Q84421	Paramecium_bursaria_Chlorella_virus	9.5e-100	37.6
WP_053866436.1\|1300489_1301839_-\|transposase	ISLre2 family transposase	NA	NA	NA	NA
WP_053866437.1\|1302012_1302228_-	hypothetical protein	NA	NA	NA	NA
WP_053866438.1\|1302274_1303072_-	AAA family ATPase	A0A1V0DZZ0	Clostridioides_phage	2.0e-17	33.1
WP_079739431.1\|1303158_1304436_-	zeta toxin family protein	NA	NA	NA	NA
WP_000301765.1\|1304437_1304710_-	antitoxin	A0A1X9I6E5	Streptococcus_phage	5.0e-05	100.0
WP_000527318.1\|1304726_1304936_-	peptide-binding protein	A0A1X9I6D5	Streptococcus_phage	1.4e-31	98.6
WP_002334978.1\|1305034_1305931_-	ParA family protein	A0A1X9I765	Streptococcus_phage	9.0e-152	97.2
WP_074390291.1\|1306019_1306304_-	topoisomerase DNA-binding C4 zinc finger domain-containing protein	A0A1X9I6W8	Streptococcus_phage	1.4e-42	97.7
WP_012477196.1\|1306449_1307187_-	23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	2.2e-132	98.0
WP_001809736.1\|1307311_1307407_-	23S rRNA methyltransferase attenuation leader peptide	NA	NA	NA	NA
WP_053866439.1\|1308175_1308493_-	hypothetical protein	NA	NA	NA	NA
WP_161802282.1\|1309994_1311287_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	7.3e-211	92.8

DBSCAN-SWA_91

1316086 : 1317814

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061286134.1\|1316086_1317814_-	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	1.1e-41	32.3

DBSCAN-SWA_92

1323532 : 1327637

Staphylococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061286137.1\|1323532_1326124_-	CHAP domain-containing protein	Q4Z9D9	Staphylococcus_phage	1.0e-06	39.0
WP_145888480.1\|1326790_1327637_+\|transposase	IS630-like element ISSsu3 family transposase	S5VXX4	Leptospira_phage	1.1e-08	25.4

DBSCAN-SWA_93

1332221 : 1334792

Streptococcus_virus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053866477.1\|1332221_1333085_-	replication initiator protein A	Q9MCM7	Streptococcus_virus	5.0e-14	39.4
WP_053866472.1\|1333097_1333259_-	hypothetical protein	NA	NA	NA	NA
WP_061286142.1\|1333535_1334792_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.7e-127	56.1

DBSCAN-SWA_94

1344297 : 1359309

Streptomyces_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935534.1\|1344297_1347408_-	DNA polymerase III subunit alpha	A0A1C9LWZ5	Streptomyces_phage	3.2e-119	29.3
WP_002935537.1\|1347565_1347940_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002935539.1\|1347932_1348640_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.1e-18	26.1
WP_002935541.1\|1348656_1349439_+	hypothetical protein	NA	NA	NA	NA
WP_002935542.1\|1349482_1350484_-	adenosine deaminase	NA	NA	NA	NA
WP_002935545.1\|1351189_1351783_+	TVP38/TMEM64 family protein	M1Q152	Streptococcus_phage	3.8e-106	100.0
WP_002935553.1\|1353896_1354220_-	metal-sulfur cluster assembly factor	NA	NA	NA	NA
WP_002935555.1\|1354604_1355723_-	RNA polymerase sigma factor RpoD	M4SMP8	Cyanophage	7.3e-34	34.1
WP_002935556.1\|1355725_1357516_-	DNA primase	A0A1S5RFR1	Helicobacter_phage	9.2e-47	32.7
WP_002935562.1\|1357697_1358063_+	large conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
WP_002935565.1\|1358295_1359309_-	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	1.6e-91	49.5

DBSCAN-SWA_95

1364598 : 1366866

Iris_mild_mosaic_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935577.1\|1364598_1366866_-	glycogen/starch/alpha-glucan family phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	2.2e-08	41.2

DBSCAN-SWA_96

1375783 : 1377040

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002936184.1\|1375783_1377040_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.4e-173	73.6

DBSCAN-SWA_97

1392236 : 1393781

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009910410.1\|1392236_1393781_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	3.5e-50	27.9

DBSCAN-SWA_98

1400358 : 1551839

185

Streptococcus_phage(90.55%)

portal,terminase,tail,protease,transposase,holin,tRNA,capsid,integrase

attL 1479477:1479529|attR 1517910:1517962

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935669.1\|1400358_1402257_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	7.7e-52	29.7
WP_002935672.1\|1402307_1402673_-	hypothetical protein	NA	NA	NA	NA
WP_002935675.1\|1402683_1403379_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_002935676.1\|1403444_1404221_-	esterase family protein	NA	NA	NA	NA
WP_002935677.1\|1404285_1405947_-	ribonuclease J	NA	NA	NA	NA
WP_002935678.1\|1406202_1406607_-	lipoprotein	NA	NA	NA	NA
WP_087013902.1\|1406967_1408319_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	9.7e-65	51.8
WP_002935680.1\|1408353_1408542_-	hypothetical protein	NA	NA	NA	NA
WP_002935681.1\|1408724_1409483_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	5.3e-12	28.6
WP_002935682.1\|1409479_1410346_-	ABC transporter permease	NA	NA	NA	NA
WP_002935683.1\|1410368_1411370_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002935684.1\|1412126_1413551_-	glycoside hydrolase family 1 protein	NA	NA	NA	NA
WP_002935685.1\|1413565_1415407_-	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_002935686.1\|1415417_1416257_-	PRD domain-containing protein	NA	NA	NA	NA
WP_002935687.1\|1416562_1418221_+	fibronectin/fibrinogen-binding protein	NA	NA	NA	NA
WP_002935688.1\|1418246_1418963_-	acetolactate decarboxylase	NA	NA	NA	NA
WP_002935689.1\|1418966_1420196_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_002935690.1\|1420185_1421352_-	AI-2E family transporter	NA	NA	NA	NA
WP_002935691.1\|1421487_1422492_+	lactonase family protein	NA	NA	NA	NA
WP_002935693.1\|1422555_1422741_+	hypothetical protein	W6LMT3	Streptococcus_phage	2.3e-17	68.9
WP_002935700.1\|1422773_1423415_-	HAD family hydrolase	NA	NA	NA	NA
WP_002935704.1\|1423666_1424974_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	8.3e-247	100.0
WP_002935706.1\|1425123_1425576_+	DUF1694 domain-containing protein	NA	NA	NA	NA
WP_002935708.1\|1425585_1425813_-	hypothetical protein	NA	NA	NA	NA
WP_002935718.1\|1425803_1426931_-	glycerate kinase	W6LM47	Streptococcus_phage	5.7e-87	58.0
WP_002935722.1\|1427038_1427689_+	HAD family hydrolase	NA	NA	NA	NA
WP_002935723.1\|1427719_1428355_-	phosphoserine phosphatase SerB	NA	NA	NA	NA
WP_002935725.1\|1428406_1430131_-	septation ring formation regulator EzrA	NA	NA	NA	NA
WP_002939427.1\|1430219_1432172_-	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	2.2e-142	44.8
WP_002939430.1\|1432353_1432893_-	DJ-1/PfpI family protein	NA	NA	NA	NA
WP_012027447.1\|1432906_1434136_-	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_162096930.1\|1434630_1435923_+\|transposase	IS110-like element ISSsu7 family transposase	A0A1X9I619	Streptococcus_phage	8.8e-225	99.8
WP_014636072.1\|1436208_1436490_-	type B 50S ribosomal protein L31	NA	NA	NA	NA
WP_013730454.1\|1436569_1437598_-	FAD:protein FMN transferase	NA	NA	NA	NA
WP_013730455.1\|1437584_1438529_-	bifunctional oligoribonuclease/PAP phosphatase NrnA	NA	NA	NA	NA
WP_012775265.1\|1438623_1439085_+	flavodoxin	NA	NA	NA	NA
WP_002940393.1\|1439224_1439494_+	30S ribosomal protein S14	NA	NA	NA	NA
WP_013730456.1\|1439575_1439854_+	chorismate mutase	NA	NA	NA	NA
WP_024390438.1\|1439843_1441058_+	chloride channel protein	A0A1X9I5Z9	Streptococcus_phage	8.3e-225	100.0
WP_024395066.1\|1441176_1441392_-	hypothetical protein	A3F673	Streptococcus_phage	4.2e-15	67.2
WP_053866423.1\|1441566_1442316_-	phage antirepressor KilAC domain-containing protein	M1PKL6	Streptococcus_phage	5.3e-121	90.8
WP_024395064.1\|1442317_1442548_-	hypothetical protein	M1PF88	Streptococcus_phage	1.1e-34	97.4
WP_024395063.1\|1442671_1442851_-	hypothetical protein	A0A0E3U2Q1	Fusobacterium_phage	2.6e-10	59.3
WP_099779929.1\|1443053_1443215_-	CopG family transcriptional regulator	NA	NA	NA	NA
WP_024395062.1\|1443410_1444130_-	SH3 domain-containing protein	M1PRP8	Streptococcus_phage	5.8e-133	95.4
WP_002937841.1\|1444113_1444464_-\|holin	phage holin	A0A1X9I630	Streptococcus_phage	2.1e-56	100.0
WP_014636661.1\|1444466_1444766_-	hypothetical protein	A0A1S5SA32	Streptococcus_phage	7.6e-47	100.0
WP_002937844.1\|1444769_1445114_-	hypothetical protein	A0A1X9I644	Streptococcus_phage	8.7e-63	100.0
WP_002937846.1\|1445116_1445335_-	hypothetical protein	A0A1X9I6F7	Streptococcus_phage	1.5e-28	100.0
WP_002937853.1\|1450607_1451303_-	adenylosuccinate synthetase	M1PFK1	Streptococcus_phage	5.8e-130	100.0
WP_044768633.1\|1451302_1453885_-\|tail	phage tail protein	M1NRZ6	Streptococcus_phage	3.5e-257	98.3
WP_044666863.1\|1453874_1454258_-	DUF5361 domain-containing protein	M1PS20	Streptococcus_phage	3.6e-65	100.0
WP_002937863.1\|1454254_1454533_-	hypothetical protein	M1PFS2	Streptococcus_phage	1.1e-42	100.0
WP_002937867.1\|1454543_1455131_-	hypothetical protein	M1NS84	Streptococcus_phage	5.1e-103	100.0
WP_002937874.1\|1455146_1455482_-	hypothetical protein	M1PFK6	Streptococcus_phage	2.2e-55	100.0
WP_002937877.1\|1455478_1455718_-	hypothetical protein	M1NS01	Streptococcus_phage	6.3e-36	100.0
WP_002937879.1\|1455710_1456049_-	hypothetical protein	M1PS26	Streptococcus_phage	2.3e-60	100.0
WP_002937880.1\|1456035_1456431_-	phage Gp19/Gp15/Gp42 family protein	M1Q1D8	Streptococcus_phage	4.4e-66	100.0
WP_002937881.1\|1456434_1456659_-	hypothetical protein	M1PL08	Streptococcus_phage	1.2e-31	100.0
WP_002937882.1\|1456660_1457563_-\|capsid	phage major capsid protein	M1PFL0	Streptococcus_phage	1.4e-173	100.0
WP_002937883.1\|1457577_1458048_-	DUF4355 domain-containing protein	M1Q1L0	Streptococcus_phage	3.5e-78	100.0
WP_002937884.1\|1458130_1459546_-\|terminase	terminase	M1PL91	Streptococcus_phage	1.1e-265	100.0
WP_002937901.1\|1459890_1460103_-	hypothetical protein	M1Q1E3	Streptococcus_phage	8.1e-35	100.0
WP_002937903.1\|1460099_1461179_-	hypothetical protein	M1PL14	Streptococcus_phage	5.7e-209	100.0
WP_002937907.1\|1461171_1462437_-\|portal	phage portal protein	M1PFL4	Streptococcus_phage	7.0e-243	100.0
WP_002937910.1\|1462433_1462796_-	hypothetical protein	M1PRL3	Streptococcus_phage	9.0e-26	71.7
WP_002937914.1\|1462874_1463222_-	HNH endonuclease	M1Q1E9	Streptococcus_phage	1.5e-62	100.0
WP_002937915.1\|1463318_1463753_-	DUF1492 domain-containing protein	A0A1X9I5B5	Streptococcus_phage	2.0e-72	100.0
WP_002937919.1\|1463829_1464081_-	hypothetical protein	M1PFL8	Streptococcus_phage	1.7e-39	100.0
WP_002937922.1\|1464092_1464362_-	hypothetical protein	M1NS18	Streptococcus_phage	1.6e-43	100.0
WP_002937925.1\|1464361_1464538_-	hypothetical protein	M1PS40	Streptococcus_phage	5.7e-26	100.0
WP_002937935.1\|1464537_1464771_-	hypothetical protein	M1Q1F5	Streptococcus_phage	1.9e-37	100.0
WP_002937939.1\|1464786_1465089_-	DUF1372 family protein	M1PL25	Streptococcus_phage	9.4e-53	100.0
WP_002937943.1\|1465098_1465617_-	hypothetical protein	M1PFM2	Streptococcus_phage	1.7e-89	100.0
WP_002937944.1\|1465613_1465946_-	hypothetical protein	M1NS23	Streptococcus_phage	5.3e-57	100.0
WP_002937949.1\|1466258_1466633_-	hypothetical protein	M1Q1F9	Streptococcus_phage	2.8e-70	100.0
WP_002937951.1\|1466660_1467122_-	single-stranded DNA-binding protein	M1PL31	Streptococcus_phage	2.0e-70	100.0
WP_002937955.1\|1467224_1467404_-	hypothetical protein	M1NS29	Streptococcus_phage	1.9e-24	100.0
WP_002937956.1\|1467393_1467720_-	hypothetical protein	M1PS51	Streptococcus_phage	6.1e-58	100.0
WP_002935596.1\|1468095_1469298_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	6.8e-211	92.8
WP_044769722.1\|1470662_1471433_-	phage recombination protein Bet	M1PFN1	Streptococcus_phage	6.2e-141	99.2
WP_004195116.1\|1471429_1471609_-	hypothetical protein	A0A1X9I5S5	Streptococcus_phage	2.4e-24	100.0
WP_014636677.1\|1471747_1471891_-	hypothetical protein	A0A1X9I5P7	Streptococcus_phage	7.1e-19	100.0
WP_004194647.1\|1472428_1472794_-	hypothetical protein	A0A1X9I5L0	Streptococcus_phage	5.8e-65	100.0
WP_004194648.1\|1472846_1473071_-	hypothetical protein	A0A1X9I5Q2	Streptococcus_phage	8.3e-30	100.0
WP_014636678.1\|1473051_1473309_-	hypothetical protein	A0A1X9I620	Streptococcus_phage	7.7e-40	100.0
WP_014636680.1\|1473663_1474374_-	phage antirepressor KilAC domain-containing protein	A0A1X9I742	Streptococcus_phage	2.6e-130	100.0
WP_014636681.1\|1474427_1475117_+	DUF4145 domain-containing protein	A0A1X9I6S1	Streptococcus_phage	4.0e-131	100.0
WP_004195135.1\|1475212_1475434_-	hypothetical protein	A0A1X9I662	Streptococcus_phage	1.3e-32	100.0
WP_004194666.1\|1475469_1475655_-	helix-turn-helix transcriptional regulator	A0A1X9I675	Streptococcus_phage	1.4e-27	100.0
WP_024417669.1\|1475669_1475870_-	helix-turn-helix transcriptional regulator	A0A1X9I6I3	Streptococcus_phage	3.1e-28	100.0
WP_029743813.1\|1476130_1476436_-	ImmA/IrrE family metallo-endopeptidase	A0A1X9I661	Streptococcus_phage	4.7e-52	100.0
WP_153308570.1\|1476584_1476749_-	hypothetical protein	A0A1X9I670	Streptococcus_phage	3.8e-16	100.0
WP_024417671.1\|1476891_1477647_+	helix-turn-helix transcriptional regulator	A0A1X9I660	Streptococcus_phage	2.1e-141	100.0
WP_014636688.1\|1477821_1478256_+	type II toxin-antitoxin system PemK/MazF family toxin	A0A1X9I6T4	Streptococcus_phage	2.3e-76	100.0
WP_061286144.1\|1478381_1479476_+\|integrase	site-specific integrase	A0A1X9I680	Streptococcus_phage	3.4e-209	99.5
1479477:1479529	attL	NA	NA	NA	NA
WP_024395066.1\|1479611_1479827_-	hypothetical protein	A3F673	Streptococcus_phage	4.2e-15	67.2
WP_053866423.1\|1480001_1480751_-	phage antirepressor KilAC domain-containing protein	M1PKL6	Streptococcus_phage	5.3e-121	90.8
WP_024395064.1\|1480752_1480983_-	hypothetical protein	M1PF88	Streptococcus_phage	1.1e-34	97.4
WP_024395063.1\|1481106_1481286_-	hypothetical protein	A0A0E3U2Q1	Fusobacterium_phage	2.6e-10	59.3
WP_099779929.1\|1481488_1481650_-	CopG family transcriptional regulator	NA	NA	NA	NA
WP_024395062.1\|1481845_1482565_-	SH3 domain-containing protein	M1PRP8	Streptococcus_phage	5.8e-133	95.4
WP_002937841.1\|1482548_1482899_-\|holin	phage holin	A0A1X9I630	Streptococcus_phage	2.1e-56	100.0
WP_014636661.1\|1482901_1483201_-	hypothetical protein	A0A1S5SA32	Streptococcus_phage	7.6e-47	100.0
WP_002937844.1\|1483204_1483549_-	hypothetical protein	A0A1X9I644	Streptococcus_phage	8.7e-63	100.0
WP_002937846.1\|1483551_1483770_-	hypothetical protein	A0A1X9I6F7	Streptococcus_phage	1.5e-28	100.0
WP_002937853.1\|1489041_1489737_-	adenylosuccinate synthetase	M1PFK1	Streptococcus_phage	5.8e-130	100.0
WP_044768633.1\|1489736_1492319_-\|tail	phage tail protein	M1NRZ6	Streptococcus_phage	3.5e-257	98.3
WP_044666863.1\|1492308_1492692_-	DUF5361 domain-containing protein	M1PS20	Streptococcus_phage	3.6e-65	100.0
WP_002937863.1\|1492688_1492967_-	hypothetical protein	M1PFS2	Streptococcus_phage	1.1e-42	100.0
WP_002937867.1\|1492977_1493565_-	hypothetical protein	M1NS84	Streptococcus_phage	5.1e-103	100.0
WP_002937874.1\|1493580_1493916_-	hypothetical protein	M1PFK6	Streptococcus_phage	2.2e-55	100.0
WP_002937877.1\|1493912_1494152_-	hypothetical protein	M1NS01	Streptococcus_phage	6.3e-36	100.0
WP_002937879.1\|1494144_1494483_-	hypothetical protein	M1PS26	Streptococcus_phage	2.3e-60	100.0
WP_002937880.1\|1494469_1494865_-	phage Gp19/Gp15/Gp42 family protein	M1Q1D8	Streptococcus_phage	4.4e-66	100.0
WP_002937881.1\|1494868_1495093_-	hypothetical protein	M1PL08	Streptococcus_phage	1.2e-31	100.0
WP_002937882.1\|1495094_1495997_-\|capsid	phage major capsid protein	M1PFL0	Streptococcus_phage	1.4e-173	100.0
WP_002937883.1\|1496011_1496482_-	DUF4355 domain-containing protein	M1Q1L0	Streptococcus_phage	3.5e-78	100.0
WP_002937884.1\|1496564_1497980_-\|terminase	terminase	M1PL91	Streptococcus_phage	1.1e-265	100.0
WP_002937901.1\|1498324_1498537_-	hypothetical protein	M1Q1E3	Streptococcus_phage	8.1e-35	100.0
WP_002937903.1\|1498533_1499613_-	hypothetical protein	M1PL14	Streptococcus_phage	5.7e-209	100.0
WP_002937907.1\|1499605_1500871_-\|portal	phage portal protein	M1PFL4	Streptococcus_phage	7.0e-243	100.0
WP_002937910.1\|1500867_1501230_-	hypothetical protein	M1PRL3	Streptococcus_phage	9.0e-26	71.7
WP_002937914.1\|1501308_1501656_-	HNH endonuclease	M1Q1E9	Streptococcus_phage	1.5e-62	100.0
WP_002937915.1\|1501752_1502187_-	DUF1492 domain-containing protein	A0A1X9I5B5	Streptococcus_phage	2.0e-72	100.0
WP_002937919.1\|1502263_1502515_-	hypothetical protein	M1PFL8	Streptococcus_phage	1.7e-39	100.0
WP_002937922.1\|1502526_1502796_-	hypothetical protein	M1NS18	Streptococcus_phage	1.6e-43	100.0
WP_002937925.1\|1502795_1502972_-	hypothetical protein	M1PS40	Streptococcus_phage	5.7e-26	100.0
WP_002937935.1\|1502971_1503205_-	hypothetical protein	M1Q1F5	Streptococcus_phage	1.9e-37	100.0
WP_002937939.1\|1503220_1503523_-	DUF1372 family protein	M1PL25	Streptococcus_phage	9.4e-53	100.0
WP_002937943.1\|1503532_1504051_-	hypothetical protein	M1PFM2	Streptococcus_phage	1.7e-89	100.0
WP_002937944.1\|1504047_1504380_-	hypothetical protein	M1NS23	Streptococcus_phage	5.3e-57	100.0
WP_002937949.1\|1504692_1505067_-	hypothetical protein	M1Q1F9	Streptococcus_phage	2.8e-70	100.0
WP_002937951.1\|1505094_1505556_-	single-stranded DNA-binding protein	M1PL31	Streptococcus_phage	2.0e-70	100.0
WP_002937955.1\|1505658_1505838_-	hypothetical protein	M1NS29	Streptococcus_phage	1.9e-24	100.0
WP_002937956.1\|1505827_1506154_-	hypothetical protein	M1PS51	Streptococcus_phage	6.1e-58	100.0
WP_002935596.1\|1506529_1507732_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	6.8e-211	92.8
WP_014636674.1\|1508058_1509087_-	DUF1351 domain-containing protein	M1PL36	Streptococcus_phage	2.0e-134	100.0
WP_004195116.1\|1509862_1510042_-	hypothetical protein	A0A1X9I5S5	Streptococcus_phage	2.4e-24	100.0
WP_014636677.1\|1510180_1510324_-	hypothetical protein	A0A1X9I5P7	Streptococcus_phage	7.1e-19	100.0
WP_004194647.1\|1510862_1511228_-	hypothetical protein	A0A1X9I5L0	Streptococcus_phage	5.8e-65	100.0
WP_004194648.1\|1511280_1511505_-	hypothetical protein	A0A1X9I5Q2	Streptococcus_phage	8.3e-30	100.0
WP_014636678.1\|1511485_1511743_-	hypothetical protein	A0A1X9I620	Streptococcus_phage	7.7e-40	100.0
WP_014636680.1\|1512097_1512808_-	phage antirepressor KilAC domain-containing protein	A0A1X9I742	Streptococcus_phage	2.6e-130	100.0
WP_004195135.1\|1513645_1513867_-	hypothetical protein	A0A1X9I662	Streptococcus_phage	1.3e-32	100.0
WP_004194666.1\|1513902_1514088_-	helix-turn-helix transcriptional regulator	A0A1X9I675	Streptococcus_phage	1.4e-27	100.0
WP_024417669.1\|1514102_1514303_-	helix-turn-helix transcriptional regulator	A0A1X9I6I3	Streptococcus_phage	3.1e-28	100.0
WP_029743813.1\|1514563_1514869_-	ImmA/IrrE family metallo-endopeptidase	A0A1X9I661	Streptococcus_phage	4.7e-52	100.0
WP_153308570.1\|1515017_1515182_-	hypothetical protein	A0A1X9I670	Streptococcus_phage	3.8e-16	100.0
WP_024417671.1\|1515324_1516080_+	helix-turn-helix transcriptional regulator	A0A1X9I660	Streptococcus_phage	2.1e-141	100.0
WP_014636688.1\|1516254_1516689_+	type II toxin-antitoxin system PemK/MazF family toxin	A0A1X9I6T4	Streptococcus_phage	2.3e-76	100.0
WP_061286144.1\|1516814_1517909_+\|integrase	site-specific integrase	A0A1X9I680	Streptococcus_phage	3.4e-209	99.5
WP_023370923.1\|1518215_1520240_-	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
1517910:1517962	attR	NA	NA	NA	NA
WP_024381607.1\|1520501_1521107_-	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	7.9e-59	55.7
WP_024381608.1\|1521219_1522251_-	DNA polymerase III subunit delta	NA	NA	NA	NA
WP_013730461.1\|1522400_1522991_-	hypothetical protein	NA	NA	NA	NA
WP_002937287.1\|1523098_1523854_-	epoxyqueuosine reductase QueH	NA	NA	NA	NA
WP_002937288.1\|1524224_1524935_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.6e-16	27.7
WP_002937291.1\|1524934_1525699_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.8e-16	26.3
WP_002937293.1\|1525698_1526646_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_002937296.1\|1526648_1527536_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_002937297.1\|1527741_1528911_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002937299.1\|1529041_1529314_-	YlbG family protein	NA	NA	NA	NA
WP_002937303.1\|1529440_1530031_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	1.5e-54	56.7
WP_002937309.1\|1530147_1530777_-	uracil phosphoribosyltransferase	NA	NA	NA	NA
WP_053866414.1\|1530859_1532476_-	alpha-glucosidase	NA	NA	NA	NA
WP_002937311.1\|1532548_1533997_-	sucrose phosphorylase	NA	NA	NA	NA
WP_002937312.1\|1534066_1534897_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002937313.1\|1534907_1535780_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_002937314.1\|1535917_1537153_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_002937316.1\|1537165_1539340_-	alpha-galactosidase	NA	NA	NA	NA
WP_002937318.1\|1539444_1540284_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_002937324.1\|1540315_1541476_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_002937325.1\|1541479_1542571_-	cystathionine gamma-synthase	NA	NA	NA	NA
WP_002937331.1\|1542772_1543039_+	hypothetical protein	NA	NA	NA	NA
WP_002937335.1\|1543315_1543567_+	hypothetical protein	NA	NA	NA	NA
WP_002935801.1\|1543822_1544995_+\|transposase	IS110 family transposase	A0A1X9I5G9	Streptococcus_phage	2.1e-31	95.9
WP_002937337.1\|1545448_1546198_+\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_002937340.1\|1546187_1546460_+	GIY-YIG nuclease family protein	S5MQN3	Choristoneura_occidentalis_alphabaculovirus	3.8e-05	41.3
WP_002936208.1\|1546475_1547087_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_002935134.1\|1547269_1548559_+\|transposase	IS4-like element ISSsu2 family transposase	NA	NA	NA	NA
WP_061286146.1\|1548727_1549135_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002936206.1\|1549246_1549849_-	DUF1648 domain-containing protein	NA	NA	NA	NA
WP_002936205.1\|1549835_1550114_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002936204.1\|1550258_1551839_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.8e-61	37.1

DBSCAN-SWA_99

1558277 : 1623868

Streptococcus_phage(23.53%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002936184.1\|1558277_1559534_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.4e-173	73.6
WP_002936194.1\|1559846_1560317_+	ferrous iron transport protein A	NA	NA	NA	NA
WP_002936193.1\|1560313_1562458_+	ferrous iron transport protein B	NA	NA	NA	NA
WP_002936191.1\|1562662_1563592_-	ABC transporter permease	NA	NA	NA	NA
WP_002936190.1\|1563584_1564277_-	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	5.2e-30	33.2
WP_099425916.1\|1564419_1565515_-	peptide chain release factor 2	NA	NA	NA	NA
WP_024390910.1\|1565549_1566677_-\|tRNA	tRNA epoxyqueuosine(34) reductase QueG	NA	NA	NA	NA
WP_002936187.1\|1566717_1567206_-	VanZ family protein	NA	NA	NA	NA
WP_002936186.1\|1567374_1567791_-	TM2 domain-containing protein	NA	NA	NA	NA
WP_002936185.1\|1567924_1568101_+	hypothetical protein	NA	NA	NA	NA
WP_171840846.1\|1568208_1568394_+	hypothetical protein	NA	NA	NA	NA
WP_002936184.1\|1568532_1569789_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.4e-173	73.6
WP_053866454.1\|1569942_1572630_-	cation-translocating P-type ATPase	M1IAU8	Acanthocystis_turfacea_Chlorella_virus	6.2e-71	28.8
WP_002936182.1\|1572839_1573226_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_002936180.1\|1573237_1574125_-	anion permease	NA	NA	NA	NA
WP_002936179.1\|1574223_1575537_+	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	8.9e-31	33.9
WP_009909496.1\|1575526_1576336_+	sugar-phosphatase	NA	NA	NA	NA
WP_161802282.1\|1576506_1577799_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	7.3e-211	92.8
WP_004298713.1\|1578013_1578766_-	triose-phosphate isomerase	NA	NA	NA	NA
WP_012775011.1\|1578940_1580137_-	elongation factor Tu	A0A076FFS6	Aureococcus_anophage	2.5e-32	28.2
WP_009909491.1\|1580492_1581464_-	anti sigma factor C-terminal domain-containing protein	NA	NA	NA	NA
WP_024390428.1\|1581444_1581948_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_014636830.1\|1582062_1584759_-	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
WP_002938463.1\|1584779_1585994_-	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_002938468.1\|1586130_1586496_-	DUF4430 domain-containing protein	NA	NA	NA	NA
WP_002938471.1\|1586492_1586996_-	hypothetical protein	NA	NA	NA	NA
WP_002938476.1\|1587108_1587963_+	glycoside hydrolase family 25 protein	A0A2K5B2A3	Erysipelothrix_phage	1.9e-10	27.9
WP_002938477.1\|1588140_1588689_+	energy-coupled thiamine transporter ThiT	NA	NA	NA	NA
WP_002938478.1\|1588791_1589649_+	DUF368 domain-containing protein	NA	NA	NA	NA
WP_002938479.1\|1589632_1590115_+\|tRNA	aminoacyl-tRNA deacylase	NA	NA	NA	NA
WP_002938482.1\|1590117_1590744_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_002938484.1\|1590846_1592337_+\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	8.7e-91	40.9
WP_002938486.1\|1592685_1593822_-	hypothetical protein	NA	NA	NA	NA
WP_002938493.1\|1593818_1594661_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_145888480.1\|1594824_1595671_+\|transposase	IS630-like element ISSsu3 family transposase	S5VXX4	Leptospira_phage	1.1e-08	25.4
WP_014636829.1\|1595942_1597007_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_004194760.1\|1597132_1598380_-	ABC transporter permease	NA	NA	NA	NA
WP_004194759.1\|1598380_1599076_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.1e-35	41.2
WP_004194758.1\|1599056_1600214_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_004194752.1\|1601387_1602737_+	glutathione-disulfide reductase	NA	NA	NA	NA
WP_004194751.1\|1602880_1603525_-	cyclase family protein	NA	NA	NA	NA
WP_004194750.1\|1603730_1604270_+	biotin transporter BioY	NA	NA	NA	NA
WP_004194749.1\|1604281_1604497_-	hypothetical protein	NA	NA	NA	NA
WP_014636828.1\|1604588_1604912_+	hypothetical protein	NA	NA	NA	NA
WP_015646557.1\|1605124_1606411_-	U32 family peptidase	Q6DW11	Phage_TP	2.7e-40	31.2
WP_002938686.1\|1606708_1607638_-	U32 family peptidase	NA	NA	NA	NA
WP_002938687.1\|1607798_1608113_+	DUF3270 domain-containing protein	NA	NA	NA	NA
WP_002938688.1\|1608134_1608545_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_022540576.1\|1608951_1609779_-	class C sortase	NA	NA	NA	NA
WP_002938691.1\|1610136_1610523_-	hypothetical protein	NA	NA	NA	NA
WP_162492404.1\|1610541_1611144_-	signal peptidase I	NA	NA	NA	NA
WP_002938694.1\|1611133_1611427_-	hypothetical protein	NA	NA	NA	NA
WP_002938697.1\|1612864_1613713_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	1.0e-40	42.0
WP_002938699.1\|1613842_1614577_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.9e-37	41.1
WP_002938702.1\|1614569_1615259_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_002938704.1\|1615384_1615615_-	DUF1797 family protein	NA	NA	NA	NA
WP_002938706.1\|1615838_1618067_+\|protease	ATP-dependent Clp protease ATP-binding subunit	K4FB40	Cronobacter_phage	5.6e-126	40.4
WP_002938708.1\|1618252_1618714_+	NUDIX hydrolase	NA	NA	NA	NA
WP_002938710.1\|1618768_1619077_+	DUF1827 family protein	NA	NA	NA	NA
WP_162096930.1\|1619563_1620856_+\|transposase	IS110-like element ISSsu7 family transposase	A0A1X9I619	Streptococcus_phage	8.8e-225	99.8
WP_002938831.1\|1621078_1623868_-\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	1.6e-90	27.7

DBSCAN-SWA_100

1647030 : 1651560

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194629.1\|1647030_1647810_+	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	1.5e-09	26.5
WP_004194627.1\|1647825_1648380_-	methyltransferase domain-containing protein	A0A2H4PQV0	Staphylococcus_phage	8.9e-33	40.8
WP_004194621.1\|1648510_1649155_+	prepilin peptidase	NA	NA	NA	NA
WP_061286149.1\|1649262_1650723_+	nicotinate phosphoribosyltransferase	G3MA18	Bacillus_virus	3.2e-98	41.5
WP_004194617.1\|1650735_1651560_+	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	4.1e-74	56.4

DBSCAN-SWA_101

1655943 : 1656432

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002939048.1\|1655943_1656432_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	1.2e-17	34.2

DBSCAN-SWA_102

1661372 : 1675722

uncultured_Mediterranean_phage(28.57%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004194742.1\|1661372_1662251_-	ABC transporter ATP-binding protein	A0A2R8FFL6	Cedratvirus	4.1e-16	29.7
WP_002937360.1\|1662576_1663866_+\|transposase	IS4-like element ISSsu2 family transposase	NA	NA	NA	NA
WP_004194743.1\|1664018_1664537_-	DNA starvation/stationary phase protection protein	NA	NA	NA	NA
WP_013730504.1\|1664741_1664954_+	CsbD family protein	J7KJ36	Streptococcus_phage	2.1e-11	55.6
WP_013730505.1\|1665123_1665558_+	low molecular weight phosphotyrosine protein phosphatase	NA	NA	NA	NA
WP_013730506.1\|1665689_1666112_+	membrane protein	NA	NA	NA	NA
WP_002939444.1\|1666101_1667901_+	acyltransferase	C6ZR20	Salmonella_phage	5.0e-16	22.7
WP_002939437.1\|1668124_1668778_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_009910581.1\|1668802_1669360_-	ECF transporter S component	NA	NA	NA	NA
WP_002939238.1\|1669683_1670229_-\|tRNA	tRNA (cytidine(34)-2'-O)-methyltransferase	NA	NA	NA	NA
WP_009910583.1\|1670796_1671036_-	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	2.8e-15	48.7
WP_002939235.1\|1671035_1671767_-	rRNA pseudouridine synthase	NA	NA	NA	NA
WP_002939233.1\|1671756_1672326_-	segregation/condensation protein B	A0A1B1IVT7	uncultured_Mediterranean_phage	5.0e-15	31.5
WP_002939230.1\|1672309_1673029_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	2.9e-07	23.9
WP_002939226.1\|1673028_1673760_-	site-specific tyrosine recombinase XerD	NA	NA	NA	NA
WP_002939222.1\|1673756_1674215_-	CBS domain-containing protein	NA	NA	NA	NA
WP_002939213.1\|1674211_1674739_-	metallophosphoesterase	NA	NA	NA	NA
WP_002939211.1\|1674711_1675722_-	nucleoside-triphosphate diphosphatase	A0A2H4UUV7	Bodo_saltans_virus	4.9e-13	31.5

DBSCAN-SWA_103

1689783 : 1696670

Yellowstone_lake_phycodnavirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002938331.1\|1689783_1692876_-	SNF2 helicase associated domain-containing protein	A0A0P0YNJ0	Yellowstone_lake_phycodnavirus	1.4e-42	30.4
WP_002938333.1\|1693015_1693324_-	hypothetical protein	NA	NA	NA	NA
WP_002938335.1\|1693731_1695042_-	ribosome biogenesis GTPase Der	NA	NA	NA	NA
WP_053866418.1\|1695060_1695774_-	nitroreductase family protein	NA	NA	NA	NA
WP_002938337.1\|1695770_1696670_-	primosomal protein DnaI	S5MU12	Brevibacillus_phage	2.8e-28	32.5

DBSCAN-SWA_104

1700361 : 1712203

Streptococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002942698.1\|1700361_1701789_-	NADP-dependent phosphogluconate dehydrogenase	M4QQM4	Ostreococcus_lucimarinus_virus	3.8e-43	29.7
WP_013730515.1\|1701885_1702425_-	DUF177 domain-containing protein	NA	NA	NA	NA
WP_002936674.1\|1702434_1703352_-	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	1.4e-83	50.5
WP_002936682.1\|1703365_1703590_-	DUF4059 family protein	NA	NA	NA	NA
WP_002936685.1\|1703607_1704951_-	DEAD/DEAH box helicase	E3T5E1	Cafeteria_roenbergensis_virus	2.6e-46	30.1
WP_014637131.1\|1705030_1705294_-	hypothetical protein	NA	NA	NA	NA
WP_162492405.1\|1705502_1706795_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	3.5e-221	97.5
WP_002936698.1\|1707925_1709182_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	7.6e-173	73.4
WP_002936699.1\|1709237_1709927_-	5'-methylthioadenosine/adenosylhomocysteine nucleosidase	NA	NA	NA	NA
WP_002936700.1\|1709935_1710256_-	hypothetical protein	NA	NA	NA	NA
WP_002936703.1\|1710266_1710812_-	NUDIX hydrolase	NA	NA	NA	NA
WP_009910530.1\|1710820_1712203_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A2K9L4K9	Tupanvirus	7.2e-31	37.8

DBSCAN-SWA_105

1717868 : 1720393

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022540669.1\|1717868_1718627_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.0e-26	35.3
WP_002936726.1\|1718724_1719717_-	sensor histidine kinase	B5LWN0	Feldmannia_species_virus	7.2e-09	24.9
WP_002936735.1\|1719709_1720393_-	response regulator transcription factor	W8CYM9	Bacillus_phage	3.1e-27	33.2

DBSCAN-SWA_106

1725300 : 1726032

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002936747.1\|1725300_1726032_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.6e-26	33.6

DBSCAN-SWA_107

1740627 : 1742101

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002936792.1\|1740627_1741470_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	1.7e-51	39.3
WP_002936797.1\|1741585_1742101_-	QueT transporter family protein	E7DN70	Pneumococcus_phage	1.2e-07	32.1

DBSCAN-SWA_108

1747379 : 1749705

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002936827.1\|1747379_1748570_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	9.5e-141	66.3
WP_002936829.1\|1749237_1749705_-	cytidine/deoxycytidylate deaminase family protein	A7KUY9	Bacillus_phage	1.4e-34	60.0

DBSCAN-SWA_109

1752904 : 1855670

Streptococcus_phage(54.84%)

protease,transposase,holin,tRNA,integrase

attL 1792074:1792133|attR 1876161:1876244

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002937360.1\|1752904_1754194_-\|transposase	IS4-like element ISSsu2 family transposase	NA	NA	NA	NA
WP_002936841.1\|1754380_1756048_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	5.4e-49	38.2
WP_014638428.1\|1756047_1756545_-	GAF domain-containing protein	NA	NA	NA	NA
WP_002940218.1\|1756609_1756879_-	DUF1294 domain-containing protein	NA	NA	NA	NA
WP_002936217.1\|1757508_1758138_-	uridine kinase	A0A2K9L178	Tupanvirus	4.5e-33	38.5
WP_002936219.1\|1758220_1759207_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_002936220.1\|1759196_1760279_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.2e-28	30.3
WP_061286153.1\|1760345_1761743_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_002936224.1\|1762032_1762416_-	VOC family protein	NA	NA	NA	NA
WP_002936226.1\|1762521_1763214_-	phosphoglycerate mutase	NA	NA	NA	NA
WP_002936238.1\|1763439_1764624_+	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
WP_002936240.1\|1764652_1765807_+	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_002936241.1\|1766067_1767354_+	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_002936242.1\|1767493_1767961_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_162096930.1\|1768297_1769590_-\|transposase	IS110-like element ISSsu7 family transposase	A0A1X9I619	Streptococcus_phage	8.8e-225	99.8
WP_145888480.1\|1769792_1770640_-\|transposase	IS630-like element ISSsu3 family transposase	S5VXX4	Leptospira_phage	1.1e-08	25.4
WP_002936184.1\|1770952_1772209_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.4e-173	73.6
WP_002936247.1\|1772301_1772577_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	1.1e-23	67.4
WP_002936249.1\|1772666_1773263_-	YpmS family protein	NA	NA	NA	NA
WP_002936251.1\|1773234_1774068_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_002936253.1\|1774060_1774894_-	DegV family protein	NA	NA	NA	NA
WP_002936255.1\|1774987_1776649_-	DNA repair protein RecN	NA	NA	NA	NA
WP_002936261.1\|1776651_1777077_-	arginine repressor	NA	NA	NA	NA
WP_002936263.1\|1777069_1777891_-	TlyA family RNA methyltransferase	NA	NA	NA	NA
WP_002936266.1\|1777883_1778753_-	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_002936269.1\|1778752_1778968_-	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_002936271.1\|1778942_1780286_-	exodeoxyribonuclease VII large subunit	L7RDW5	Acanthamoeba_polyphaga_moumouvirus	1.1e-36	32.2
WP_002936272.1\|1780452_1781361_+	neutral zinc metallopeptidase	A0A1I9SA48	Rhodococcus_phage	1.2e-34	34.2
WP_002936277.1\|1782436_1782988_-	isoprenylcysteine carboxyl methyltransferase family protein	NA	NA	NA	NA
WP_002936278.1\|1783375_1784764_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_002936279.1\|1784765_1785416_-	response regulator transcription factor	W8CYM9	Bacillus_phage	4.7e-33	38.4
WP_002936280.1\|1785647_1786349_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_014636745.1\|1788146_1789436_-\|transposase	IS4-like element ISSsu2 family transposase	NA	NA	NA	NA
WP_002936284.1\|1790486_1791923_+	SpaH/EbpB family LPXTG-anchored major pilin	NA	NA	NA	NA
1792074:1792133	attL	NA	NA	NA	NA
WP_014636745.1\|1792157_1793447_+\|transposase	IS4-like element ISSsu2 family transposase	NA	NA	NA	NA
WP_002936291.1\|1793809_1794064_-	hypothetical protein	NA	NA	NA	NA
WP_079254655.1\|1794464_1795073_+\|integrase	tyrosine-type recombinase/integrase	A0A1P8DJJ6	Virus_Rctr41k	2.2e-08	43.8
WP_002936301.1\|1797738_1797945_-	hypothetical protein	NA	NA	NA	NA
WP_002936302.1\|1798061_1798349_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_002936303.1\|1798329_1798515_-	hypothetical protein	NA	NA	NA	NA
WP_002936306.1\|1799820_1801053_-	N-acylneuraminate cytidylyltransferase	NA	NA	NA	NA
WP_011922122.1\|1801061_1801712_-	acetyltransferase	NA	NA	NA	NA
WP_002936318.1\|1801701_1802835_-	UDP-N-acetylglucosamine 2-epimerase (hydrolyzing)	NA	NA	NA	NA
WP_002936321.1\|1802846_1803863_-	N-acetylneuraminate synthase	NA	NA	NA	NA
WP_002936324.1\|1804384_1805791_-	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_053866465.1\|1805799_1806768_-	lipooligosaccharide sialyltransferase	NA	NA	NA	NA
WP_079739436.1\|1807126_1807384_-	hypothetical protein	NA	NA	NA	NA
WP_009909574.1\|1808257_1808569_-	hypothetical protein	NA	NA	NA	NA
WP_002936340.1\|1808608_1809613_-	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	6.0e-11	33.6
WP_002936347.1\|1809605_1810604_-	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	4.7e-08	34.8
WP_011922117.1\|1810742_1811975_-	polymerase	NA	NA	NA	NA
WP_011922116.1\|1812009_1813455_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_002936352.1\|1813768_1814926_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_002936354.1\|1814929_1816099_-	glycosyltransferase family 1 protein	NA	NA	NA	NA
WP_002936357.1\|1816137_1817517_-	sugar transferase	NA	NA	NA	NA
WP_002936359.1\|1817541_1818273_-	hypothetical protein	NA	NA	NA	NA
WP_002936361.1\|1818311_1818989_-	tyrosine-protein kinase	A0A1X9I5D6	Streptococcus_phage	7.6e-119	97.3
WP_002936363.1\|1818998_1819688_-	capsular polysaccharide biosynthesis protein CpsC	A0A1X9I5E1	Streptococcus_phage	9.8e-114	98.3
WP_024394229.1\|1819705_1821151_-	LCP family protein	A0A1X9I5X1	Streptococcus_phage	7.6e-225	99.1
WP_012775019.1\|1821255_1821990_-	peroxide stress protein YaaA	A0A1X9I5I0	Streptococcus_phage	1.5e-120	99.5
WP_011922108.1\|1822112_1823372_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	1.2e-239	98.8
WP_002938910.1\|1823470_1824322_-	DegV family protein	A0A1X9I5J4	Streptococcus_phage	1.3e-152	98.6
WP_002938911.1\|1824448_1824853_+	TetR/AcrR family transcriptional regulator	A0A1X9I6A2	Streptococcus_phage	6.0e-63	97.8
WP_002938914.1\|1824875_1825661_-	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	8.2e-133	96.9
WP_002938916.1\|1825670_1826909_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	2.7e-215	95.6
WP_002938922.1\|1826918_1827995_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	3.1e-191	98.0
WP_024387276.1\|1828155_1830669_-	bifunctional DnaQ family exonuclease/ATP-dependent helicase	A0A1X9I5C8	Streptococcus_phage	0.0e+00	98.3
WP_002938932.1\|1830731_1831370_+	MBL fold metallo-hydrolase	A0A1X9I5D3	Streptococcus_phage	6.7e-125	99.1
WP_002935153.1\|1833084_1834287_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	3.2e-213	93.8
WP_002939032.1\|1834474_1835383_-	EamA family transporter	NA	NA	NA	NA
WP_009909376.1\|1835457_1836939_-	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_002939036.1\|1836948_1838121_-	galactokinase	NA	NA	NA	NA
WP_161802282.1\|1838562_1839855_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	7.3e-211	92.8
WP_044771265.1\|1840024_1840876_+	substrate-binding domain-containing protein	C6ZCU4	Enterobacteria_phage	1.9e-05	24.5
WP_074390696.1\|1841178_1841334_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_002939042.1\|1841651_1843091_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_002939044.1\|1843090_1844557_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_002939046.1\|1844556_1844859_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_012774968.1\|1845076_1845751_-	hydrolase	NA	NA	NA	NA
WP_011921928.1\|1845936_1846284_-	50S ribosomal protein L19	NA	NA	NA	NA
WP_024376330.1\|1848312_1848864_-	cysteine hydrolase	G3MA16	Bacillus_virus	9.5e-27	38.7
WP_002937605.1\|1848865_1849654_-	GTP-sensing pleiotropic transcriptional regulator CodY	NA	NA	NA	NA
WP_002937606.1\|1850124_1851339_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_004194294.1\|1851493_1851946_+	universal stress protein	NA	NA	NA	NA
WP_004194296.1\|1851961_1852480_-	haloacid dehalogenase	A0A0H3UZF4	Geobacillus_virus	8.9e-19	35.5
WP_004194297.1\|1852481_1853327_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_014636805.1\|1853396_1854356_+	asparaginase	NA	NA	NA	NA
WP_002936184.1\|1854413_1855670_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.4e-173	73.6
1876161:1876244	attR	NA	NA	NA	NA

DBSCAN-SWA_110

1866114 : 1870943

Only_Syngen_Nebraska_virus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009909339.1\|1866114_1867719_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	4.4e-141	46.6
WP_011921912.1\|1867911_1868493_-	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
WP_087013902.1\|1869591_1870943_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	9.7e-65	51.8

DBSCAN-SWA_111

1890333 : 1893078

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002937472.1\|1890333_1892202_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.1e-93	34.9
WP_013730132.1\|1892336_1892861_+	hypothetical protein	NA	NA	NA	NA
WP_002937476.1\|1892862_1893078_+	helix-turn-helix transcriptional regulator	A0A0E3U244	Fusobacterium_phage	8.0e-06	29.9

DBSCAN-SWA_112

1898427 : 1901921

Cafeteria_roenbergensis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002937503.1\|1898427_1899564_-	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	1.9e-21	29.6
WP_002937513.1\|1900097_1901921_-	molecular chaperone DnaK	A0A167RF67	Powai_lake_megavirus	7.3e-132	46.6

DBSCAN-SWA_113

1906564 : 1910045

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013730124.1\|1906564_1908307_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	1.5e-46	29.6
WP_024390900.1\|1908296_1910045_+	ABC transporter ATP-binding protein	W8CYT2	Bacillus_phage	6.5e-05	50.9

DBSCAN-SWA_114

1916052 : 1923541

Klosneuvirus(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013730121.1\|1916052_1917480_-	ABC transporter ATP-binding protein	A0A1V0SI78	Klosneuvirus	6.1e-17	26.2
WP_002938996.1\|1917443_1918103_-	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_024394223.1\|1918099_1918693_-	MptD family putative ECF transporter S component	NA	NA	NA	NA
WP_013730119.1\|1918693_1920355_-	ABC transporter ATP-binding protein	F2Y1V5	Organic_Lake_phycodnavirus	7.8e-16	27.1
WP_162096930.1\|1922248_1923541_-\|transposase	IS110-like element ISSsu7 family transposase	A0A1X9I619	Streptococcus_phage	8.8e-225	99.8

DBSCAN-SWA_115

1928862 : 1929888

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002937592.1\|1928862_1929888_+	alcohol dehydrogenase AdhP	A0A2K9L339	Tupanvirus	4.2e-28	24.5

DBSCAN-SWA_116

1939159 : 1940692

Klebsiella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061286163.1\|1939159_1940692_-	DUF853 family protein	A0A248XCZ8	Klebsiella_phage	1.5e-77	44.6

DBSCAN-SWA_117

1949382 : 1955314

Brazilian_cedratvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002937544.1\|1949382_1950366_+	ATP-binding cassette domain-containing protein	A0A2R8FG22	Brazilian_cedratvirus	9.3e-17	29.6
WP_002937543.1\|1950358_1951138_+	ABC-2 family transporter protein	NA	NA	NA	NA
WP_002937541.1\|1951139_1951922_+	ABC-2 family transporter protein	NA	NA	NA	NA
WP_002937540.1\|1951971_1952799_-	HAD family hydrolase	NA	NA	NA	NA
WP_002937539.1\|1952810_1954043_-	CapA family protein	A0A0N9SJ77	Staphylococcus_phage	1.1e-27	30.4
WP_002937537.1\|1954375_1955314_-	dihydroorotate oxidase	A0A1V0SH91	Hokovirus	4.4e-64	45.5

DBSCAN-SWA_118

1961950 : 1962583

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935897.1\|1961950_1962583_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.6e-20	30.8

DBSCAN-SWA_119

1973410 : 1973725

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935923.1\|1973410_1973725_-	thioredoxin	A0A1X9I9P5	Staphylococcus_phage	2.5e-16	40.6

DBSCAN-SWA_120

1979661 : 1981995

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935942.1\|1979661_1981995_-	endonuclease MutS2	Q94M10	Lactobacillus_phage	4.9e-24	51.8

DBSCAN-SWA_121

1988519 : 1989644

Gordonia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935956.1\|1988519_1989644_-	LysM peptidoglycan-binding domain-containing protein	A0A0E3XB61	Gordonia_phage	4.5e-15	42.3

DBSCAN-SWA_122

1992647 : 1996117

Brevibacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014636769.1\|1992647_1995137_+	ATP-dependent RecD-like DNA helicase	A0A0K2FLP8	Brevibacillus_phage	4.1e-53	26.8
WP_002935962.1\|1995175_1996117_-	HAD-IC family P-type ATPase	E4ZFI9	Streptococcus_phage	4.6e-37	38.2

DBSCAN-SWA_123

1999371 : 2000163

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935969.1\|1999371_2000163_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.8e-32	36.0

DBSCAN-SWA_124

2014472 : 2016818

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935985.1\|2014472_2016818_+	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	7.4e-121	33.4

DBSCAN-SWA_125

2025960 : 2027721

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002935993.1\|2025960_2027721_-	glycerophosphoryl diester phosphodiesterase membrane domain-containing protein	I6XE30	Staphylococcus_phage	2.8e-11	25.8

DBSCAN-SWA_126

2036035 : 2041283

Staphylococcus_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002939148.1\|2036035_2037211_+	NAD(P)/FAD-dependent oxidoreductase	A0A2H4PQX1	Staphylococcus_phage	2.9e-17	55.4
WP_002939149.1\|2037451_2038144_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002939155.1\|2038224_2038923_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.5e-18	30.6
WP_061286169.1\|2038932_2040402_+	hypothetical protein	NA	NA	NA	NA
WP_145888480.1\|2040436_2041283_+\|transposase	IS630-like element ISSsu3 family transposase	S5VXX4	Leptospira_phage	1.1e-08	25.4

DBSCAN-SWA_127

2050449 : 2051457

Pandoravirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002938526.1\|2050449_2051457_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A291ATS8	Pandoravirus	2.8e-40	36.6

DBSCAN-SWA_128

2061099 : 2070595

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002938504.1\|2061099_2063091_-	M13 family metallopeptidase	A0A1V0SHG2	Klosneuvirus	6.2e-60	26.5
WP_002938501.1\|2064072_2066154_-	elongation factor G	E4ZFJ7	Streptococcus_phage	2.2e-63	28.7
WP_002940031.1\|2066595_2067066_-	30S ribosomal protein S7	NA	NA	NA	NA
WP_002940030.1\|2067082_2067496_-	30S ribosomal protein S12	NA	NA	NA	NA
WP_013730081.1\|2067727_2069350_-	chaperonin GroEL	A0A219YK78	uncultured_virus	1.3e-153	56.8
WP_002936521.1\|2069361_2069643_-	co-chaperone GroES	NA	NA	NA	NA
WP_002936522.1\|2069840_2070086_+	hypothetical protein	NA	NA	NA	NA
WP_002936524.1\|2070199_2070595_-	single-stranded DNA-binding protein	A1EAD1	Streptococcus_phage	8.0e-28	45.5

DBSCAN-SWA_129

2084525 : 2091923

Phaeocystis_globosa_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009909090.1\|2084525_2088173_-	DNA-directed RNA polymerase subunit beta'	R4TQM7	Phaeocystis_globosa_virus	4.8e-66	24.7
WP_002936570.1\|2088350_2091923_-	DNA-directed RNA polymerase subunit beta	A0A2P0VMZ3	Tetraselmis_virus	5.7e-40	26.7

DBSCAN-SWA_130

2095056 : 2209030

113

Streptococcus_phage(82.86%)

portal,terminase,tail,protease,head,transposase,holin,tRNA,capsid,integrase

attL 2114676:2114735|attR 2211675:2213177

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002936579.1\|2095056_2096313_+\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	3.3e-75	41.1
WP_002936580.1\|2096370_2096748_+	HIT family protein	NA	NA	NA	NA
WP_002936581.1\|2097040_2097250_-	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_002936585.1\|2097246_2097693_-	CopY/TcrY family copper transport repressor	NA	NA	NA	NA
WP_002936590.1\|2097792_2099304_-	zinc ABC transporter substrate-binding protein AdcA	NA	NA	NA	NA
WP_002936593.1\|2099313_2100126_-	metal ABC transporter permease	NA	NA	NA	NA
WP_002936595.1\|2100118_2100823_-	metal ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.8e-07	27.2
WP_013730073.1\|2100823_2101267_-	winged helix DNA-binding protein	NA	NA	NA	NA
WP_002936600.1\|2102012_2102795_-	DUF2971 domain-containing protein	NA	NA	NA	NA
WP_004194117.1\|2109574_2110117_-	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_004194119.1\|2110193_2110859_-	ComF family protein	NA	NA	NA	NA
WP_004194121.1\|2110851_2112144_-	DEAD/DEAH box helicase	A0A1X9I5S6	Streptococcus_phage	6.3e-247	99.1
WP_004194123.1\|2112200_2112833_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	1.3e-109	97.6
WP_161802282.1\|2113185_2114478_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	7.3e-211	92.8
2114676:2114735	attL	NA	NA	NA	NA
WP_002937360.1\|2114806_2116096_-\|transposase	IS4-like element ISSsu2 family transposase	NA	NA	NA	NA
WP_004194142.1\|2116203_2118198_-	Stk1 family PASTA domain-containing Ser/Thr kinase	A0A1V0SDC3	Indivirus	3.2e-24	32.5
WP_004194145.1\|2118197_2118935_-	Stp1/IreP family PP2C-type Ser/Thr phosphatase	NA	NA	NA	NA
WP_074390766.1\|2118972_2120286_-	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
WP_004194149.1\|2120272_2121211_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	6.8e-09	28.3
WP_004194151.1\|2121342_2123733_-	primosomal protein N'	NA	NA	NA	NA
WP_004194153.1\|2124076_2124391_-	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_004194155.1\|2124414_2125041_-	guanylate kinase	K4JYM5	Abalone_herpesvirus	8.8e-21	33.3
WP_004194157.1\|2125188_2126802_-	ribonuclease Y	NA	NA	NA	NA
WP_004194159.1\|2126929_2127412_+	S-ribosylhomocysteine lyase	NA	NA	NA	NA
WP_004194161.1\|2127629_2129084_-	hypothetical protein	NA	NA	NA	NA
WP_004194163.1\|2129093_2130260_-	class I SAM-dependent RNA methyltransferase	NA	NA	NA	NA
WP_004194167.1\|2130816_2131152_-	cell division regulator GpsB	NA	NA	NA	NA
WP_004194171.1\|2131220_2131760_-	DUF1273 domain-containing protein	NA	NA	NA	NA
WP_004194173.1\|2131825_2132443_+	Holliday junction resolvase RecU	NA	NA	NA	NA
WP_074390762.1\|2132411_2134598_+	PBP1A family penicillin-binding protein	NA	NA	NA	NA
WP_004194177.1\|2134651_2135365_+	16S rRNA (guanine(527)-N(7))-methyltransferase RsmG	NA	NA	NA	NA
WP_004194179.1\|2135554_2135758_-	cold-shock protein	Q9AZD3	Lactococcus_phage	7.5e-22	75.4
WP_004194181.1\|2135917_2136751_-	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_004194183.1\|2136768_2138421_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.2e-21	32.9
WP_170241756.1\|2138527_2138851_-	lactoylglutathione lyase	NA	NA	NA	NA
WP_004194187.1\|2139107_2140091_-	rhodanese-related sulfurtransferase	NA	NA	NA	NA
WP_004194188.1\|2140301_2141222_-	hypothetical protein	NA	NA	NA	NA
WP_004194190.1\|2141329_2141875_-	ECF-type riboflavin transporter substrate-binding protein	NA	NA	NA	NA
WP_004194192.1\|2141895_2142744_-	S-adenosyl-l-methionine hydroxide adenosyltransferase family protein	NA	NA	NA	NA
WP_004194195.1\|2143175_2143892_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_004194196.1\|2144052_2144364_+	transcriptional regulator	NA	NA	NA	NA
WP_004194198.1\|2144374_2145001_+	DUF2812 domain-containing protein	NA	NA	NA	NA
WP_004194200.1\|2145072_2147241_-	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_004194203.1\|2147274_2148066_-	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_004194205.1\|2148264_2148972_+	UTRA domain-containing protein	NA	NA	NA	NA
WP_004194208.1\|2149198_2151463_-	glycogen/starch/alpha-glucan family phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	3.2e-12	44.8
WP_004194210.1\|2151455_2152964_-	4-alpha-glucanotransferase	NA	NA	NA	NA
WP_053866426.1\|2153145_2155245_-\|protease	ATP-dependent Clp protease ATP-binding subunit	H6X3M6	Enterobacteria_phage	1.6e-119	38.1
WP_004194216.1\|2155659_2156070_-	peptide deformylase	A0A2I7QLT9	Vibrio_phage	2.1e-10	34.2
WP_004194219.1\|2156089_2157469_-	hypothetical protein	NA	NA	NA	NA
WP_161802282.1\|2157650_2158943_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	7.3e-211	92.8
WP_014636745.1\|2159222_2160512_+\|transposase	IS4-like element ISSsu2 family transposase	NA	NA	NA	NA
WP_004194221.1\|2160652_2162176_-	Heme/copper-type cytochrome/quinol oxidase subunit 1	NA	NA	NA	NA
WP_013730059.1\|2162344_2163586_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_162096930.1\|2163772_2165065_+\|transposase	IS110-like element ISSsu7 family transposase	A0A1X9I619	Streptococcus_phage	8.8e-225	99.8
WP_014636660.1\|2165271_2166009_-	PlySs2 family phage lysin	A0A1X9I6R1	Streptococcus_phage	4.2e-139	100.0
WP_002937841.1\|2165992_2166343_-\|holin	phage holin	A0A1X9I630	Streptococcus_phage	2.1e-56	100.0
WP_014636661.1\|2166345_2166645_-	hypothetical protein	A0A1S5SA32	Streptococcus_phage	7.6e-47	100.0
WP_002936845.1\|2166648_2166993_-	hypothetical protein	M1PS15	Streptococcus_phage	1.5e-62	100.0
WP_002936847.1\|2166995_2167205_-	hypothetical protein	M1Q1C6	Streptococcus_phage	8.0e-27	100.0
WP_002936851.1\|2172146_2172497_-	hypothetical protein	A0A1X9I607	Streptococcus_phage	1.3e-61	100.0
WP_002936852.1\|2172506_2175644_-	hypothetical protein	A0A1X9I5Z7	Streptococcus_phage	0.0e+00	100.0
WP_024394260.1\|2175668_2176028_-	hypothetical protein	A0A1X9I602	Streptococcus_phage	2.2e-61	100.0
WP_002936853.1\|2176054_2176429_-	hypothetical protein	A0A1X9I734	Streptococcus_phage	4.1e-66	100.0
WP_002936854.1\|2176439_2176856_-\|tail	tail protein	A0A1X9I6R2	Streptococcus_phage	9.5e-72	100.0
WP_002936856.1\|2176859_2177228_-	hypothetical protein	A0A1X9I641	Streptococcus_phage	1.3e-64	100.0
WP_002936858.1\|2177224_2177737_-	HK97 gp10 family phage protein	A0A1X9I618	Streptococcus_phage	2.5e-90	100.0
WP_002936870.1\|2178004_2178334_-\|head,tail	phage head-tail connector protein	A0A1X9I6G0	Streptococcus_phage	3.3e-51	100.0
WP_002936873.1\|2178343_2178532_-	hypothetical protein	A0A1X9I614	Streptococcus_phage	3.2e-27	100.0
WP_002936880.1\|2178542_2179559_-	hypothetical protein	A0A1X9I629	Streptococcus_phage	8.0e-189	99.7
WP_002936882.1\|2179576_2180098_-	DUF4355 domain-containing protein	A0A1X9I605	Streptococcus_phage	1.7e-73	100.0
WP_002936883.1\|2180261_2180552_-	hypothetical protein	A0A1X9I606	Streptococcus_phage	3.4e-52	100.0
WP_002936884.1\|2180563_2180800_-	hypothetical protein	A0A1X9I5F6	Streptococcus_phage	1.1e-35	100.0
WP_024390557.1\|2181013_2181217_-	hypothetical protein	A0A1X9I649	Streptococcus_phage	2.2e-34	100.0
WP_002936887.1\|2181182_2182652_-\|capsid	minor capsid protein	A0A1X9I626	Streptococcus_phage	3.4e-281	100.0
WP_024390877.1\|2182602_2184051_-\|portal	phage portal protein	A0A1X9I654	Streptococcus_phage	1.5e-265	98.8
WP_002936901.1\|2184063_2185485_-\|terminase	phage terminase large subunit	A0A1X9I6G4	Streptococcus_phage	1.4e-279	100.0
WP_002936906.1\|2186234_2186657_-	ArpU family transcriptional regulator	A0A1X9I632	Streptococcus_phage	7.9e-74	100.0
WP_002936911.1\|2186732_2187002_-	hypothetical protein	A0A1X9I627	Streptococcus_phage	4.0e-47	100.0
WP_002936917.1\|2187002_2187206_-	hypothetical protein	A0A1X9I612	Streptococcus_phage	1.2e-30	100.0
WP_002936919.1\|2187202_2187412_-	hypothetical protein	A0A1X9I737	Streptococcus_phage	8.8e-34	100.0
WP_002936925.1\|2187789_2188002_-	hypothetical protein	A0A1X9I653	Streptococcus_phage	2.8e-35	100.0
WP_002936928.1\|2188001_2188577_-	DUF1642 domain-containing protein	A0A1X9I640	Streptococcus_phage	3.3e-107	100.0
WP_024394268.1\|2188587_2189019_-	restriction endonuclease subunit S	A0A1X9I666	Streptococcus_phage	5.2e-73	100.0
WP_002936936.1\|2189012_2190272_-	N-6 DNA methylase	A0A1X9I6H1	Streptococcus_phage	2.4e-235	99.8
WP_002936938.1\|2190268_2190571_-	DUF1372 family protein	A0A1X9I624	Streptococcus_phage	9.7e-50	100.0
WP_002936941.1\|2190567_2190798_-	DUF3310 domain-containing protein	A0A1X9I635	Streptococcus_phage	6.9e-40	100.0
WP_002936944.1\|2190794_2191115_-	VRR-NUC domain-containing protein	A0A1X9I642	Streptococcus_phage	2.4e-54	100.0
WP_161802265.1\|2191366_2192830_-	DNA primase	A0A1X9I634	Streptococcus_phage	1.5e-289	99.8
WP_002936949.1\|2192894_2193701_-	bifunctional DNA primase/polymerase	A0A1X9I739	Streptococcus_phage	5.8e-150	98.1
WP_002936952.1\|2193705_2194176_-	DUF669 domain-containing protein	A0A1X9I6S0	Streptococcus_phage	2.3e-82	100.0
WP_002936961.1\|2194178_2195591_-	DEAD/DEAH box helicase	A0A1X9I664	Streptococcus_phage	4.6e-275	99.8
WP_002936965.1\|2195559_2196249_-	AAA family ATPase	A0A1X9I651	Streptococcus_phage	9.8e-130	99.1
WP_002936969.1\|2196245_2196722_-	siphovirus Gp157 family protein	A0A1P8VVS5	Streptococcus_phage	1.1e-28	44.4
WP_002936972.1\|2196723_2196912_-	hypothetical protein	A0A1X9I6H6	Streptococcus_phage	2.6e-29	100.0
WP_044752281.1\|2196908_2197253_-	hypothetical protein	A0A1X9I636	Streptococcus_phage	9.1e-44	100.0
WP_153601467.1\|2197385_2197535_-	hypothetical protein	A0A1X9I650	Streptococcus_phage	2.0e-19	100.0
WP_002936978.1\|2197524_2197773_-	hypothetical protein	A0A1X9I648	Streptococcus_phage	3.8e-36	96.3
WP_002936992.1\|2197813_2198068_-	hypothetical protein	A0A1X9I5T3	Streptococcus_phage	7.4e-43	100.0
WP_002936994.1\|2198134_2198332_-	helix-turn-helix transcriptional regulator	A0A1S5S8U1	Streptococcus_phage	2.1e-13	59.0
WP_002936996.1\|2198556_2198805_+	hypothetical protein	NA	NA	NA	NA
WP_002937001.1\|2198981_2199182_-	helix-turn-helix transcriptional regulator	A0A1X9I583	Streptococcus_phage	9.6e-30	100.0
WP_002937004.1\|2199366_2199747_+	helix-turn-helix transcriptional regulator	A0A1X9I5A1	Streptococcus_phage	3.9e-64	100.0
WP_002937006.1\|2199753_2200158_+	ImmA/IrrE family metallo-endopeptidase	A0A1X9I5R2	Streptococcus_phage	2.1e-63	93.7
WP_002937008.1\|2200154_2201051_+	Abi family protein	NA	NA	NA	NA
WP_061286175.1\|2201335_2202493_+\|integrase	site-specific integrase	A0A1X9I5L3	Streptococcus_phage	5.5e-218	99.2
WP_004194670.1\|2202701_2202854_-	hypothetical protein	M1Q1N6	Streptococcus_phage	3.6e-21	100.0
WP_053866469.1\|2203026_2203782_+	helix-turn-helix domain-containing protein	A0A1X9I660	Streptococcus_phage	3.5e-96	75.6
WP_053866468.1\|2203981_2204743_+	NYN domain-containing protein	A4JWQ6	Burkholderia_virus	5.0e-42	43.6
WP_061286175.1\|2204916_2206074_+\|integrase	site-specific integrase	A0A1X9I5L3	Streptococcus_phage	5.5e-218	99.2
WP_002937015.1\|2206303_2207230_+	cysteine synthase A	A0A1X9I5F1	Streptococcus_phage	9.9e-170	100.0
WP_002937017.1\|2207256_2207628_-	S1 RNA-binding domain-containing protein	NA	NA	NA	NA
WP_002937018.1\|2207629_2209030_-	Cof-type HAD-IIB family hydrolase	A0A1V0S9I2	Catovirus	2.3e-24	43.5
2211675:2213177	attR	NA	NA	NA	NA

DBSCAN-SWA_131

2213601 : 2219486

Cafeteria_roenbergensis_virus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002937034.1\|2213601_2216142_-	DNA mismatch repair protein MutS	E3T5Q7	Cafeteria_roenbergensis_virus	6.5e-38	22.1
WP_002937036.1\|2216156_2216597_-	arginine repressor	NA	NA	NA	NA
WP_002937037.1\|2216703_2218392_+\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	1.2e-77	33.1
WP_002937039.1\|2218571_2219486_+	SH3 domain-containing protein	F8HGP2	Streptococcus_phage	5.8e-05	39.5

DBSCAN-SWA_132

2226681 : 2227665

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002936122.1\|2226681_2227665_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	4.1e-12	28.0

DBSCAN-SWA_133

2231346 : 2233098

Klosneuvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002936129.1\|2231346_2233098_-\|tRNA	aspartate--tRNA ligase	A0A1V0SJ84	Klosneuvirus	2.9e-13	26.1

DBSCAN-SWA_134

2237262 : 2241861

Lactobacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002936146.1\|2237262_2238780_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	1.4e-51	33.3
WP_002936148.1\|2238912_2239362_-	thiol reductase thioredoxin	NA	NA	NA	NA
WP_002938227.1\|2239428_2240040_-	30S ribosomal protein S4	NA	NA	NA	NA
WP_002938218.1\|2240250_2240502_-	hypothetical protein	NA	NA	NA	NA
WP_002938217.1\|2240505_2241861_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	2.0e-142	59.0

DBSCAN-SWA_135

2251175 : 2278815

Streptococcus_phage(63.64%)

tRNA,transposase,integrase

attL 2258480:2258500|attR 2269655:2269675

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009911037.1\|2251175_2251730_-	LysM peptidoglycan-binding domain-containing protein	A0A096XT26	Enterococcus_phage	1.0e-28	48.8
WP_002938197.1\|2251861_2252656_-	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_061286179.1\|2252648_2253491_-	energy-coupling factor transporter ATPase	A0A2H4PQG7	Staphylococcus_phage	1.1e-13	27.1
WP_002938187.1\|2253466_2254303_-	energy-coupling factor transporter ATPase	G9BWD6	Planktothrix_phage	1.3e-22	32.9
WP_013730677.1\|2254299_2254839_-	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_002939074.1\|2254848_2255706_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002939071.1\|2255787_2257071_-	insulinase family protein	NA	NA	NA	NA
WP_009911054.1\|2257067_2258321_-	insulinase family protein	A0A1X9I714	Streptococcus_phage	4.2e-232	99.0
2258480:2258500	attL	NA	NA	NA	NA
WP_002939065.1\|2258852_2259257_-	ArpU family transcriptional regulator	A0A1X9I5Y7	Streptococcus_phage	8.4e-65	97.0
WP_158500238.1\|2259290_2259548_-	hypothetical protein	A0A1X9I699	Streptococcus_phage	2.2e-18	71.2
WP_002939060.1\|2259961_2260504_-	hypothetical protein	A0A1X9I5U4	Streptococcus_phage	6.0e-50	57.1
WP_002939058.1\|2260524_2260698_-	sporulation protein Cse60	A0A1X9I5U0	Streptococcus_phage	1.2e-12	63.2
WP_002939056.1\|2261037_2262636_-	hypothetical protein	A0A1P8BM51	Lactococcus_phage	1.3e-145	53.4
WP_024394241.1\|2262632_2263103_-	hypothetical protein	NA	NA	NA	NA
WP_053866481.1\|2263270_2263555_-	hypothetical protein	A0A1X9I5U9	Streptococcus_phage	6.1e-38	85.1
WP_002936163.1\|2263544_2263883_-	hypothetical protein	A0A1X9I5Z6	Streptococcus_phage	6.2e-45	92.4
WP_002936164.1\|2263879_2264029_-	hypothetical protein	A0A1X9I6A8	Streptococcus_phage	6.9e-17	89.6
WP_014638857.1\|2264040_2264244_-	hypothetical protein	A0A1X9I5T6	Streptococcus_phage	7.2e-25	80.6
WP_002936166.1\|2264231_2264633_-	hypothetical protein	NA	NA	NA	NA
WP_002936167.1\|2265088_2265712_-	Rha family transcriptional regulator	A0A192Y918	Salmonella_phage	7.5e-12	30.2
WP_002936168.1\|2265723_2265930_-	helix-turn-helix transcriptional regulator	A0A1S5SE31	Streptococcus_phage	4.3e-09	59.6
WP_002936170.1\|2265947_2266148_-	transcriptional regulator	NA	NA	NA	NA
WP_002936171.1\|2266351_2266858_+	helix-turn-helix transcriptional regulator	A0A1X9I723	Streptococcus_phage	1.8e-16	68.3
WP_002936172.1\|2267245_2268250_+	virulence RhuM family protein	Q9JMN3	Wolbachia_phage	3.9e-79	47.7
WP_002936173.1\|2268479_2269652_+\|integrase	site-specific integrase	A0A1X9I5Y5	Streptococcus_phage	1.3e-211	95.4
WP_002936175.1\|2269789_2270173_+	S4 domain-containing protein YaaA	A0A1X9I5V8	Streptococcus_phage	4.6e-36	94.5
2269655:2269675	attR	NA	NA	NA	NA
WP_002936177.1\|2270175_2271270_+	DNA replication/repair protein RecF	NA	NA	NA	NA
WP_161802282.1\|2271710_2273003_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	7.3e-211	92.8
WP_014637236.1\|2273162_2274644_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	3.6e-97	41.9
WP_013730696.1\|2274875_2275901_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_013730698.1\|2276255_2277128_+	YitT family protein	NA	NA	NA	NA
WP_004194522.1\|2277192_2278815_+	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	2.0e-48	26.0

DBSCAN-SWA_136

2283462 : 2284659

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009911075.1\|2283462_2284659_+	trypsin-like peptidase domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	8.7e-17	28.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP012912

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2114 : 8485

Streptococcus_phage(87.5%)

integrase

attL 4849:4860|attR 6331:6342

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002936168.1\|2114_2321_-	helix-turn-helix transcriptional regulator	A0A1S5SE31	Streptococcus_phage	4.3e-09	59.6
WP_002936170.1\|2338_2539_-	transcriptional regulator	NA	NA	NA	NA
WP_002936171.1\|2743_3250_+	helix-turn-helix transcriptional regulator	A0A1X9I723	Streptococcus_phage	1.8e-16	68.3
WP_002936172.1\|3637_4642_+	virulence RhuM family protein	Q9JMN3	Wolbachia_phage	3.9e-79	47.7
4849:4860	attL	NA	NA	NA	NA
WP_002936173.1\|4871_6044_+\|integrase	site-specific integrase	A0A1X9I5Y5	Streptococcus_phage	1.3e-211	95.4
WP_002939065.1\|6639_7044_-	ArpU family transcriptional regulator	A0A1X9I5Y7	Streptococcus_phage	8.4e-65	97.0
6331:6342	attR	NA	NA	NA	NA
WP_158500238.1\|7077_7335_-	hypothetical protein	A0A1X9I699	Streptococcus_phage	2.2e-18	71.2
WP_002939060.1\|7748_8291_-	hypothetical protein	A0A1X9I5U4	Streptococcus_phage	6.0e-50	57.1
WP_002939058.1\|8311_8485_-	sporulation protein Cse60	A0A1X9I5U0	Streptococcus_phage	1.2e-12	63.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP012911

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP012912

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection