CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP013667	Coxiella burnetii strain 3262 chromosome, complete genome	1 crisprs	cas5f,cas7f,cas6f,DEDDh,cas3	0	1	9	0
NZ_CP013668	Coxiella burnetii strain 3262 plasmid QpH1, complete sequence	0 crisprs	NA	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013667_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013667_1

1347289-1347370

Orphan

Consensus_repeat	Method
TTTTTGTTCGAGTCTTTCAGCTAAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013667_1

>merge|NZ_CP013667|1|1347289-1347370|CRISPRCasFinder
TTTTTGTTCGAGTCTTTCAGCTAAGCTTCGTCCTTCGGCGAGGCCTCTTTCGAAACCTTTTTGCTCGAGTCTTTCAGCTAAG

>NZ_CP013667|1|1|1347289-1347370|CRISPRCasFinder
TTTTTGTTCGAGTCTTTCAGCTAAG	CTTCGTCCTTCGGCGAGGCCTCTTTCGAAACC
TTTTTGCTCGAGTCTTTCAGCTAAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013667.1\|WP_040953281.1\|1358776_1359463_+\|GMP-synthase	unknown	unknown	gnl\|CDD\|181323
NZ_CP013667.1\|WP_080713307.1\|1344969_1345572_-\|DUF1601-domain-containing-protein	unknown	unknown	gnl\|CDD\|369458
NZ_CP013667.1\|WP_005769002.1\|1349527_1350118_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013667.1\|WP_010957788.1\|1356598_1356730_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013667.1\|WP_012220346.1\|1343429_1344836_-\|CBU_1063-family-Dot/Icm-T4SS-effector	unknown	unknown	unknown
NZ_CP013667.1\|WP_124224376.1\|1335828_1336608_-\|adenylate/guanylate-cyclase-domain-containing-protein	unknown	unknown	gnl\|CDD\|143636
NZ_CP013667.1\|WP_129545642.1\|1337877_1338135_-\|adenylate/guanylate-cyclase-domain-containing-protein	unknown	unknown	gnl\|CDD\|143636
NZ_CP013667.1\|WP_080713298.1\|1348880_1349507_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP013667.1\|WP_005769011.1\|1347674_1348106_-\|Rpn-family-recombination-promoting-nuclease/putative-transposase	unknown	unknown	gnl\|CDD\|368098
NZ_CP013667.1\|WP_012220345.1\|1339937_1340708_+\|tRNA-2-thiocytidine(32)-synthetase-TtcA	unknown	unknown	gnl\|CDD\|236737
NZ_CP013667.1\|WP_005768280.1\|1343139_1343424_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013667.1\|WP_040953318.1\|1340704_1342486_-\|SLC13-family-permease	unknown	unknown	gnl\|CDD\|238535
NZ_CP013667.1\|WP_010957785.1\|1348777_1348888_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013667.1\|WP_046036891.1\|1345730_1346750_+\|IS110-like-element-IS1111A-family-transposase	unknown	unknown	gnl\|CDD\|226077
NZ_CP013667.1\|WP_012220006.1\|1346746_1347019_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013667.1\|WP_040953278.1\|1348187_1348562_-\|response-regulator	unknown	unknown	gnl\|CDD\|381099
NZ_CP013667.1\|WP_040953279.1\|1354348_1356301_-\|acetoacetate--CoA-ligase	unknown	unknown	gnl\|CDD\|235134
NZ_CP013667.1\|WP_005768975.1\|1361061_1361934_+\|methylisocitrate-lyase	unknown	unknown	gnl\|CDD\|183086
NZ_CP013667.1\|WP_011996944.1\|1342557_1343112_+\|RNA-2',3'-cyclic-phosphodiesterase	unknown	unknown	gnl\|CDD\|274058
NZ_CP013667.1\|WP_040953280.1\|1357141_1358677_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794

Protein	Function_ID	Function_description	E-value
NZ_CP013667.1\|WP_080713307.1\|1344969_1345572_-\|DUF1601-domain-containing-protein	gnl\|CDD\|369458	pfam07671, DUF1601, Protein of unknown function (DUF1601). This repeat is found in a small number of proteins and is apparently limited to Coxiella and related species.	6.39259e-06
NZ_CP013667.1\|WP_124224376.1\|1335828_1336608_-\|adenylate/guanylate-cyclase-domain-containing-protein	gnl\|CDD\|143636	cd07302, CHD, cyclase homology domain. Catalytic domains of the mononucleotidyl cyclases (MNC's), also called cyclase homology domains (CHDs), are part of the class III nucleotidyl cyclases. This class includes eukaryotic and prokaryotic adenylate cyclases (AC's) and guanylate cyclases (GC's). They seem to share a common catalytic mechanism in their requirement for two magnesium ions to bind the polyphosphate moiety of the nucleotide.	9.59634e-31
NZ_CP013667.1\|WP_129545642.1\|1337877_1338135_-\|adenylate/guanylate-cyclase-domain-containing-protein	gnl\|CDD\|143636	cd07302, CHD, cyclase homology domain. Catalytic domains of the mononucleotidyl cyclases (MNC's), also called cyclase homology domains (CHDs), are part of the class III nucleotidyl cyclases. This class includes eukaryotic and prokaryotic adenylate cyclases (AC's) and guanylate cyclases (GC's). They seem to share a common catalytic mechanism in their requirement for two magnesium ions to bind the polyphosphate moiety of the nucleotide.	2.4552e-16
NZ_CP013667.1\|WP_080713298.1\|1348880_1349507_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	0.00201574
NZ_CP013667.1\|WP_005769011.1\|1347674_1348106_-\|Rpn-family-recombination-promoting-nuclease/putative-transposase	gnl\|CDD\|368098	pfam04754, Transposase_31, Putative transposase, YhgA-like. This family of putative transposases includes the YhgA sequence from Escherichia coli and several prokaryotic homologs.	1.74956e-45
NZ_CP013667.1\|WP_012220345.1\|1339937_1340708_+\|tRNA-2-thiocytidine(32)-synthetase-TtcA	gnl\|CDD\|236737	PRK10696, PRK10696, tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional.	3.45604e-158
NZ_CP013667.1\|WP_040953279.1\|1354348_1356301_-\|acetoacetate--CoA-ligase	gnl\|CDD\|235134	PRK03584, PRK03584, acetoacetate--CoA ligase.	0
NZ_CP013667.1\|WP_040953318.1\|1340704_1342486_-\|SLC13-family-permease	gnl\|CDD\|238535	cd01115, SLC13_permease, Permease SLC13 (solute carrier 13). The sodium/dicarboxylate cotransporter NaDC-1 has been shown to translocate Krebs cycle intermediates such as succinate, citrate, and alpha-ketoglutarate across plasma membranes rabbit, human, and rat kidney. It is related to renal and intestinal Na+/sulfate cotransporters and a few putative bacterial permeases. The SLC13-type proteins belong to the ArsB/NhaD superfamily of permeases that translocate sodium and various anions across biological membranes in all three kingdoms of life. A typical ArsB/NhaD permease is composed of 8-13 transmembrane helices.	1.05064e-60
NZ_CP013667.1\|WP_046036891.1\|1345730_1346750_+\|IS110-like-element-IS1111A-family-transposase	gnl\|CDD\|226077	COG3547, COG3547, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	4.56443e-38
NZ_CP013667.1\|WP_040953280.1\|1357141_1358677_+\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	4.536e-43
NZ_CP013667.1\|WP_040953278.1\|1348187_1348562_-\|response-regulator	gnl\|CDD\|381099	cd17546, REC_hyHK_CKI1_RcsC-like, phosphoacceptor receiver (REC) domain of hybrid sensor histidine kinases/response regulators similar to Arabidopsis thaliana CKI1 and Escherichia coli RcsC. This family is composed of hybrid sensor histidine kinases/response regulators that are sensor histidine kinases (HKs) fused with a REC domain, similar to the sensor histidine kinase CKI1 from Arabidopsis thaliana, which is involved in multi-step phosphorelay (MSP) signaling that mediates responses to a variety of important stimuli in plants. MSP involves a signal being transferred from HKs via histidine phosphotransfer proteins (AHP1-AHP5) to nuclear response regulators. The CKI1 REC domain specifically interacts with the downstream signaling protein AHP2, AHP3 and AHP5. The plant MSP system has evolved from the prokaryotic two-component system (TCS), which allows organisms to sense and respond to changes in environmental conditions. This family also includes bacterial hybrid sensor HKs such as Escherichia coli RcsC, which is a component of the Rcs signalling pathway that controls a variety of physiological functions like capsule synthesis, cell division, and motility. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	1.56645e-35
NZ_CP013667.1\|WP_040953281.1\|1358776_1359463_+\|GMP-synthase	gnl\|CDD\|181323	PRK08250, PRK08250, glutamine amidotransferase; Provisional.	5.46294e-88
NZ_CP013667.1\|WP_005768975.1\|1361061_1361934_+\|methylisocitrate-lyase	gnl\|CDD\|183086	PRK11320, prpB, 2-methylisocitrate lyase; Provisional.	0
NZ_CP013667.1\|WP_011996944.1\|1342557_1343112_+\|RNA-2',3'-cyclic-phosphodiesterase	gnl\|CDD\|274058	TIGR02258, UPF0097_protein_AF_2157, 2'-5' RNA ligase. This protein family consists of bacterial and archaeal proteins with two tandem copies of Pfam domain pfam02834. Members for which activity has been measured perform a reversible, ATP-independent 2'-5'-ligation of what is presumably a non-phyiological substrate: half-tRNA splice intermediates from an intron-containing yeast tRNA. The physiological substrate(s) in prokaryotes may include small 2'-5'-link-containing oligonucleotides, perhaps with regulatory or biosynthetic roles. [Transcription, RNA processing].	2.15908e-58

>NZ_CP013667.1|WP_012220006.1|1346746_1347019_-|hypothetical-protein
MDPPLLSTISFDEKKAVAFVYPASQFKLATIGALMNYARLMLIGLSASQSHRMNQLNQPQVLPYFHQPSLFRTRLVCLLLLILFFTHGGV
>NZ_CP013667.1|WP_046036891.1|1345730_1346750_+|IS110-like-element-IS1111A-family-transposase
MKDIKILGVDIAKDVFQLCGIDEWGEVIYTRRVKRAQYVSTVASLKVGCVVMEACGGANHWYRTFMGMGIPTQLISPQHVKPYVKSNKNDRNDAQAIAEAASRASMRFVRGKTVEQQDVQALLKIRDRLVKSRTALINEIRGLLQEYGLTMARGAKRFYEELPLILASEAVGLTPRMKRVLNCLYTELLNRDEAIGDYEEELKAVAKANEDCQRVQSIPGVGYLTALSVYASVGDIHQFHRSRQLSAFIGLVPRQHSSGNKEVLLGISKRGNVMLRTLLIHGARALLRHVKNKTDKKSLWLKALIERRGMNRACVALANKNAPIIWALLTRQETYRCGA
>NZ_CP013667.1|WP_080713307.1|1344969_1345572_-|DUF1601-domain-containing-protein
MTMKNPIPLDPIPLIRDFFHTAKQQKNRPLSLNPQDYQTIKSILDNQSHPAFNAQSIANLLLALAYRRTRWATLLNKELDRPLLHAIAQNADRFNPQDIANTLWALATMGINWRYVQENGSHLSLVHVIARNYNQFALKGAIQIMWAVLWFDIQLPENVLQHLKTVIASSKQPQSSRLHQRFAKLLARKVTLPFHNEYPI
>NZ_CP013667.1|WP_012220346.1|1343429_1344836_-|CBU_1063-family-Dot/Icm-T4SS-effector
MPSLKEELLDVLNFEVKDLPVFSSLEDELVVVGLDIDGLIFNHRYLTPYRPPYEEKIRKEIQNFHSPEYLEAHKLHIQESADCLIKKIKKIIDKKEAKVICASTPQGPGTDFGNAIKIDENLGKIKTDSCVVALTSIVEKLKIDGHGVELDTYLLADTNQDGETFLSISRETQNYNEKYQVKSAEKEPNYFKEKFNILYTHVHRLAVENPNKKISYHFLDDREDIIVQLSHYYNEYPQLIPKNVSVTLHLYHDDRYESFEKFDPIEGSGVVDPDYKRTFQNFTKYSVRNSTDLAENRKNTTEILLQQVKLQFEFYTKLLNDKILSLKNTENFDQKDLIDKLEALRDHAVKIKHEAPARSLKLLKLGTQVVLYAEKCIENKFKTTVARINQRQIVTETLKKAAENFGHRKWTFLRSIAEFLLTTILPLGILIRIGNKICHNQFTIFAPSKSSRHAVELGESAKKTFTAG
>NZ_CP013667.1|WP_005768280.1|1343139_1343424_+|hypothetical-protein
MAESVDDLTVEYVEDGVVTLKELDKVILTKGAWCTILFKIQTWNRSKQEYNPVSYTIRRYQKRSGEFKQRSKFTISSNDQAQKIIDTLSKWMSE
>NZ_CP013667.1|WP_011996944.1|1342557_1343112_+|RNA-2',3'-cyclic-phosphodiesterase
MKKIHSSIRTFIAVPLFPAERDQLQTAIKPLIKQWTHLRWLPPENWHLTLRFLGDVTPEALEILRQATAKEAKETIKFKININKIDTFPPEKLRLLVAYIERQEHLSQLFFNLDQAAEKAGLAREERLFLPHITLAKSRRPIRHFDPLDCDLSIHAEELVIFESRPTNDGSQYVPLYKFQFSLH
>NZ_CP013667.1|WP_040953318.1|1340704_1342486_-|SLC13-family-permease
MFQGPYTILIILVITMALFIWGYWRYDIVAAIALMLATLTGAVPFSKVYTGFSNPAVITVACVMIISQVITRSGAVAFMVRKITVAAKYHNLYVIILCVIAAILSAFMNNVGALALMMLVALRSSLKMKRSASLVLMPLALASAMGGLVTMIGTPPNLLISFYREQSTGQPFALFDYARVGFYVALAGVLFIALIGWRLLPRKRKGTRQPEDLFQIEDYLTEIKIPEKSPTIDKSIREFEKLIEAEFSIIGLIRKGKKHFALSPDEKLQPHDVLIVEISSEDLQELLQAGKIELVGDKKISSEVLKSKEVGIVEAVVPPGSRVENRSAESIRLRARYRLNLLAIARQGNPFRERLREINFRAGNVVLLQGPVDVLEENVASLGFLPLLERGLDVGMKRMAFLPIIIFIFAIFLAGVQWVPVEVAFGGAVILLLLFRLLPTRLIYESIDWPVIILLGAMIPVGEALQSTGGTTLIAHFISSFTKDYPPFIILGLVMIITMTLSDFMNNAATAVVMAPIGVSIAHSIHASVDPFLMAVAIAASCSFLTPIGHQNNALVMGPGGYKFFDYIRLGLPLEIVVLVLSLPLILWAWPLS
>NZ_CP013667.1|WP_012220345.1|1339937_1340708_+|tRNA-2-thiocytidine(32)-synthetase-TtcA
MSEKRVEKKLIHYVKKALNDYRMINTGDRVMVCLSGGKDSYTLLSLLNSIRIEGNYKFDIFAFVLDQSQPGWDDSALRGWLDDKKIPYEILTRDTYSIVKEKIPAGKTYCSLCSRLRRGIIYRYAEEQGFSKIALGHHRDDLIQTLLMSVFYNGQIRSMPPKLLSDNRRHVLIRPLAYCQERDIIKYAMEQQFPLIPCNLCGSQKNLMRQRVKRLISDLAKENPKVPSNMLRALSNIKPSQLMDHELWNFRELNVD
>NZ_CP013667.1|WP_129545642.1|1337877_1338135_-|adenylate/guanylate-cyclase-domain-containing-protein
MHGGDVMFGMVGEANRLEGTVIGDTVNLCARLLNYNETYKSPVLISESLKQHVDLDQANITARYLDEVTPKGITTPVRIYAVQTG
>NZ_CP013667.1|WP_124224376.1|1335828_1336608_-|adenylate/guanylate-cyclase-domain-containing-protein
MEFLNIKTVDAMKSGAHVDKPSTVLFADIVNFTAMANVSDVPKTFQYINTYTSSSSPVIRQHDGFVVKYFGDAILALFGGAQASVAAIQSAIQMIHRLKKIKSTKQTDISIGVSITSGLAELGIAGSDDRIGIVLLGSPVNRATGFNSLTRLFRVAILITEPVYQEIKLSSQFHTRFLDQVSSIDKKKQINVYEVFDADEQTIIDKKVSIMPHYEAAIRDFNARKFKTALAQLKKCLSILPDDQASQIYLERCQKELKQ
>NZ_CP013667.1|WP_005769011.1|1347674_1348106_-|Rpn-family-recombination-promoting-nuclease/putative-transposase
MKKIHNPHDYYFRTAMSDTRVAKEFFEYHLPNNILKAADLNSLQLQKSSFIDEHLKASMADVLYSVKLNRRPGYFYIIVEHQRNPDKLMPYRLLRYILRIIDHHLKKKDYLPLPIVVPLVFYNGKKRYPFQRIFLLYLAKKSH
>NZ_CP013667.1|WP_040953278.1|1348187_1348562_-|response-regulator
MITKKPIKKPLILLVEDNTFIQKIHVQLLKKLNCEVTLAIDGQSALALYSDKFDLIFLDINLSEMNGMEVCKAIRQRTSSTPIIALTSESSKNKPRYFSTGINDFIKKPTTQAALKRVLNYWIQ
>NZ_CP013667.1|WP_010957785.1|1348777_1348888_+|hypothetical-protein
MRFFLHLLKSGGDGYEAFEGRTLGQSKAGASGARND
>NZ_CP013667.1|WP_080713298.1|1348880_1349507_+|helix-turn-helix-transcriptional-regulator
MTKLSRREFAKKSGIANTTLQHWEDGEKHTLPEKSVRRFIKALLNLGVHCSYDWLMHGKGPAPQYAGHVIFQEETTDLPTHGARQKNEDEEIKEELTLFLSRNKNTVHLVVSDDAMEPRFVQGEVVAGVRVYGKEIEKLIGLDCIVLVQGDDLLLRTILKGDVEGYYHLGYTNPKTTASKPFLYNIELVNAAPVIWARRNSHRYKSPK
>NZ_CP013667.1|WP_005769002.1|1349527_1350118_+|hypothetical-protein
MDKGYHKTVGGIGGHILRRFIHLSMLIIPFLYYSYAKSRFNLFGLSYKSLLLVIIGLMLLFEIVRLKRGWLLWGQREREGKNFSSLAWTIVSLCLVLLLAPGKQYAIPIIWSCAIVDPLLGELRRTQLSRTWIVFIGIVVVMLIWGLASWWFKLDWLLVLLMGPLVVILEWPNFRWLDDNALVQLVPLLVILILYG
>NZ_CP013667.1|WP_040953279.1|1354348_1356301_-|acetoacetate--CoA-ligase
MEASKPLWEPSSETRLQSQMSHFISDINKRFSLKIEGYPALYQWSIDQPALFWKAVWDFCGISASQAPTNVLVRGKRMEESQWFLGAKLNFAENLLRHRNQNVALIFTSETGFSRSITYAELYTEVAALAGFLRQCHVVPGDRVVGVLSNQIETVIAMLATASVGAIWSACSPDFGLEGLIDRFGQIKPKVLFAVDSHTYKGKTYHHLDKIRQLQQQLTSLTHTIIVPNHQKNIAINELKNASLYPDCLRATSLPFYFEALPFDHPVYILYSSGTTGKPKCMVHSAGGTLLQHLKELILHTDLRPSQRIFFYTTCSWMMWNWLMSSLAVGATVVLYDGAPFYPTPTALFDLIDKVGISIFGVGAKILEPAEKFDLVPKKTHNLLSLKTILTTGSPLLPKSFDYVYNNVKSDIQLSSISGGSDIISCFALGNSLLPVYRGELQCIGLGMDVKIFNDDGDFVIEEKGELVCKSPFPSMPIYFWNDPEGKKYHQAYFDKYPNTWAHGDYAKTTKRGTLIIYGRSDTTLNPGGIRIGTAEIYQQVEKIKEILDCLVTSQQWKGDERIILFVVLQKETTLTDPLRKKIQTTIRQNLSPHHVPNKIIAVPDLPRTKSGKIVELAVKKIINGESVNNLTALENPKILEYFQNLKELG
>NZ_CP013667.1|WP_010957788.1|1356598_1356730_+|hypothetical-protein
MLLVDQALLQQAILLGWTSELPIIVKMNDLPKEKQPHSADPDF
>NZ_CP013667.1|WP_040953280.1|1357141_1358677_+|MFS-transporter
MFSYFLAKGSFNHVYKERYSESYYHAIAEKDKIFKITLVISAFLSMIFLDQTAVGVTLASIQKELVLSASTIAWIMNAYMITLSAFLLLFARLSDSIGIKNLFCAGILIFLLASLSCAVSNSGAGLIINRGLQGIGASMGYATYLLIFNNQVPANKRGKVLGKSAAFAAVFLALGPLIGGFFSNVISWRYLFWLNVPICLVCFYFAISACNKDSHPVNHAFLDKLGLLIYLFAMTGLIFFLMEGPTLGWTNPAILISLISSLLFFTLFVYHEKRQRQPLIEMALFKNKEFFASVLILFGNYACITTMAFWALWIEQVLGYSPLMTGVALLPAGVPFGIIIDGSHTGFKTSMDALNLTTKPFVFSHSGVYCLAPHVRNVRDEQIKSVAATGGVIGVNGLGILLGDVNASIGKYVDHIDYITKLVGAQHVAIGLDNLYFANQFSEFMSQQGITHPQAYASKVNNATLWRCLQPENVIEVVEMLLQRGYSENEIKGILGGNILRIMGYFSSCSN
>NZ_CP013667.1|WP_040953281.1|1358776_1359463_+|GMP-synthase
MKIHYIMHAPFEKLSAIEVWATQKSYDLSGTHVYKGEKLSRALNFDCLILMGGPQSPFKTDKYPYLLDEIQFVKKALAGNKKILGICLGAQLIAEALGAKTLHSPYKEIGIYPIQTLPEATDDPFFSKLPKSFDVMHWHNDMPGIPKDVVLLAKGEGCPHQAFRYGDRVYGFQFHMELTLSVIEEMIEKYRGDLEPGKFVRTKEEMLHSNYNEVNAKMFTFLDYLEGV
>NZ_CP013667.1|WP_005768975.1|1361061_1361934_+|methylisocitrate-lyase
MSPGKLFRQAVANEHPLQIVGAINAYCALLAENVGFKAIYLSGGGVANTLGLPDLGITDLHDVLEDARRITAATHLPLLVDIDTGFGGAFTIARAIKEMERAQVAAVHMEDQVAQKRCGHRPGKELVNTNEMVDRIKAAVDVKSNDFVLIARTDAYAVEGLKATIDRACTYVEAGADMIFAEALENINDYPTFCKAVKVPVLANMTEFGKTPLYTAAQLADHGVKMVLYPRSADRAMSKAALAVYEDIKKHGVQTASLPFMQTREALYEVLNYHAYEDKLNQLFKRKEDD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP013667_1	1.1\|1347314\|32\|NZ_CP013667\|CRISPRCasFinder	1347314-1347345	32	NC_009620	Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence	767068-767099	8	0.75

1. spacer 1.1|1347314|32|NZ_CP013667|CRISPRCasFinder matches to NC_009620 (Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence) position: , mismatch: 8, identity: 0.75

cttcgtccttcggcgaggcctctttcgaaacc	CRISPR spacer
tgcctcgcttcggcgaggcctctttcgcaaca	Protospacer
. .* . ******************** ***

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

500356 : 569918

Streptococcus_phage(40.0%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046036993.1\|500356_501376_-\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	1.8e-10	26.4
WP_012220820.1\|501551_502466_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	5.1e-94	57.7
WP_010958474.1\|502495_502633_+	hypothetical protein	NA	NA	NA	NA
WP_017253405.1\|503837_505286_-	glycosyltransferase family 39 protein	NA	NA	NA	NA
WP_005770178.1\|505290_506250_-	ribose-phosphate pyrophosphokinase	A0A2K9L2G2	Tupanvirus	3.2e-38	35.0
WP_011996384.1\|506424_507057_-	lipoprotein localization protein LolB	NA	NA	NA	NA
WP_010958470.1\|507063_508317_+	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_010958469.1\|508350_509496_-	CCA-adding protein	S5MVS8	Sinorhizobium_phage	1.3e-62	38.6
WP_040953425.1\|509502_510351_+	phosphatidylserine decarboxylase	NA	NA	NA	NA
WP_040953427.1\|510330_510702_-	Dot/Icm T4SS effector CoxDFB6	NA	NA	NA	NA
WP_040953424.1\|511003_512053_-	Dot/Icm T4SS effector CoxH4	NA	NA	NA	NA
WP_010958466.1\|512112_512703_+	superoxide dismutase family protein	Q9MC02	Salmonella_phage	5.0e-34	46.4
WP_005770158.1\|512818_513316_+	DUF1778 domain-containing protein	NA	NA	NA	NA
WP_010958464.1\|513318_513843_+	hypothetical protein	NA	NA	NA	NA
WP_017253234.1\|513859_514993_-	CBU_1819 family Dot/Icm T4SS effector	NA	NA	NA	NA
WP_017253235.1\|515045_516491_-	CBU_1818 family Dot/Icm T4SS effector	NA	NA	NA	NA
WP_005770152.1\|516712_517678_-	elongation factor P--(R)-beta-lysine ligase	A0A1V0SAC0	Catovirus	3.5e-24	27.3
WP_005772139.1\|517682_518249_-	elongation factor P	NA	NA	NA	NA
WP_010958461.1\|518320_520309_+	primosomal protein N'	NA	NA	NA	NA
WP_080938447.1\|520438_520711_+	hypothetical protein	NA	NA	NA	NA
WP_005772222.1\|520707_521727_-\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	1.8e-10	26.4
WP_017252686.1\|521830_522544_-	outer membrane beta-barrel protein	NA	NA	NA	NA
WP_012220811.1\|522580_522709_-	hypothetical protein	NA	NA	NA	NA
WP_017252685.1\|522689_523817_-	4-phosphoerythronate dehydrogenase	NA	NA	NA	NA
WP_017252684.1\|523883_525407_+	TolC family protein	NA	NA	NA	NA
WP_012220808.1\|525409_526585_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_010958456.1\|526577_527243_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.1e-35	40.0
WP_080513004.1\|527232_528447_+	ABC transporter permease	NA	NA	NA	NA
WP_010958454.1\|529567_529855_+	hypothetical protein	NA	NA	NA	NA
WP_012220006.1\|529934_530207_+	hypothetical protein	NA	NA	NA	NA
WP_040953503.1\|530203_531223_-\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	6.7e-10	25.9
WP_010958453.1\|531307_531691_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_005772150.1\|531702_531957_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_010958452.1\|531975_532104_-	hypothetical protein	NA	NA	NA	NA
WP_017252657.1\|532293_532932_+	hypothetical protein	NA	NA	NA	NA
WP_017252658.1\|532955_533252_+	hypothetical protein	NA	NA	NA	NA
WP_010958450.1\|534014_534476_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_017252659.1\|534857_536801_-	APC family permease	NA	NA	NA	NA
WP_010958447.1\|536929_537370_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_017252661.1\|537374_539003_-	amino acid permease	NA	NA	NA	NA
WP_017252662.1\|539053_541762_+	DNA polymerase I	A0A2H4J6W7	uncultured_Caudovirales_phage	6.0e-66	31.4
WP_010958443.1\|546009_546876_+	CBU_1789 family Dot/Icm type IV secretion system effector	NA	NA	NA	NA
WP_005772156.1\|547846_549682_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	4.7e-131	43.4
WP_010958440.1\|549718_550921_+	ATP-binding protein	NA	NA	NA	NA
WP_010957319.1\|550993_551266_+	hypothetical protein	NA	NA	NA	NA
WP_046036888.1\|551262_552282_-\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	6.7e-10	25.9
WP_080513002.1\|552480_554499_+	transketolase	NA	NA	NA	NA
WP_010958438.1\|554513_555518_+	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_010958437.1\|555589_556804_+	phosphoglycerate kinase	NA	NA	NA	NA
WP_180991540.1\|556811_558245_+	pyruvate kinase	NA	NA	NA	NA
WP_012220006.1\|559998_560271_+	hypothetical protein	NA	NA	NA	NA
WP_040953503.1\|560267_561287_-\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	6.7e-10	25.9
WP_005770375.1\|561456_562548_+	fructose-bisphosphate aldolase class II	NA	NA	NA	NA
WP_010958434.1\|562607_562793_+	hypothetical protein	NA	NA	NA	NA
WP_012220794.1\|563894_564278_-	SEL1-like repeat protein	NA	NA	NA	NA
WP_012220792.1\|564547_565165_+	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_010958432.1\|565399_567145_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_010958431.1\|567243_568560_+	nitrate/sulfonate/bicarbonate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.0e-34	39.5
WP_010957319.1\|568629_568902_+	hypothetical protein	NA	NA	NA	NA
WP_040953503.1\|568898_569918_-\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	6.7e-10	25.9

DBSCAN-SWA_2

687083 : 737607

Streptococcus_phage(71.43%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_040953503.1\|687083_688103_-\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	6.7e-10	25.9
WP_010958348.1\|688344_688440_-	hypothetical protein	NA	NA	NA	NA
WP_017252654.1\|688494_690939_-	type IVB secretion system protein DotA	NA	NA	NA	NA
WP_010958350.1\|690935_691430_-	hypothetical protein	NA	NA	NA	NA
WP_017252655.1\|691619_692069_+	hypothetical protein	NA	NA	NA	NA
WP_017252656.1\|692065_692524_+	hypothetical protein	NA	NA	NA	NA
WP_010958351.1\|692539_693670_+	phosphoesterase	NA	NA	NA	NA
WP_046036888.1\|694224_695244_+\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	6.7e-10	25.9
WP_010957319.1\|695240_695513_-	hypothetical protein	NA	NA	NA	NA
WP_010958352.1\|695693_695876_+	virulence factor	NA	NA	NA	NA
WP_010958353.1\|695900_697391_-	bifunctional D-glycero-beta-D-manno-heptose-7-phosphate kinase/D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase HldE	E3SJ88	Synechococcus_phage	1.2e-15	44.6
WP_040953503.1\|697622_698642_+\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	6.7e-10	25.9
WP_012220006.1\|698638_698911_-	hypothetical protein	NA	NA	NA	NA
WP_040953397.1\|699138_700335_+	CBU_1639 family Dot/Icm T4SS effector	NA	NA	NA	NA
WP_010958343.1\|700446_701652_+	ATP-binding protein	NA	NA	NA	NA
WP_017253150.1\|701736_702912_+	Dot/Icm T4SS effector CoxCC14	NA	NA	NA	NA
WP_005769595.1\|703540_703690_+	hypothetical protein	NA	NA	NA	NA
WP_010958340.1\|703686_704403_+	Dot/Icm secretion system protein IcmQ	NA	NA	NA	NA
WP_010958339.1\|704403_705567_+	type IVB secretion system coupling complex protein DotM/IcmP	NA	NA	NA	NA
WP_010958338.1\|705542_707921_+	TraM recognition domain-containing protein	NA	NA	NA	NA
WP_017253152.1\|707930_708590_+	OmpA family protein	NA	NA	NA	NA
WP_005769604.1\|708595_709219_+	type IVB secretion system apparatus protein IcmL.2	NA	NA	NA	NA
WP_010958336.1\|709220_709877_+	type IVB secretion system apparatus protein IcmL.1	NA	NA	NA	NA
WP_012569740.1\|709887_710943_+	DotH/IcmK family type IV secretion protein	NA	NA	NA	NA
WP_080713332.1\|710929_714049_+	type IVB secretion system protein DotG/IcmE	NA	NA	NA	NA
WP_010958333.1\|714066_714801_+	hypothetical protein	NA	NA	NA	NA
WP_010958332.1\|714871_715381_+	hypothetical protein	NA	NA	NA	NA
WP_005769614.1\|715474_715891_+	hypothetical protein	NA	NA	NA	NA
WP_010958331.1\|715903_716542_+	HNH endonuclease	NA	NA	NA	NA
WP_010958330.1\|716614_719626_+	type IVa secretion system protein IcmB	NA	NA	NA	NA
WP_005769621.1\|719640_719778_-	hypothetical protein	NA	NA	NA	NA
WP_040953395.1\|719995_720202_-	hypothetical protein	NA	NA	NA	NA
WP_012220725.1\|720222_720522_-	hypothetical protein	NA	NA	NA	NA
WP_026051240.1\|720578_720926_-	hypothetical protein	NA	NA	NA	NA
WP_017253183.1\|721218_721662_+	hypothetical protein	NA	NA	NA	NA
WP_012220723.1\|721833_722436_+	hypothetical protein	NA	NA	NA	NA
WP_010958327.1\|723003_723159_+	hypothetical protein	NA	NA	NA	NA
WP_040939795.1\|723262_723358_+	hypothetical protein	NA	NA	NA	NA
WP_026051241.1\|723566_723863_+	hypothetical protein	NA	NA	NA	NA
WP_005772725.1\|726550_726949_+	CBU_1607 family Dot/Icm T4SS effector	NA	NA	NA	NA
WP_040953394.1\|727348_729445_-	mechanosensitive ion channel	NA	NA	NA	NA
WP_010958325.1\|729599_730628_-	succinylglutamate desuccinylase/aspartoacylase family protein	NA	NA	NA	NA
WP_005769646.1\|730630_731536_-	30S ribosomal protein S6--L-glutamate ligase	I3ULC9	Synechococcus_phage	2.2e-36	34.4
WP_061299194.1\|731532_732018_-\|protease	ATP-dependent zinc protease	NA	NA	NA	NA
WP_010957319.1\|732211_732484_+	hypothetical protein	NA	NA	NA	NA
WP_040953503.1\|732480_733500_-\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	6.7e-10	25.9
WP_005773037.1\|733722_734268_+	porin family protein	NA	NA	NA	NA
WP_040953392.1\|735016_736231_-	hypothetical protein	NA	NA	NA	NA
WP_010957319.1\|736318_736591_+	hypothetical protein	NA	NA	NA	NA
WP_005772222.1\|736587_737607_-\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	1.8e-10	26.4

DBSCAN-SWA_3

743223 : 795316

Streptococcus_phage(45.45%)

transposase,holin,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_040953503.1\|743223_744243_+\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	6.7e-10	25.9
WP_080938449.1\|744239_744512_-	hypothetical protein	NA	NA	NA	NA
WP_012220714.1\|745981_746287_+\|holin	bacteriophage holin	NA	NA	NA	NA
WP_010958318.1\|746407_748714_+	putative monovalent cation/H+ antiporter subunit A	NA	NA	NA	NA
WP_010958317.1\|748710_749118_+	Na+/H+ antiporter subunit B	NA	NA	NA	NA
WP_005772121.1\|749114_749486_+	NADH-quinone oxidoreductase subunit K	NA	NA	NA	NA
WP_017253377.1\|749482_750982_+	Na+/H+ antiporter subunit D	NA	NA	NA	NA
WP_010958315.1\|750978_751326_+	Na+/H+ antiporter subunit E	NA	NA	NA	NA
WP_010958314.1\|751322_751625_+	sodium:proton antiporter	NA	NA	NA	NA
WP_010958313.1\|751617_751998_+	monovalent cation/H(+) antiporter subunit G	NA	NA	NA	NA
WP_010958312.1\|752038_752161_-	hypothetical protein	NA	NA	NA	NA
WP_010958311.1\|752571_753669_-	cell division protein ZapE	NA	NA	NA	NA
WP_010958310.1\|753665_754259_-	NAD(P)H:quinone oxidoreductase	NA	NA	NA	NA
WP_017252888.1\|754369_755206_+	YihY family inner membrane protein	NA	NA	NA	NA
WP_010958309.1\|755208_756153_+	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_040953390.1\|756118_758638_-	CBU_1576 family Dot/Icm T4SS effector	NA	NA	NA	NA
WP_040953503.1\|758829_759849_+\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	6.7e-10	25.9
WP_012220006.1\|759845_760118_-	hypothetical protein	NA	NA	NA	NA
WP_005772109.1\|760159_760603_-	protein TolR	NA	NA	NA	NA
WP_005772108.1\|760580_761294_-	protein TolQ	NA	NA	NA	NA
WP_040953503.1\|762793_763813_+\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	6.7e-10	25.9
WP_012220006.1\|763809_764082_-	hypothetical protein	NA	NA	NA	NA
WP_005772105.1\|764167_765223_-	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	1.0e-05	27.4
WP_005772102.1\|767083_767686_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_010958304.1\|767682_768201_-	crossover junction endodeoxyribonuclease RuvC	NA	NA	NA	NA
WP_017252979.1\|768316_769051_-	Dot/Icm type IV secretion system effector transcriptional regulator CvpC	NA	NA	NA	NA
WP_010958303.1\|769066_770899_-\|tRNA	aspartate--tRNA ligase	NA	NA	NA	NA
WP_012220710.1\|770993_771869_+	hypothetical protein	NA	NA	NA	NA
WP_040953389.1\|772546_773539_+	hypothetical protein	NA	NA	NA	NA
WP_080512995.1\|773535_774324_-	hypothetical protein	NA	NA	NA	NA
WP_010958301.1\|774406_774532_-	hypothetical protein	NA	NA	NA	NA
WP_010958300.1\|774580_774673_-	hypothetical protein	NA	NA	NA	NA
WP_017252983.1\|774841_775471_-	DUF502 domain-containing protein	A0A2I7S9X1	Vibrio_phage	3.7e-11	25.0
WP_005772089.1\|775467_775743_-	FmdB family transcriptional regulator	NA	NA	NA	NA
WP_010958299.1\|775969_777673_-	Dot/Icm T4SS effector CoxCC11	NA	NA	NA	NA
WP_040953472.1\|777782_778928_-\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_012220006.1\|779124_779397_+	hypothetical protein	NA	NA	NA	NA
WP_010958298.1\|780592_781798_-	ribonucleotide-diphosphate reductase subunit beta	A0A060BQZ3	Podovirus	7.9e-34	29.5
WP_010958297.1\|781847_784673_-	ribonucleoside-diphosphate reductase subunit alpha	A0A2H4P767	Pseudomonas_phage	2.3e-177	43.6
WP_010958296.1\|784694_784796_-	hypothetical protein	NA	NA	NA	NA
WP_040953388.1\|784848_784959_+	hypothetical protein	NA	NA	NA	NA
WP_026051176.1\|785045_785555_+	RNA pyrophosphohydrolase	NA	NA	NA	NA
WP_026051177.1\|785562_787836_+	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	3.1e-15	29.1
WP_005772080.1\|787890_788676_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_010958292.1\|788677_789052_+	hypothetical protein	NA	NA	NA	NA
WP_005772639.1\|789048_789843_+	thymidylate synthase	A6M9A2	Geobacillus_virus	2.6e-110	66.3
WP_005772222.1\|790814_791834_+\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	1.8e-10	26.4
WP_012220006.1\|791830_792103_-	hypothetical protein	NA	NA	NA	NA
WP_012220701.1\|793372_793939_+	Dot/Icm T4SS effector CoxCC10	NA	NA	NA	NA
WP_012220006.1\|794027_794300_+	hypothetical protein	NA	NA	NA	NA
WP_040953503.1\|794296_795316_-\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	6.7e-10	25.9

DBSCAN-SWA_4

805692 : 855272

Streptococcus_phage(42.86%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_040953503.1\|805692_806712_+\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	6.7e-10	25.9
WP_080938449.1\|806708_806981_-	hypothetical protein	NA	NA	NA	NA
WP_017253419.1\|809169_811080_+	S9 family peptidase	NA	NA	NA	NA
WP_017253417.1\|811251_812631_-	DUF1460 domain-containing protein	NA	NA	NA	NA
WP_010958280.1\|812702_812798_+	hypothetical protein	NA	NA	NA	NA
WP_012220693.1\|812850_814527_+	hypothetical protein	NA	NA	NA	NA
WP_012220692.1\|814580_815876_+	hypothetical protein	NA	NA	NA	NA
WP_040947956.1\|816712_816946_-	hypothetical protein	NA	NA	NA	NA
WP_010958278.1\|817323_817758_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_005772051.1\|817762_818020_+	glutaredoxin 3	V9QKN6	Rhizobium_phage	4.1e-09	44.6
WP_005772050.1\|818032_818518_+	protein-export chaperone SecB	NA	NA	NA	NA
WP_010958277.1\|818586_819585_+	NAD(P)-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_017253414.1\|819612_820071_-\|tRNA	tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL	NA	NA	NA	NA
WP_012220690.1\|820359_820611_-	hypothetical protein	NA	NA	NA	NA
WP_005772046.1\|820774_820993_-	hypothetical protein	NA	NA	NA	NA
WP_017253411.1\|820996_821689_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_026051283.1\|821807_822581_+	SDR family NAD(P)-dependent oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	8.1e-08	29.3
WP_010958273.1\|822588_823302_+	hypothetical protein	NA	NA	NA	NA
WP_005772043.1\|823298_824084_-	ZIP family metal transporter	NA	NA	NA	NA
WP_005772042.1\|824232_825183_+	acetyl-CoA carboxylase carboxyltransferase subunit alpha	NA	NA	NA	NA
WP_040953384.1\|825158_826508_+\|tRNA	tRNA lysidine(34) synthetase TilS	M1IAK8	Acanthocystis_turfacea_Chlorella_virus	5.8e-09	22.4
WP_010958272.1\|826585_828217_+	ATP-binding protein	NA	NA	NA	NA
WP_080512994.1\|828239_830468_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.5e-94	34.0
WP_010958270.1\|830484_830922_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_040953503.1\|831035_832055_+\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	6.7e-10	25.9
WP_012220006.1\|832051_832324_-	hypothetical protein	NA	NA	NA	NA
WP_080713330.1\|832431_834276_+	elongation factor 4	E4ZFJ7	Streptococcus_phage	9.6e-23	25.9
WP_017253496.1\|834272_835043_+	signal peptidase I	NA	NA	NA	NA
WP_010958268.1\|835063_835765_+	ribonuclease III	A0A0P0CQ80	Ostreococcus_lucimarinus_virus	4.3e-24	34.2
WP_010958267.1\|835761_836649_+	GTPase Era	NA	NA	NA	NA
WP_012220685.1\|836645_837350_+	DNA repair protein RecO	NA	NA	NA	NA
WP_012220006.1\|837381_837654_+	hypothetical protein	NA	NA	NA	NA
WP_040953503.1\|837650_838670_-\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	6.7e-10	25.9
WP_005772029.1\|840065_840197_+	hypothetical protein	NA	NA	NA	NA
WP_012220684.1\|840274_841675_+	hypothetical protein	NA	NA	NA	NA
WP_012220683.1\|841697_842561_+	hypothetical protein	NA	NA	NA	NA
WP_040953381.1\|842642_843365_+	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
WP_040948181.1\|843383_844106_-	hypothetical protein	NA	NA	NA	NA
WP_040948180.1\|844136_844394_-	hypothetical protein	NA	NA	NA	NA
WP_012220006.1\|844577_844850_+	hypothetical protein	NA	NA	NA	NA
WP_005772222.1\|844846_845866_-\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	1.8e-10	26.4
WP_012220681.1\|845864_846104_+	hypothetical protein	NA	NA	NA	NA
WP_012220680.1\|846269_847943_-	CBU_1493 family Dot/Icm T4SS effector	NA	NA	NA	NA
WP_040953472.1\|848270_849416_-\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_010958264.1\|849774_850113_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A222YWE2	Escherichia_phage	3.5e-08	41.9
WP_010958263.1\|850118_850430_+	HigA family addiction module antidote protein	M9MUN2	Rhodococcus_phage	7.0e-11	45.3
WP_010958262.1\|850498_851230_-	UDP-2,3-diacylglucosamine diphosphatase	NA	NA	NA	NA
WP_010958261.1\|851386_852784_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_010958260.1\|852774_854157_+\|tRNA	cysteine--tRNA ligase	A0A2K9L6B7	Tupanvirus	7.6e-49	28.6
WP_005772222.1\|854252_855272_+\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	1.8e-10	26.4

DBSCAN-SWA_5

866745 : 933714

Streptococcus_phage(40.0%)

transposase,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046036891.1\|866745_867765_+\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	6.7e-10	25.9
WP_012220006.1\|867761_868034_-	hypothetical protein	NA	NA	NA	NA
WP_005772006.1\|868202_869636_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_005772005.1\|869640_871092_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_005772004.1\|871095_871395_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_040953378.1\|871542_871743_-	hypothetical protein	NA	NA	NA	NA
WP_026051278.1\|871956_873003_+	rod shape-determining protein	NA	NA	NA	NA
WP_017253387.1\|873085_873964_+	rod shape-determining protein MreC	NA	NA	NA	NA
WP_010958247.1\|873969_874458_+	rod shape-determining protein MreD	NA	NA	NA	NA
WP_040953377.1\|874457_877919_+	DUF3971 domain-containing protein	NA	NA	NA	NA
WP_010958245.1\|877989_879423_+\|protease	metalloprotease TldD	NA	NA	NA	NA
WP_005772705.1\|879399_879741_-	hypothetical protein	NA	NA	NA	NA
WP_017253385.1\|879745_880204_-	EVE domain-containing protein	NA	NA	NA	NA
WP_005772706.1\|880508_880793_+	HU family DNA-binding protein	A7KV42	Bacillus_phage	7.1e-18	55.1
WP_010958243.1\|880795_880993_+	hypothetical protein	NA	NA	NA	NA
WP_040953503.1\|881392_882412_+\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	6.7e-10	25.9
WP_012220006.1\|882408_882681_-	hypothetical protein	NA	NA	NA	NA
WP_040953376.1\|882714_882879_+	hypothetical protein	NA	NA	NA	NA
WP_040947945.1\|885695_886481_+	Dot/Icm T4SS effector CoxCC7	NA	NA	NA	NA
WP_005771989.1\|887005_887152_+	hypothetical protein	NA	NA	NA	NA
WP_010958239.1\|887274_888435_-	ATP-binding protein	NA	NA	NA	NA
WP_046036970.1\|888619_890644_+	Dot/Icm type IV secretion system effector CoxTRP1	NA	NA	NA	NA
WP_040953374.1\|891156_891672_+	hypothetical protein	NA	NA	NA	NA
WP_080713326.1\|891664_893476_+	hypothetical protein	NA	NA	NA	NA
WP_040953373.1\|893466_894774_+	hypothetical protein	NA	NA	NA	NA
WP_040939758.1\|894751_895237_+	hypothetical protein	NA	NA	NA	NA
WP_012220665.1\|895365_896934_+	SurA N-terminal domain-containing protein	NA	NA	NA	NA
WP_005769081.1\|897786_898554_+	triose-phosphate isomerase	NA	NA	NA	NA
WP_005769079.1\|898535_898832_+	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_010958235.1\|899122_899485_+	NADH-quinone oxidoreductase subunit A	NA	NA	NA	NA
WP_005769074.1\|899489_899975_+	NADH-quinone oxidoreductase subunit B	NA	NA	NA	NA
WP_012220664.1\|899984_900668_+	NADH-quinone oxidoreductase subunit C	NA	NA	NA	NA
WP_078068422.1\|900639_901914_+	NADH-quinone oxidoreductase subunit D	NA	NA	NA	NA
WP_017252939.1\|901913_902438_+	NADH-quinone oxidoreductase subunit NuoE	NA	NA	NA	NA
WP_010958231.1\|902427_903696_+	NADH-quinone oxidoreductase subunit NuoF	NA	NA	NA	NA
WP_012220661.1\|903806_906170_+	NADH-quinone oxidoreductase subunit G	NA	NA	NA	NA
WP_005769061.1\|906169_907192_+	NADH-quinone oxidoreductase subunit NuoH	NA	NA	NA	NA
WP_012220660.1\|907188_907680_+	NADH-quinone oxidoreductase subunit NuoI	NA	NA	NA	NA
WP_005769059.1\|907693_908299_+	NADH-quinone oxidoreductase subunit J	NA	NA	NA	NA
WP_005769056.1\|908295_908601_+	NADH-quinone oxidoreductase subunit NuoK	NA	NA	NA	NA
WP_012220659.1\|908657_910619_+	NADH-quinone oxidoreductase subunit L	NA	NA	NA	NA
WP_010958227.1\|910623_912144_+	NADH-quinone oxidoreductase subunit M	NA	NA	NA	NA
WP_010958226.1\|912153_913602_+	NADH-quinone oxidoreductase subunit NuoN	NA	NA	NA	NA
WP_010958225.1\|913979_914441_+	ribosome maturation factor RimP	NA	NA	NA	NA
WP_017252940.1\|914444_915956_+	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_012220657.1\|915961_918373_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	4.2e-26	24.5
WP_005769039.1\|918460_918820_+	ribosome-binding factor A	NA	NA	NA	NA
WP_017252941.1\|918797_919727_+\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_010957319.1\|920258_920531_+	hypothetical protein	NA	NA	NA	NA
WP_046036967.1\|920527_921547_-\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	3.9e-10	25.9
WP_017253499.1\|921898_922444_-	DUF962 domain-containing protein	NA	NA	NA	NA
WP_010957319.1\|922560_922833_+	hypothetical protein	NA	NA	NA	NA
WP_040953503.1\|922829_923849_-\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	6.7e-10	25.9
WP_005772424.1\|928469_929861_-	sugar porter family MFS transporter	O13311	Aichi_virus	3.4e-28	29.1
WP_010957521.1\|929901_930585_-	phosphoglycolate phosphatase	NA	NA	NA	NA
WP_010957522.1\|930577_931282_-	bifunctional 3-demethylubiquinone 3-O-methyltransferase/2-octaprenyl-6-hydroxy phenol methylase	A0A1B1IVA4	uncultured_Mediterranean_phage	2.8e-07	32.7
WP_010957523.1\|931268_931622_-	Hpt domain-containing protein	NA	NA	NA	NA
WP_010957524.1\|931667_932561_-	cation transporter	A0A1V0SED0	Indivirus	3.7e-12	30.4
WP_005769160.1\|932697_933714_-\|protease	protease SohB	A0A2H4UUF9	Bodo_saltans_virus	6.0e-19	27.5

DBSCAN-SWA_6

1084544 : 1142841

Streptococcus_phage(35.71%)

transposase,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046036942.1\|1084544_1085564_+\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	1.8e-10	26.4
WP_012220006.1\|1085560_1085833_-	hypothetical protein	NA	NA	NA	NA
WP_040953351.1\|1085959_1087630_-	DNA repair protein RecN	NA	NA	NA	NA
WP_041952469.1\|1087634_1088534_-	NAD(+) kinase	NA	NA	NA	NA
WP_010958133.1\|1088543_1088873_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_005770889.1\|1088862_1089240_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_010958132.1\|1089294_1089921_+	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_012220588.1\|1090050_1091448_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_005770884.1\|1091450_1092044_-	biotin/lipoyl-binding protein	NA	NA	NA	NA
WP_005770882.1\|1092209_1094180_+	molecular chaperone DnaK	G8DDB7	Micromonas_pusilla_virus	5.8e-151	52.3
WP_010958131.1\|1094324_1095449_+	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	2.0e-23	28.7
WP_011997058.1\|1097368_1098751_-	ATP-binding protein	NA	NA	NA	NA
WP_005770872.1\|1100174_1101485_-	ATP-binding protein	NA	NA	NA	NA
WP_010958127.1\|1103257_1104466_+	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	3.8e-52	34.6
WP_040953349.1\|1104547_1107769_+	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
WP_017253300.1\|1107818_1108058_-	hypothetical protein	NA	NA	NA	NA
WP_010958124.1\|1108279_1108801_+	transcription elongation factor GreA	NA	NA	NA	NA
WP_005772526.1\|1109134_1109737_-	exopolysaccharide biosynthesis protein	NA	NA	NA	NA
WP_010958122.1\|1109724_1110282_-	thioredoxin family protein	NA	NA	NA	NA
WP_010958121.1\|1110292_1111000_-	bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase	NA	NA	NA	NA
WP_010958120.1\|1111062_1111869_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	4.8e-11	30.4
WP_005770856.1\|1111899_1113108_+	D-galactonate dehydratase family protein	Q6A202	Oenococcus_phage	1.6e-47	30.4
WP_010958119.1\|1113101_1113584_+\|protease	protease inhibitor I42 family protein	NA	NA	NA	NA
WP_010958118.1\|1113585_1114848_-	6-phosphofructokinase	NA	NA	NA	NA
WP_017253299.1\|1115120_1115237_+	hypothetical protein	NA	NA	NA	NA
WP_046036920.1\|1115328_1116348_+\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	6.7e-10	25.9
WP_012220006.1\|1116344_1116617_-	hypothetical protein	NA	NA	NA	NA
WP_040953348.1\|1116770_1117262_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_010958115.1\|1117268_1118342_+	CBU_1268 family Dot/Icm T4SS effector	NA	NA	NA	NA
WP_010958114.1\|1118397_1118490_-	protein ScvA	NA	NA	NA	NA
WP_012220577.1\|1118533_1120582_-	LssY C-terminal domain-containing protein	NA	NA	NA	NA
WP_010957319.1\|1120687_1120960_+	hypothetical protein	NA	NA	NA	NA
WP_040953503.1\|1120956_1121976_-\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	6.7e-10	25.9
WP_017252813.1\|1122065_1123013_-	lipoyl synthase	NA	NA	NA	NA
WP_040953347.1\|1122942_1123671_-	lipoyl(octanoyl) transferase LipB	NA	NA	NA	NA
WP_012220575.1\|1124276_1124663_-	hypothetical protein	NA	NA	NA	NA
WP_005770832.1\|1124686_1124950_-	DUF493 domain-containing protein	NA	NA	NA	NA
WP_010958109.1\|1124946_1126203_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	4.8e-66	42.0
WP_011997045.1\|1126300_1127047_-	outer membrane beta-barrel protein	NA	NA	NA	NA
WP_010957319.1\|1127436_1127709_+	hypothetical protein	NA	NA	NA	NA
WP_040953503.1\|1127705_1128725_-\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	6.7e-10	25.9
WP_005770826.1\|1128856_1130455_-	Na+/H+ antiporter	A0A2H4J178	uncultured_Caudovirales_phage	7.3e-11	30.4
WP_010958107.1\|1130590_1131025_+	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	7.2e-22	41.7
WP_010958106.1\|1131010_1131415_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_005770820.1\|1131407_1131524_-	hypothetical protein	NA	NA	NA	NA
WP_012220574.1\|1131555_1132359_+	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_005772782.1\|1132701_1134228_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_012220573.1\|1134459_1134897_-	hypothetical protein	NA	NA	NA	NA
WP_010958104.1\|1135121_1136234_+\|tRNA	bifunctional tRNA (adenosine(37)-C2)-methyltransferase TrmG/ribosomal RNA large subunit methyltransferase RlmN	NA	NA	NA	NA
WP_010958103.1\|1137083_1137224_+	hypothetical protein	NA	NA	NA	NA
WP_010958102.1\|1137360_1137972_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_010958101.1\|1137968_1139234_+\|tRNA	histidine--tRNA ligase	A0A2I2L577	Orpheovirus	2.6e-19	25.9
WP_017252788.1\|1139256_1139877_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_005770802.1\|1140102_1141434_+	ribosome biogenesis GTPase Der	NA	NA	NA	NA
WP_012220006.1\|1141552_1141825_+	hypothetical protein	NA	NA	NA	NA
WP_040953503.1\|1141821_1142841_-\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	6.7e-10	25.9

DBSCAN-SWA_7

1305026 : 1348106

Streptococcus_phage(25.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_040939595.1\|1305026_1305428_+\|transposase	transposase	NA	NA	NA	NA
WP_012220327.1\|1305569_1306403_-	hypothetical protein	NA	NA	NA	NA
WP_005771808.1\|1306710_1306854_-	hypothetical protein	NA	NA	NA	NA
WP_152630347.1\|1307078_1307315_-	hypothetical protein	NA	NA	NA	NA
WP_010957754.1\|1307845_1308481_-	response regulator	NA	NA	NA	NA
WP_012220329.1\|1308539_1309868_-	MFS transporter	NA	NA	NA	NA
WP_017252803.1\|1309839_1310250_-	DUF3775 domain-containing protein	NA	NA	NA	NA
WP_017252947.1\|1311660_1312863_+	type III PLP-dependent enzyme	A0A2K9L4I2	Tupanvirus	2.1e-26	28.4
WP_010957761.1\|1312886_1313948_+	deoxyhypusine synthase	NA	NA	NA	NA
WP_005771798.1\|1313947_1314829_+	agmatinase	NA	NA	NA	NA
WP_010957760.1\|1314884_1315310_-	hypothetical protein	NA	NA	NA	NA
WP_010957759.1\|1315306_1315591_-	membrane protein	NA	NA	NA	NA
WP_094322076.1\|1315927_1316248_-	hypothetical protein	NA	NA	NA	NA
WP_052293388.1\|1316229_1316580_-	hypothetical protein	NA	NA	NA	NA
WP_161793206.1\|1316557_1317229_-	hypothetical protein	NA	NA	NA	NA
WP_080692293.1\|1317173_1317494_-	hypothetical protein	NA	NA	NA	NA
WP_017252853.1\|1317641_1318562_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_017252776.1\|1319739_1320957_+	N-acetylmuramoyl-L-alanine amidase	A0A067ZJB6	Vibrio_phage	2.7e-13	30.6
WP_032138365.1\|1320994_1323046_+	PAS domain-containing hybrid sensor histidine kinase/response regulator	A0A1V0SGX0	Hokovirus	6.2e-47	29.9
WP_040953320.1\|1323106_1324834_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	1.4e-84	34.7
WP_017252775.1\|1324837_1325773_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_012220006.1\|1325883_1326156_+	hypothetical protein	NA	NA	NA	NA
WP_046036926.1\|1326152_1327172_-\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	5.1e-10	25.9
WP_010957995.1\|1327324_1327663_+	hypothetical protein	NA	NA	NA	NA
WP_017252705.1\|1327735_1328218_+	L,D-transpeptidase	NA	NA	NA	NA
WP_010957993.1\|1328295_1328892_+	CBU_1079 family Dot/Icm type IV secretion system effector	NA	NA	NA	NA
WP_005768322.1\|1328899_1329238_+	DUF1820 family protein	NA	NA	NA	NA
WP_040953319.1\|1329241_1330183_+	beta-N-acetylhexosaminidase	A0A1B1IVS3	uncultured_Mediterranean_phage	2.3e-12	30.6
WP_046036886.1\|1330324_1331344_+\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	1.8e-10	26.4
WP_010957319.1\|1331340_1331613_-	hypothetical protein	NA	NA	NA	NA
WP_040947860.1\|1331830_1332982_+	mechanosensitive ion channel family protein	NA	NA	NA	NA
WP_010957989.1\|1332968_1333529_+	hypoxanthine-guanine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	2.2e-07	27.1
WP_017252872.1\|1333550_1334057_-	hypothetical protein	NA	NA	NA	NA
WP_010957987.1\|1334060_1335218_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	9.2e-56	34.8
WP_017252873.1\|1335382_1335811_+	DoxX family protein	NA	NA	NA	NA
WP_124224376.1\|1335828_1336608_-	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_129545642.1\|1337877_1338135_-	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_012220345.1\|1339937_1340708_+\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	5.7e-70	51.7
WP_040953318.1\|1340704_1342486_-	SLC13 family permease	Q6A201	Oenococcus_phage	4.6e-14	30.1
WP_011996944.1\|1342557_1343112_+	RNA 2',3'-cyclic phosphodiesterase	NA	NA	NA	NA
WP_005768280.1\|1343139_1343424_+	hypothetical protein	NA	NA	NA	NA
WP_012220346.1\|1343429_1344836_-	CBU_1063 family Dot/Icm T4SS effector	NA	NA	NA	NA
WP_080713307.1\|1344969_1345572_-	DUF1601 domain-containing protein	NA	NA	NA	NA
WP_046036891.1\|1345730_1346750_+\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	6.7e-10	25.9
WP_012220006.1\|1346746_1347019_-	hypothetical protein	NA	NA	NA	NA
WP_080713297.1\|1347159_1347726_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_005769011.1\|1347674_1348106_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA

DBSCAN-SWA_8

1612847 : 1675400

Streptococcus_phage(18.18%)

transposase,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_040953503.1\|1612847_1613867_+\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	6.7e-10	25.9
WP_012220006.1\|1613863_1614136_-	hypothetical protein	NA	NA	NA	NA
WP_010957961.1\|1614593_1615985_+	DUF853 family protein	A0A248XCZ8	Klebsiella_phage	6.4e-80	45.1
WP_040953312.1\|1616000_1616903_-	transglutaminase domain-containing protein	NA	NA	NA	NA
WP_080512968.1\|1616988_1617735_-	AMP-binding protein	A0A2K9L3I8	Tupanvirus	2.1e-24	40.2
WP_052366694.1\|1617736_1618321_-	hypothetical protein	NA	NA	NA	NA
WP_010957963.1\|1618743_1619184_+	glycoside hydrolase family protein	A0A0H4A794	Pseudoalteromonas_phage	1.2e-19	42.3
WP_012220363.1\|1619477_1620041_+	hypothetical protein	NA	NA	NA	NA
WP_017253471.1\|1620232_1620868_-	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_012220361.1\|1620914_1622321_+	nicotinate phosphoribosyltransferase	G3MA18	Bacillus_virus	2.4e-90	42.3
WP_061301491.1\|1624309_1624582_+	hypothetical protein	NA	NA	NA	NA
WP_046036920.1\|1624578_1625598_-\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	6.7e-10	25.9
WP_010957966.1\|1625803_1626139_-	cytochrome o ubiquinol oxidase subunit IV	NA	NA	NA	NA
WP_005768678.1\|1626135_1626732_-	cytochrome o ubiquinol oxidase subunit III	NA	NA	NA	NA
WP_005768680.1\|1626728_1628735_-	cytochrome o ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_026051170.1\|1628754_1629651_-	COX aromatic rich motif-containing protein	NA	NA	NA	NA
WP_012220359.1\|1629658_1629814_-	hypothetical protein	NA	NA	NA	NA
WP_005768686.1\|1629807_1630209_+	hypothetical protein	NA	NA	NA	NA
WP_010957969.1\|1630251_1630896_-	response regulator	NA	NA	NA	NA
WP_005768694.1\|1633420_1633534_-	hypothetical protein	NA	NA	NA	NA
WP_012220355.1\|1635646_1636228_-	hypothetical protein	NA	NA	NA	NA
WP_040953315.1\|1636647_1637916_-	hypothetical protein	NA	NA	NA	NA
WP_026051257.1\|1638525_1638738_-	carbon storage regulator CsrA	A0A2I7RT00	Vibrio_phage	1.7e-13	70.6
WP_010957971.1\|1638877_1640107_-	aspartate kinase	NA	NA	NA	NA
WP_040953316.1\|1640112_1642710_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	5.4e-88	40.1
WP_010957973.1\|1642702_1643137_-	regulatory protein RecX	NA	NA	NA	NA
WP_005772330.1\|1643133_1644165_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	1.7e-114	61.7
WP_005768715.1\|1644252_1644753_-	CinA family protein	B5TK85	Pseudomonas_phage	1.6e-28	44.4
WP_017253271.1\|1644887_1647503_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	9.7e-37	24.2
WP_010957975.1\|1647499_1648243_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_012220351.1\|1648255_1649542_+	flavohemoglobin expression-modulating QEGLA motif protein	NA	NA	NA	NA
WP_012220350.1\|1649512_1650247_-	pseudouridine synthase	NA	NA	NA	NA
WP_012220349.1\|1650256_1650886_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	6.6e-24	37.0
WP_017253273.1\|1650890_1651718_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	4.2e-10	24.2
WP_010957319.1\|1651868_1652141_+	hypothetical protein	NA	NA	NA	NA
WP_046036917.1\|1652137_1653157_-\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	6.7e-10	25.9
WP_012220489.1\|1653308_1654076_-	outer membrane protein assembly factor BamD	NA	NA	NA	NA
WP_080713296.1\|1654186_1655170_+	23S rRNA pseudouridine(1911/1915/1917) synthase RluD	NA	NA	NA	NA
WP_005769017.1\|1655141_1655849_+	peptidoglycan editing factor PgeF	NA	NA	NA	NA
WP_005772880.1\|1656009_1657365_+	Do family serine endopeptidase	W5SAB9	Pithovirus	4.7e-11	32.0
WP_017252708.1\|1657364_1658411_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_040953276.1\|1658458_1661527_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	2.3e-69	22.9
WP_040953503.1\|1661742_1662762_+\|transposase	IS110-like element IS1111A family transposase	M1NSC9	Streptococcus_phage	6.7e-10	25.9
WP_010957319.1\|1662758_1663031_-	hypothetical protein	NA	NA	NA	NA
WP_099126537.1\|1663218_1664076_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_005771755.1\|1664130_1665435_-	UDP-N-acetylglucosamine 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_040953274.1\|1665585_1666560_+	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	3.4e-43	36.2
WP_010957775.1\|1666561_1667059_+	3-deoxy-manno-octulosonate-8-phosphatase KdsC	A0A140XBD6	Dickeya_phage	1.1e-29	50.4
WP_005772879.1\|1667074_1667662_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_005771762.1\|1667624_1668140_+	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_026051163.1\|1668145_1668892_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.6e-21	29.5
WP_005771766.1\|1668990_1669281_+	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_005771767.1\|1669280_1669859_+	HPr kinase/phosphorylase	NA	NA	NA	NA
WP_005771768.1\|1669839_1670109_+	HPr family phosphocarrier protein	NA	NA	NA	NA
WP_010957771.1\|1670333_1671656_-\|protease	metalloprotease PmbA	NA	NA	NA	NA
WP_040953273.1\|1671664_1674118_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	3.6e-211	49.9
WP_005771771.1\|1674131_1675400_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	2.1e-133	54.9

DBSCAN-SWA_9

2071315 : 2080235

uncultured_Mediterranean_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012220156.1\|2071315_2072095_-	exodeoxyribonuclease III	E3T4M6	Cafeteria_roenbergensis_virus	7.4e-33	32.9
WP_010957485.1\|2072122_2072770_+	orotate phosphoribosyltransferase	NA	NA	NA	NA
WP_040947703.1\|2072766_2074236_+	CBU_0295 family Dot/Icm type IV secretion system effector	NA	NA	NA	NA
WP_005771434.1\|2074232_2075648_-	phosphomannomutase/phosphoglucomutase	A0A127AWJ1	Bacillus_phage	1.5e-52	29.9
WP_010957483.1\|2075625_2076111_-	dUTP diphosphatase	Q2NP83	Xanthomonas_phage	2.5e-47	58.0
WP_005771445.1\|2077146_2077386_+	50S ribosomal protein L28	NA	NA	NA	NA
WP_005771448.1\|2077396_2077609_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_005771450.1\|2077622_2077868_-	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	3.3e-16	51.1
WP_040953212.1\|2077882_2078362_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	2.4e-26	42.6
WP_005771454.1\|2078358_2078919_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	S4VNV0	Pandoravirus	4.5e-16	39.2
WP_041952431.1\|2078915_2080235_-	polynucleotide adenylyltransferase PcnB	G3MAR3	Bacillus_virus	4.3e-25	31.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP013667

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection