CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP010993	Clostridium perfringens strain JP55 chromosome, complete genome	3 crisprs	cas14j,DEDDh,cas2,csa3,cas3,c2c9_V-U4,DinG	0	5
NZ_CP013041	Clostridium perfringens strain JP55 plasmid pJFP55F, complete sequence	0 crisprs	NA	0	0
NZ_CP013044	Clostridium perfringens strain JP55 plasmid pJFP55J, complete sequence	1 crisprs	NA	1	0
NZ_CP013043	Clostridium perfringens strain JP55 plasmid pJFP55H, complete sequence	0 crisprs	NA	0	0
NZ_CP013042	Clostridium perfringens strain JP55 plasmid pJFP55G	0 crisprs	NA	0	0
NZ_CP013045	Clostridium perfringens strain JP55 plasmid pJFP55K, complete sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP010993_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010993_1

333192-333280

Orphan

Consensus_repeat	Method
AGTTTTATATAAATCAATATAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP010993_1

>merge|NZ_CP010993|1|333192-333280|CRISPRCasFinder
AGTTTTATATAAATCAATATAAATTTAAAATTGCAATTTCAAAAGCTAGATTAGGTATTGATAAAGAGTTTTATATAAATCAATGTAAA

>NZ_CP010993|1|1|333192-333280|CRISPRCasFinder
AGTTTTATATAAATCAATATAAA	TTTAAAATTGCAATTTCAAAAGCTAGATTAGGTATTGATAAAG
AGTTTTATATAAATCAATGTAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010993.1\|WP_003453458.1\|344024_345197_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213187
NZ_CP010993.1\|WP_061414314.1\|328831_329968_+\|mechanosensitive-ion-channel-family-protein	unknown	unknown	gnl\|CDD\|366370
NZ_CP010993.1\|WP_061414308.1\|327313_327928_+\|sugar-O-acetyltransferase	unknown	unknown	gnl\|CDD\|100047
NZ_CP010993.1\|WP_003473103.1\|349057_350491_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340856
NZ_CP010993.1\|WP_003460439.1\|343194_344007_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224596
NZ_CP010993.1\|WP_003473105.1\|350627_351281_-\|HAD-family-phosphatase	unknown	unknown	gnl\|CDD\|223710
NZ_CP010993.1\|WP_061414326.1\|345210_346494_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340856
NZ_CP010993.1\|WP_003472385.1\|324978_325710_-\|NAD-dependent-protein-deacylase	unknown	unknown	gnl\|CDD\|234777
NZ_CP010993.1\|WP_061414311.1\|328148_328655_+\|CarD-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224248
NZ_CP010993.1\|WP_061414324.1\|331282_332593_-\|DUF1576-domain-containing-protein	unknown	unknown	gnl\|CDD\|377881
NZ_CP010993.1\|WP_003453479.1\|340849_341317_-\|peroxiredoxin	unknown	unknown	gnl\|CDD\|224146
NZ_CP010993.1\|WP_003460432.1\|347761_348943_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213187
NZ_CP010993.1\|WP_003453475.1\|341984_342731_+\|peptidylprolyl-isomerase	unknown	unknown	gnl\|CDD\|234605
NZ_CP010993.1\|WP_061414317.1\|329964_330588_+\|copper-homeostasis-protein-CutC	unknown	unknown	gnl\|CDD\|225684
NZ_CP010993.1\|WP_003458249.1\|333317_333995_-\|uracil-DNA-glycosylase	unknown	unknown	gnl\|CDD\|235376
NZ_CP010993.1\|WP_061414321.1\|330949_331162_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010993.1\|WP_003458384.1\|332813_333110_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010993.1\|WP_003453477.1\|346512_347748_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340856
NZ_CP010993.1\|WP_061414305.1\|325910_327053_+\|type-I-restriction-enzyme-HsdR-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|227091
NZ_CP010993.1\|WP_003458352.1\|324194_324443_+\|spore-coat-protein	unknown	unknown	gnl\|CDD\|377935

Protein	Function_ID	Function_description	E-value
NZ_CP010993.1\|WP_003453458.1\|344024_345197_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213187	cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system. The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export. Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenza) and a cytoplasmic membrane protein MPA2.	7.45112e-115
NZ_CP010993.1\|WP_061414314.1\|328831_329968_+\|mechanosensitive-ion-channel-family-protein	gnl\|CDD\|366370	pfam00924, MS_channel, Mechanosensitive ion channel. Two members of this protein family of M. jannaschii have been functionally characterized. Both proteins form mechanosensitive (MS) ion channels upon reconstitution into liposomes and functional examination by the patch-clamp technique. Therefore this family are likely to also be MS channel proteins.	2.7556e-43
NZ_CP010993.1\|WP_061414308.1\|327313_327928_+\|sugar-O-acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	5.67874e-97
NZ_CP010993.1\|WP_003473103.1\|349057_350491_+\|glycosyltransferase	gnl\|CDD\|340856	cd04950, GT4_TuaH-like, teichuronic acid biosynthesis glycosyltransferase TuaH and similar proteins. Members of this family may function in teichuronic acid biosynthesis/cell wall biogenesis. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.	4.54962e-54
NZ_CP010993.1\|WP_003460439.1\|343194_344007_+\|ABC-transporter-permease	gnl\|CDD\|224596	COG1682, TagG, ABC-type polysaccharide/polyol phosphate export systems, permease component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane].	4.11533e-37
NZ_CP010993.1\|WP_061414326.1\|345210_346494_+\|glycosyltransferase	gnl\|CDD\|340856	cd04950, GT4_TuaH-like, teichuronic acid biosynthesis glycosyltransferase TuaH and similar proteins. Members of this family may function in teichuronic acid biosynthesis/cell wall biogenesis. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.	4.02463e-51
NZ_CP010993.1\|WP_003472385.1\|324978_325710_-\|NAD-dependent-protein-deacylase	gnl\|CDD\|234777	PRK00481, PRK00481, NAD-dependent deacetylase; Provisional.	3.29219e-134
NZ_CP010993.1\|WP_061414311.1\|328148_328655_+\|CarD-family-transcriptional-regulator	gnl\|CDD\|224248	COG1329, COG1329, Transcriptional regulators, similar to M. xanthus CarD [Transcription].	1.763e-14
NZ_CP010993.1\|WP_061414324.1\|331282_332593_-\|DUF1576-domain-containing-protein	gnl\|CDD\|377881	pfam07613, DUF1576, Protein of unknown function (DUF1576). This small family is found in several undescribed proteins. The alignment is distinguished by the frequent occurrence of conserved glycine and aromatic residues.	5.82212e-64
NZ_CP010993.1\|WP_003460432.1\|347761_348943_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213187	cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system. The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export. Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenza) and a cytoplasmic membrane protein MPA2.	2.43573e-120
NZ_CP010993.1\|WP_003453475.1\|341984_342731_+\|peptidylprolyl-isomerase	gnl\|CDD\|234605	PRK00059, prsA, peptidylprolyl isomerase; Provisional.	1.6338e-32
NZ_CP010993.1\|WP_061414317.1\|329964_330588_+\|copper-homeostasis-protein-CutC	gnl\|CDD\|225684	COG3142, CutC, Uncharacterized protein involved in copper resistance [Inorganic ion transport and metabolism].	1.01862e-90
NZ_CP010993.1\|WP_003458249.1\|333317_333995_-\|uracil-DNA-glycosylase	gnl\|CDD\|235376	PRK05254, PRK05254, uracil-DNA glycosylase; Provisional.	3.08574e-148
NZ_CP010993.1\|WP_003453479.1\|340849_341317_-\|peroxiredoxin	gnl\|CDD\|224146	COG1225, Bcp, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones].	9.48571e-79
NZ_CP010993.1\|WP_003458352.1\|324194_324443_+\|spore-coat-protein	gnl\|CDD\|377935	pfam07875, Coat_F, Coat F domain. The Coat F proteins, which contribute to the Bacillales spore coat. It occurs multiple times in the genomes it is found in.	2.38946e-13
NZ_CP010993.1\|WP_003453477.1\|346512_347748_+\|glycosyltransferase	gnl\|CDD\|340856	cd04950, GT4_TuaH-like, teichuronic acid biosynthesis glycosyltransferase TuaH and similar proteins. Members of this family may function in teichuronic acid biosynthesis/cell wall biogenesis. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.	1.34702e-58
NZ_CP010993.1\|WP_061414305.1\|325910_327053_+\|type-I-restriction-enzyme-HsdR-N-terminal-domain-containing-protein	gnl\|CDD\|227091	COG4748, COG4748, Uncharacterized conserved protein [Function unknown].	5.32679e-80
NZ_CP010993.1\|WP_003473105.1\|350627_351281_-\|HAD-family-phosphatase	gnl\|CDD\|223710	COG0637, COG0637, Predicted phosphatase/phosphohexomutase [General function prediction only].	6.61705e-50

>NZ_CP010993.1|WP_003458384.1|332813_333110_-|hypothetical-protein
MKNYKDNDENFKLVPMNMKCNQEYSFMPMNKFNSNSMNLNPMINNNSNHSCCCMHNYVMKPSPYNNNYYENQMFPQNHTDNMMVKTLITVKKKSDLFD
>NZ_CP010993.1|WP_061414324.1|331282_332593_-|DUF1576-domain-containing-protein
MKRLPQEYLIHLILYISFIIFAFFLESPKEILNGLYNIISNSDILITDYISIGGFGATLINSALLGLIFIFLFYITDTKSTGKSIMSLWFLTGFGMFGKNIINIWPIVLGTFIYSKVKKKPFKDYLVIASLGTALAPTVSQFSFFPEVHPISGAIMGALVGIIVGFILPPIAKNASKIHSGFSLYNVGFAGGIIAIAVMSLMRAVGHDFETNSIWHKGNNILYMLFLFTISAYFIICSLILDKSKKSVLKDQIGINKEHGIFPSDFFSIYGSSCYFNMGVLCIFSTLFVLLINGDLNGPTIGAIFSMAGFGCYGKNLANSVPLIIGASLASLISISDINSPVTVVCILFSTGLAPISGYYGWPYGIIAGFLHIFMVFNIGELHGGLNLYNNGLASGFVAAIIVPVIESLQVTNTKSNLKDYSKKHSISLGIKKEAD
>NZ_CP010993.1|WP_061414321.1|330949_331162_+|hypothetical-protein
MLEKMILSDKECEYLAKSIAGGVLIGLALGAIFNNPQFGFALGGVTGIVASLIYTLVKRTKIKSDKKLIN
>NZ_CP010993.1|WP_061414317.1|329964_330588_+|copper-homeostasis-protein-CutC
MIIKLEACVESYKEGKRAEELGANRIELCDNLAQGGTTPSYGTILQCKKDMNIDINVIIRPRGGNFVYSKEELSIMKNDIKLCKDIGVTGVVFGFLKDDNTLDYETTKEFVELAKPLSITFHMAFDEIVNKFDALDKLIDLGVDRVLTKGGLDNAFKNKETVKELVEYAKDKIIILPGGGVTKENFLELKYYTNAREFHGTKIVGNL
>NZ_CP010993.1|WP_061414314.1|328831_329968_+|mechanosensitive-ion-channel-family-protein
MKELERLLGRLTIINIKEIIIILVIMIIVLIINKILINNLFKLLMRGARRTKNYLDNNIVRALENPLKLIVSFVGIYSIFKVINLDSLGIDFLSTYKILRVGIIVSFIYFAYNLTLENSLLYSKLHKNDGGNTIVFPFVSIIIRLIILLVGIIIIANEFGLTGFIAGLGVSGVAFALAAQDTCSNLFGGMVIVLDRPFSIGDWIQAGDVEGVVEDITFRSTRIRTFSMAIATVPNSKLANSNIINWTHRKLRRIHFKFTMDCKTSIESIKNSVNKIENMLKKHDKIDKNLIIVSFNELSTYGFGVFIYFYTDEFEYLKYEKLKEEINIKILEILREENVSLMFLNFDFKGFERRSGNCNLENTELESIKNITEEERGV
>NZ_CP010993.1|WP_061414311.1|328148_328655_+|CarD-family-transcriptional-regulator
MFKINDYIMYGTVGVCQVIDITKETLMNNIEKEYYVLSPVYSKYPKKTVIKIPVDNKKISMRTLLSKEDVNSIINSIPETETLWINNDRQRNDEFKTMLRSGNCDDLIVLIRSIYLDKKKRKLDGKKACKGDDEIMQTAEKLLNEEFAIILDIPPEEVKSYIKSHIPQ
>NZ_CP010993.1|WP_061414308.1|327313_327928_+|sugar-O-acetyltransferase
MDLREIRERMYGQKLYYCNDEALMSEQMKALELLYDFNQTRPSEQEKREKILKKMFAEIGDDCYIEPPFHANWGGKNVHFGNGVYANFNLTMVDDCDIFVGNNVMFGPNVTVSAGTHPIHPELRSKQAQYNIPIHIGNNVWIGANSVILPGVNIGDNSVIGAGSIVTKDIPSNVVAVGNPCRVLREINENDMKYYYRDMKIDIE
>NZ_CP010993.1|WP_061414305.1|325910_327053_+|type-I-restriction-enzyme-HsdR-N-terminal-domain-containing-protein
MAFKDDIQKLSVQVKERKEYITNEEMTKQALIIPFIQILGFDVFNPIEIRPEYSADFGIKKGEKVDYALFKENEPIIFIEAKSVNENLNNHDAQLARYFNSTKEVKLAILTNGIEYKFFTDLNANNVMDDTPFLNINLLEIKESDIESLNKLRKENFDKDSLITYAEELVYTSTLNESLRRLFSNPSDDFVRFIVKDFSEMRITSNVIERFRPLVKKAISNAVLDIVSKGLYQQETLTIKKEENINNDSVNREDLSEIEIGNKVHKGIITTENELKGFNIVKDILEKNNRDISEINYKDTTNYFSVYLRNTTRWIIRFNLDASKKNVMTKLPVEYAKNICPNKEIEQAPKGIGESRVYINSIDELYDLEKYLVDAYDNVN
>NZ_CP010993.1|WP_003472385.1|324978_325710_-|NAD-dependent-protein-deacylase
MDDKINKLKEIIKNSNNIVFFGGAGVSTESGIPDFRSANGLFNEKLNITFTPEQLVSHSFFERYPEEFFNFYKAKLIYPNAKPNDAHIALAKLEEMGKLKAIVTQNIDGLHQMAGSKNVFELHGSVLRNYCVDCHTFYDEKFILESKGVPKCTKCGGIVKPDVVLYEEPLDDNVIRGAIDAISKADTLIIGGTSLVVYPAAGLINYFRGKNLVLINKSSTQADSKADLVINDSIGKVLGKVID
>NZ_CP010993.1|WP_003458352.1|324194_324443_+|spore-coat-protein
MQEKEMISDYLAGINASLAGYGGIISQCENQELRETIQNMRNQDEVRQYALFKIAKEKGYYIPAQQATPEEVATVKQQVSQG
>NZ_CP010993.1|WP_003458249.1|333317_333995_-|uracil-DNA-glycosylase
MAAEFNNDWDDLLKDEFEKEYYLNLRKFLINEYKTQKIHPSMYDIFNALKFTPYKDVKVVILGQDPYHGPNQAHGFSFSVKPGVQTPPSLRNMFKELNSDLGCYIPNNGFLESWAKQGILLLNTVLTVREGQANSHKGKGWEIFTDRVIELLNKREEPIVFILWGRNAISKEALITNPIHKIIKSVHPSPLSATRGFFGSKPFSKTNDFLVSINKEPIDWQIPNI
>NZ_CP010993.1|WP_003453479.1|340849_341317_-|peroxiredoxin
MSIEINKLAPDFKLMGSDGKEHSLSDYKGKNIVLYFYPKDNTAGCTTEACDFRDNIQNFHDLNAIILGVSRDSLASHDKFITKLSLPFVLLSDPDEIVCKLYDVIKEKNMYGKKYMGVERSTFLINKEGILIEEFRKVRVKGHIEKVLDKLKEIN
>NZ_CP010993.1|WP_003453475.1|341984_342731_+|peptidylprolyl-isomerase
MEKKVLATVGNTEITSDYIDEIIARYPAQQQAMLASDEGKRQVLEQAIAFELMSEFAKETGLDKTEEFKDQLNKFAKELLAQMVMKKTLSSVTVTDDEAKAFYEEHKENFVELETVTAKHILVASEEEAKKVEEEIASGSITFEDAANKYSSCPSKEQGGNLGSFSKGMMVPEFEEAAFNLELGVVSAPVKTQFGYHLIKVEDKTEAKTKAFEDVKEQVVNMLIQERQQKKYLELIKELREKYGVKLA
>NZ_CP010993.1|WP_003460439.1|343194_344007_+|ABC-transporter-permease
MKDWLEIEKSIFSHWRMIFSISKKEFKKEFAGSKLGMAWAIIRPLAMITVFWMIFSTGMRTTSSNVQVNYLVWLVSAYIPWIFISDVIMSGAGSIRVNSFLVKKVKFPVEILPTIRIVISFYTFLILLVISFIIFAVNGNLNLINIPKLIYAIIITIIFLAALSRLLSAWVVMSIDILHGISVFMQFLFWMCPVMWQAGELPVGSSMPWIEKILKLNPLYYLAVLFRDAYLGTHTVSLAYGVYFWVVTIILFIFGSKVFKKFRPEFDDVL
>NZ_CP010993.1|WP_003453458.1|344024_345197_+|ATP-binding-cassette-domain-containing-protein
MSVAIRVKDLTKKYKLYQKRSERLANAFGKEKNIKEFYALKGVSFEISKGECVGIIGHNGAGKSTLLKLLTGVAFPTSGEIEINGRLASMLELGSGFNPELTGMENIYFNGSLNGLTKEEIDGKLKDILEFADIGNFIEQPVKNYSSGMFARLAFAVAINVDPDILIVDEILSVGDVGFQVKCMEKFNEFKKKGKTILYVSHGLGTVKKFCDRAIWLQKGEVVDDGNSVIVVERYYNLNFNPANIEQLKDHKSDIINSIAVKSNTKNVEYLEKLDLEVEYDLISNDLKDPNIVLEFRKTDYEPGTTRGNDQFVCGINSKDNIKNIPFNLGVNKLKVSLNKVNLVAGVYYIDFVLRDGEEEVYRKINGYSFTLNDKYRGEGFLILGHSWGN
>NZ_CP010993.1|WP_061414326.1|345210_346494_+|glycosyltransferase
MSVGRIARRTTEVLKEDGLIEVIKRVLRYIKRRIKDKLDNNALTYRKNYEEANAIFHKILKKEKFKAVVVFDSRVGWNIPLFQRSQHMANELTDDGYLYFYRTSEQFDPHVKTVEKLKDRLYLVNMANFALQNAMFDLLKEYKGHKFLSLYSTDVYLDEQYIKEKYIDNGFKIIYEYIDELSDEISGHLPDFVYDRHKNIIEDKSNIAVGSADKLIEEIEEIRGKENVAMITNGVQYDHWQYRSNEVPEKLKDIVSKGNPIIGYFGALAKWFDYELLKKVAKERPNYEIVLIGFLYDNSFKDSKIDELENVHYLGIVDYKELNQYSQYFTISTIPFLLNDITESTSPVKLFEYMAMGHPIVTTDMRECRKYKSVLIGKSHEDFIEKLDFALTLDKKDEYYNYLKEEALANTWREKAAILDRLIEKNI
>NZ_CP010993.1|WP_003453477.1|346512_347748_+|glycosyltransferase
MSLKRSLKNLLRPILKPMLLKYREKGHEDQKQVFFDEITGAIKNGNYDAIVIFDVYFGFEVKMFQRPQHIALNLAKENVLYFYKASPYVDKDIKTYKKMEENLYLVNTDLYWLQECLIDIVSQSGVPAFGQIYSTSFVEYDSWLKKFTDRNFKIIYEYVDDLSDDIAGFKISDEIKASHKRMLEDTEKVYVVTTADKLYQEAKELRGENKLALVTNGVQYEHFANIDCKKIPDKMKNIVNSKKKIIGYFGALASWFDYDLIKELAEEFKDDYEIVLIGIDYDQSLGKSGILKLDNVHYLGTVNYNELPTYSKFFNVSIIPFVVNEITEATSPVKLFEYMALGKPIVTTALPECRKYESPLVSDSHEDFINNIKKAAELENSKEYIELLRKEGNQNTWRQKAKDIKELILNS
>NZ_CP010993.1|WP_003460432.1|347761_348943_+|ABC-transporter-ATP-binding-protein
MEKAIEVKNLCKNYRVYDSKSSRIRNIINPFAKKEVKEFKALTDVSFHVNKGEIVGIIGNNGAGKSTLLKILTGVSFPSSGEVNVNGRVSSLLELGTGFNPELTGEENIYFNGSLMGLTQDEIDKVKDNIIEFADIGEFINQPVKSYSSGMYARLAFAVAININPDILIVDEILSVGDVGFQKKCMDKFNEFKEAGKTVLYVSHGLETVQTFCERAIWLEKGRVVDIGPSFDIVEKYYDKLMKSDDKEELETGKFVELINVEILDDKKVYKKGESIEFLVEYEVFNPSVKNAGITIEMRKAYREPCEYRNADQFIFSVNSNVDEFTIPWKKGRNKITFKIDSLDVKEGIYYLDAIFSESQNLVALETQEDVVSFEVKNEGESEGFVFLDSTWT
>NZ_CP010993.1|WP_003473103.1|349057_350491_+|glycosyltransferase
MSNIFEVMLKKNIGDFTYEEKRELNNWLIENLKLKELIYSGLELTKVINEDGEETAYYENKITEEDILSGNFNELCSKTSKYIDDAISSILFEGQFNCFYEKIKSILELEDFDEIIVFHASFGWNIEMKQRPQHLAEALSKKKVLYIYRSDVKNDNIYSIKKIKDNLYVLNLDMYSLNMAFFEAIKSINKPKFLHVYATCLNSVDYEKIKTYMDKGFKVIYDFVDELSSEISGYNITSKVIEDHEKLLRDKENVLVVSTAKKLKDIANKFRGENENNILAPNAVNLEDFKNHGNEIGEKIQPIVNKRKPIIGYYGALAKWVDYKLIEELAKEREDYEIVLIGMDYDGSYNQSNLKDYSNISYLGMIDYRDLINYSRYFDVCIVPFIKNDITDSTSPLKIFEYMALEKPIVTTDINECKNYESCLISKDYDEFIKNIDKALKLEVDNKEYFNILRRESEENTWDNRAELIKEAIKNLE
>NZ_CP010993.1|WP_003473105.1|350627_351281_-|HAD-family-phosphatase
MLSNIKGVIFDLDGTLVDSMGVWAKIDSDYLTDLGLEVPKNLKEEITHLGFKEVAKYFKKRFNIASSEEEIMKTWHDMAYVEYKNNIKLKPGAREFLEQLKESNIKIGLATSNSYPLLEVCLKSNDIFHLFDSITITGEVPRGKDFPDVYLLAAERLGLEPKECAVFEDILPAVKGALSAGMKVFAVEEHTVSEEEKSQIKEIVHEYIDSFNDLLVN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP010993_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010993_2

1285211-1285296

TypeV-U4

Consensus_repeat	Method
TTTTAACTTTTGTATGCAGAAGAGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP010993_2

>merge|NZ_CP010993|2|1285211-1285296|CRISPRCasFinder
TTTTAACTTTTGTATGCAGAAGAGGTTATTAAAGAACAGCATGGAGTAAAGCTGGGTTCTATTTTAACTTTTGTATGAAGAAGAGG

>NZ_CP010993|2|2|1285211-1285296|CRISPRCasFinder
TTTTAACTTTTGTATGCAGAAGAGG	TTATTAAAGAACAGCATGGAGTAAAGCTGGGTTCTA
TTTTAACTTTTGTATGAAGAAGAGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010993.1\|WP_061416100.1\|1296222_1297050_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010993.1\|WP_061415421.1\|1297818_1298049_+\|DUF4318-domain-containing-protein	unknown	unknown	gnl\|CDD\|372960
NZ_CP010993.1\|WP_061415416.1\|1292744_1294643_+\|ATP-dependent-helicase	unknown	unknown	gnl\|CDD\|223288
NZ_CP010993.1\|WP_011590513.1\|1284431_1284650_-\|ferrous-iron-transport-protein-A	unknown	unknown	gnl\|CDD\|377199
NZ_CP010993.1\|WP_061415397.1\|1277321_1278275_-\|methionyl-tRNA-formyltransferase	unknown	unknown	gnl\|CDD\|234567
NZ_CP010993.1\|WP_003459198.1\|1297227_1297458_+\|DUF4318-domain-containing-protein	unknown	unknown	gnl\|CDD\|372960
NZ_CP010993.1\|WP_061415393.1\|1275526_1276066_+\|YcxB-family-protein	unknown	unknown	gnl\|CDD\|379553
NZ_CP010993.1\|WP_170870396.1\|1294721_1295147_-\|ImmA/IrrE-family-metallo-endopeptidase	unknown	unknown	gnl\|CDD\|225412
NZ_CP010993.1\|WP_061415420.1\|1295281_1295824_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197775
NZ_CP010993.1\|WP_061415402.1\|1280433_1281090_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226496
NZ_CP010993.1\|WP_061415406.1\|1282290_1284414_-\|ferrous-iron-transport-protein-B	unknown	unknown	gnl\|CDD\|223447
NZ_CP010993.1\|WP_003459819.1\|1280106_1280421_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|163261
NZ_CP010993.1\|WP_061415414.1\|1290679_1292725_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|226121
NZ_CP010993.1\|WP_061415399.1\|1278487_1279282_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|99750
NZ_CP010993.1\|WP_025648566.1\|1279376_1279748_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010993.1\|WP_061415412.1\|1289198_1290284_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010993.1\|WP_061415408.1\|1285535_1286072_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375832
NZ_CP010993.1\|WP_061415410.1\|1286258_1289159_+\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|223989
NZ_CP010993.1\|WP_061415404.1\|1281441_1281774_-\|DUF3784-domain-containing-protein	unknown	unknown	gnl\|CDD\|378903
NZ_CP010993.1\|WP_061415395.1\|1276101_1276911_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP010993.1\|WP_061415421.1\|1297818_1298049_+\|DUF4318-domain-containing-protein	gnl\|CDD\|372960	pfam14201, DUF4318, Domain of unknown function (DUF4318). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 80 amino acids in length. There is a single completely conserved residue F that may be functionally important.	4.62639e-11
NZ_CP010993.1\|WP_061415416.1\|1292744_1294643_+\|ATP-dependent-helicase	gnl\|CDD\|223288	COG0210, UvrD, Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair].	1.40191e-44
NZ_CP010993.1\|WP_011590513.1\|1284431_1284650_-\|ferrous-iron-transport-protein-A	gnl\|CDD\|377199	pfam04023, FeoA, FeoA domain. This family includes FeoA a small protein, probably involved in Fe2+ transport. This presumed short domain is also found at the C-terminus of a variety of metal dependent transcriptional regulators. This suggests that this domain may be metal-binding. In most cases this is likely to be either iron or manganese.	9.36726e-14
NZ_CP010993.1\|WP_003459198.1\|1297227_1297458_+\|DUF4318-domain-containing-protein	gnl\|CDD\|372960	pfam14201, DUF4318, Domain of unknown function (DUF4318). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 80 amino acids in length. There is a single completely conserved residue F that may be functionally important.	2.10306e-09
NZ_CP010993.1\|WP_061415393.1\|1275526_1276066_+\|YcxB-family-protein	gnl\|CDD\|379553	pfam14317, YcxB, YcxB-like protein. The YcxB-like protein family includes the B. subtilis YcxB protein, which is a functionally uncharacterized transmembrane protein. This family of proteins is found in bacteria, and is approximately 60 amino acids in length.	2.48289e-06
NZ_CP010993.1\|WP_170870396.1\|1294721_1295147_-\|ImmA/IrrE-family-metallo-endopeptidase	gnl\|CDD\|225412	COG2856, COG2856, Predicted Zn peptidase [Amino acid transport and metabolism].	9.93758e-12
NZ_CP010993.1\|WP_061415420.1\|1295281_1295824_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197775	smart00530, HTH_XRE, Helix-turn-helix XRE-family like proteins.	4.62681e-15
NZ_CP010993.1\|WP_061415402.1\|1280433_1281090_+\|hypothetical-protein	gnl\|CDD\|226496	COG4008, COG4008, Predicted metal-binding transcription factor [Transcription].	0.000356951
NZ_CP010993.1\|WP_061415406.1\|1282290_1284414_-\|ferrous-iron-transport-protein-B	gnl\|CDD\|223447	COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism].	1.32258e-141
NZ_CP010993.1\|WP_003459819.1\|1280106_1280421_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|163261	TIGR03433, padR_acidobact, transcriptional regulator, Acidobacterial, PadR-family. Members of this protein family are putative transcriptional regulators of the PadR family, as found in species of the Acidobacteria. This family of proteins has expanded greatly in this lineage, and where it regularly is found in the vicinity of a putative transporter protein [Regulatory functions, DNA interactions].	1.79693e-21
NZ_CP010993.1\|WP_061415414.1\|1290679_1292725_+\|AAA-family-ATPase	gnl\|CDD\|226121	COG3593, COG3593, Predicted ATP-dependent endonuclease of the OLD family [DNA replication, recombination, and repair].	1.13495e-27
NZ_CP010993.1\|WP_061415399.1\|1278487_1279282_-\|hypothetical-protein	gnl\|CDD\|99750	cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX, which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.	8.08914e-08
NZ_CP010993.1\|WP_061415397.1\|1277321_1278275_-\|methionyl-tRNA-formyltransferase	gnl\|CDD\|234567	PRK00005, fmt, methionyl-tRNA formyltransferase; Reviewed.	3.39809e-163
NZ_CP010993.1\|WP_061415408.1\|1285535_1286072_+\|hypothetical-protein	gnl\|CDD\|375832	pfam18406, DUF1281_C, Ferredoxin-like domain in Api92-like protein. This domain has a ferredoxin like fold. It is often found to the C terminus of pfam06924.	0.000288926
NZ_CP010993.1\|WP_061415410.1\|1286258_1289159_+\|DEAD/DEAH-box-helicase	gnl\|CDD\|223989	COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair].	2.21602e-72
NZ_CP010993.1\|WP_061415404.1\|1281441_1281774_-\|DUF3784-domain-containing-protein	gnl\|CDD\|378903	pfam12650, DUF3784, Domain of unknown function (DUF3784). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and archaea. Proteins in this family are typically between 96 and 110 amino acids in length.	1.71213e-11

>NZ_CP010993.1|WP_011590513.1|1284431_1284650_-|ferrous-iron-transport-protein-A
MKLHEAKILSTVKVIDIKAQGELRRRFFDLGIIEGTDIKVLYGGPFGDPRAYLIRGTVIAIREEECEEIEVI
>NZ_CP010993.1|WP_061415406.1|1282290_1284414_-|ferrous-iron-transport-protein-B
MSLNKNSTGISLLSKDKTRGNTKEDYVVALAGNPNVGKSTVFNALTGLNQHTGNWPGKTVAKAEGYYEFKDSTIKIVDLPGTYSLLSNSEEEEIARDYICFNDPDIVVVVADATSLERNLNLFIQISEITEKAILCVNLTDEAEKNNIKIDLDLLSKELNSTIVSSSARNGVGIEELKEATFKEITLKGSKKNAINYDSPIEKAIEEIEIILDETLEVPKRKKRWIALRILEGNTSILKSLYNKYNIQEKYINMISKIKDELNKNYKDELVEDLIIKSIIKEAERIGNKVVKGGEEYTDFQRKIDKILVSKSTGIPIMIMTLLIVLWITITLANYPSEMLANMFAHGEIYIRDFFSGLNLPPWISGILIDGIYVTLAWVISVMLPPMAIFFPMFTLLEDLGYLPRIAFNLDKCFKKCCACGKQALTMCMGLGCNAAGIIGCRIINSPRERIIAILTNAFMPCNGRFPMLISIAAIFIGGISVGIKESFISALTVTVVIILGVLMTLLVSKILSKTILKGMPSNFILELPPYRKPQVGKVIVRSIFDRTLYVLGRAIAIAAPAGAVIWIFSNIMIGDASILTICADYLSPLANAIGVDGYILMAFILGLPANEIVMPIIIMSYLRATTMLELDNLYELKELLVANGWTILTAINVMILCLMHYPCGTTLWTIKKETKSFKWTALSFLIPTVAGIVICFITTQLWRLFA
>NZ_CP010993.1|WP_061415404.1|1281441_1281774_-|DUF3784-domain-containing-protein
MNVGMIACLTLGIFFLIFSICFAILKEKGAILVSGFNSFSKAEREKYDQKRISLDMRNSFFLWAMILFIGSLFSYFVSQYCAIIAFIIWLILFFKDVHISATKAFEKYKL
>NZ_CP010993.1|WP_061415402.1|1280433_1281090_+|hypothetical-protein
MRLNEILDYKLNKLDMSQKELEELKMQLLDNAEEMKKDFLEEGFSEEEAQKKALDSIELDELIKSIKESSIKKYLTLNRILATIFVVIYSGFLIKCISHTAGMGSDLLESSYIPFRFSINLVKHIMNYKGPIYEELYILDQSFILMLFIPFGILIPIVINKCNSLKTNLKIFIVFILFFSLIFYPRHFNFDLTVLRILACILGFYILRFFINRSKAKK
>NZ_CP010993.1|WP_003459819.1|1280106_1280421_+|helix-turn-helix-transcriptional-regulator
MDREILKGSLEIILLSLLKNNAMYGYEISKTIKNLSENALIIGEGTLYPALKRLEEKELIKHYFVEFENSKKKRKYYEITEEGKRELDLKLKDFSLIEKLIKSF
>NZ_CP010993.1|WP_025648566.1|1279376_1279748_-|hypothetical-protein
MSKNQIELITALILLSLYLIALIVLRFGFKIKRNLKLEGKIRKTLPKAYSYIYIFLLIVGFAEYVFLKGKINLLLIVLLGDQLVLSSRLLKETKNSKEKYYDYFSIGFSSIAIILLIINMIFF
>NZ_CP010993.1|WP_061415399.1|1278487_1279282_-|hypothetical-protein
MKKKTAEYINVLGRFCGKRDIPSLRKEELKKKYDIDQADVMVLFGGSIICGGDLLAEGIKNNIAKKYVIVGGAGHTTEVLRKKMHSQLPNVDTSKLTEAEIFDEYLKYKYNLKADLLECNSTNCGNNITYLLELLKENNIKFNSIIIMQDATMQHRMEAGLRKYVSSDIKIINFATYNAKVILKDGELAYENDILGMWDINHYITLLMGEIPRLSDNSDGYGPKGKDFIAHVSISDEVNLAFSELKKEFSGMVRTANPLYASKN
>NZ_CP010993.1|WP_061415397.1|1277321_1278275_-|methionyl-tRNA-formyltransferase
MKIVFMGTPDFAVPSLKKMIEKFNVSAIVTQPDKPSGRGKKVSISPIKEVGLSNQIPIFQPEKIRTDSVIINKLKEIEPDFIIVVAYGQILTKEILDIPRLGCICLHASLLPMYRGSAPINWCLINGETKTGNTTILMDTGIDTGDMLMRSEVEISESMTAGELYNLLKINGAELLEETINGIITGKICGVKQPNDGSSYVKMLNKEMAKINWNDSSTNIHNLIRGLSSWPYKNINSWPTAYTYYKDIPFKIFKSKSLEANIIDPPGYIIDANDEGIKVATKNGILIIEILQFPGGKPLEVKEFLKGNKIEKGIILS
>NZ_CP010993.1|WP_061415395.1|1276101_1276911_+|hypothetical-protein
MDVRIYKINTGITGRNFSSDKRSNFTIGGKTNSFYSIGNLMRGIEDFYLEGNLYFIDKEEELEKFYNPLGDRWVAKKKYYISHPKKERENYLLEASKFHEYIVREQLEEIANYLHSQININSLKIEGEEGNDFSSYNNIVLEEMNLNNDGKVELKGDKALEIKWSENDTREYEANQEEKEVDYLESENINGKNNFLWIEDFKDLVNKVQELKASNKRGEKESLGENSLSKGETSYILEIDNSFGISEKIGKKIGVNPTWLKKCSFKITF
>NZ_CP010993.1|WP_061415393.1|1275526_1276066_+|YcxB-family-protein
MTINYKNTFDDLIALSTYIFENDRTIQMKIKILQVLFPIYIMFSYLSFAGIYKADMTLFIFFLTLSVFLVILVPFILKFVHKRQFLRNLSSIVSHGGVKDNILTLDEKGIVHEDENILLKLKWNGVQKVSIIDKYIFIFIDELRAIVLPNDAFKSEEEKKDFLDIIYRYMNKDKIKIDI
>NZ_CP010993.1|WP_061415408.1|1285535_1286072_+|hypothetical-protein
MPNWCDNYIKIKGKIEEIIKCIEGMKGYKALYKEDRENKEDLEKCYTFNATLEVPEEVLELGYAKSGCYWQKDNWGCKWDMLYESKYELDNILKELKSSIKEENEVKESESYNYLEERSYDKKHMKEVEFFVLSPWSPVEEWVKALSEKHRDLEFSLSFEISEEFLKGSATFKEGEYI
>NZ_CP010993.1|WP_061415410.1|1286258_1289159_+|DEAD/DEAH-box-helicase
MSVLQNIKEKVIKDKIEEVGSKGIIEDKYLIKNRLIVNSQRGNLLGELKESLRECKSFYFSVAFINFSGLQLLLDSFRDLEERGVKGKIITSTYLNFTEPKALKKVKSFENIDLKIFIADSEKGFHTKAYIFENEDNFKIIIGSSNITQRALKSNVEWNVMIISKKDTDFVKEVLEEYEGIWSSTGIVDDEFLEKYNEFIKSIKEKQREIAIDFSEYEVIKPNFMQKEAMENLERLRRAGEDKALVIAATGTGKTYMSAFDVMAFNPKRLLFLVHREDILRSAEKTYKSLCKNKNITMGFYTGNSKEREADYLFSTVQTMCRNLEDFNRDDFDYIVIDEAHHSTSPTYERILNHFTPKFLLGITATPERCDTGDIFQVFDNNIALEIRLNEALEHELIVPFHYFGITDIDAVDYSNVDLDDISEISKRLMINSRVDFIIDKMNFYGFDGSKQKTVGFCINKEHAYYMAEKFNEAGIPSIALTGDHSIDKRTEEIKNLENENHELKVIFTVDIFNEGVDIPSINQVLMLRPTNSPIIFIQQLGRGLRKHRSKEFLTVLDFIGNHNKAFLIALALKGGRYYDKDSLKVSVATDFSDIPGCSNIQMDRISKERILNQLNTENFNSLKYLKEEYNEFKSLLGGKIPYQLMDYVKFDGAPDPLKFINYGKTYQGFLNKVEKTYEALELLDEDFYKVLKELSDKLPLKRPHEFAIIKELINKSELNVDEASKGIRKYIKSVDEETVKHAFRTLNQDYYDSREKSNCIKLFDLIGERLVKLLSFEKILSDKRYKEIIVDLLNYGLITYEKRFGSENFGVPFFKLYEQYQMVDAALLSNYEKIHSSFRGSGLMANGKEYFLFVDLNKDEDIKESINYKDEFLSRSLFQWETPNSTAQSSERGKNIIFNKERGINMHLFVRKYKEIDRKVQPYIYIGKGDVVKYEGEKPIKVEIELHNRVPENLYVEFTKVVFLD
>NZ_CP010993.1|WP_061415412.1|1289198_1290284_+|hypothetical-protein
MKDIEFIKLGVTDEECEKINSNIIGYKKELNKIISEARKVSKSEKCIYCGNETTSFCNSHSIPAFCLRNIAKNGELLHTNKFINFPLLDFEKGINKAGTFQIICRECDSKIFQEYEEPNNYENEVTQQMVAQIVMKNSLKAISKRVNEHAIFDILKERTSESIEIADYMQYIQDIDLSEYKREFEKAKRLSKKNWPGEYYVFYYEKLNYVVPVAFQSSIALVVDLDRQIVNDIYCENPKYKIEDFHICIFPLKNTSVVMMFVDSKYKRYRNFYKSFRKLSQEDKLSLVNYIIFLYSEDIFFSKEIPINVLQNKDLIDVSKQSAIALSINPYIKAIDKAKDIYDLSKHNNIPNLLSEQYKLR
>NZ_CP010993.1|WP_061415414.1|1290679_1292725_+|AAA-family-ATPase
MRLKKIKIYNFRSFGEEKIIEFDEMTTFIGNNSSGKTSALVALQKMFGNTIAERSLTRADFHLNKDEKIEGVEQKELYIEAVFEFPELKEDTNISNSIPIIFRQLTIDDEGELPYLRIRLEATWNKNNTVEGSIDSSIYYIKQSENEKIEGKNKTLAKNKDLQRINLIYIPAIRHPESQLRNASNSILYRVLSSINWTNTVKESIAQKSSEFEDEFDKETGVRLLKTAITKEWTNYHNDTRYNKAELKFNNPNIETILKKVNIEFAPTVTGRPYNVDELGDGLKSLFYISLVNSLLTLEEKIVEENDMDIEHKSFRIIPPICTILALEEPENHIAPQLLGKIMNNVKNISSKNNCQAIVSSHSTSIVSRVNPENIRHFRINKLNLNTDVKSLELPPDEGKTEEIYKYIKNGIMAYPELYFANLVILGEGDSEEILLPKMIEIGDENIDSKSIAIVPLGGRHVNHFWKLLNQLNIPFITLLDLDRERYLGGWGRIKYVCEQLIELGKLEKKQLEESEDITFLKDFEEMHNWDVNNIDEMKRWIKFLEEYDVYFSSPLDIDFLMIKEFEEEYLSILEENEGPRIKGLGKIKDLTKEDKEKDEYLKRIEEDKKSTLKEKCTNGDTFSKKEIELMIWYKYFFLTRGKPTTHRVALIKIEDEKLQANMPKVFRDIRLKVNEKLKNN
>NZ_CP010993.1|WP_061415416.1|1292744_1294643_+|ATP-dependent-helicase
MFNIIDRNKWEPVDGIILEENALEVVKSNRNMLVVAGPGAGKSELLAQRACYLLQTNECKEPNRILALSFKKDAASNISERVVKRCGEELGERFDSMTFDAFSRALVDQFLNAIPKEYRPKRNYELITTDKEMVEILKNNKKINLIDDKKYFHIVKKLTEYELPFEKSQNEIKELWDYILGNNEEEICYLTFKMIGRLAEYLIRKNPIIKKVLNMTYSHLFLDEYQDTTSMQYKLLKSCFYNTDIVITAVGDDKQRIMVWAGALKDAFNRYKCDFDAIETMLVMNHRSAPRLLTLQKSIYKEFFYKDSIQDCTIKNNPKWDDEAGEAYVHIFPNDKIEAIEISAQINKLIESGYNKREICILVKQTPDKYCKDIIENLEKNHNIIARNEMIFQEILKEDLINILNDIIAILINKKSPEEWSRFIDLIMEFNECSLTDIYEIRLLEDSILKNILKFKEVLLKVSSEEELYKFINDILEFIGIEKLKGKYDNYKNESTFRYYINTYCDLLWREYIKCKKWNKAIENLKGENSIPIMTIHKSKGLEYDVVFFIGLEDGAFWSFENQKDEDFCTFFVALSRAKKRVDFTFSKIRKYTRNYQENRVKIKEFYEILEKSGVVDSKLYDDSKNYELLLI
>NZ_CP010993.1|WP_170870396.1|1294721_1295147_-|ImmA/IrrE-family-metallo-endopeptidase
MNIKNLANQLVKKYGLRDPLEITLSKGIILLEEDLGEVYGYCHTYKRQSFIHLNKNCSLKTKRLVCAHELGYLLIHPKEEIHVVTNSSLEPKDDFERYAKIFAAHLLISDEMVKEYEGKSAEDMAKSLNLPLDLVLIKLNS
>NZ_CP010993.1|WP_061415420.1|1295281_1295824_-|helix-turn-helix-transcriptional-regulator
MFIDYRLQKLRKKRKLTQKALAEMTGISRSYLSDIEHNRYNPSFDTIEALATALKLDLKSFFDDTLLEEDYYLKPLNEELEDERFEEIEVLSENEIVEKQIINNDLNITYKTGSLSKKEILNIKADLEKTLNNLDNFEKNIAFEGFLLDSETRKAFKESLEHSMKMAKLIAKNKFSSKAN
>NZ_CP010993.1|WP_061416100.1|1296222_1297050_+|hypothetical-protein
MVKRLEIKINEEPKVVEVQFPYNTEFDNYNIEIKKPKVVNHYILFDYTISTKDNSPIEKEDFYITGSPSFQDIAYFISSQNVLTKVENNKMRIVDAGIIVARKDYDKYVNNFDFLVNAREKGSSKNLFEEKRVDTTIKVDGVVYPDKENYKEIKKTFKLDDIDFEVLSIGDFDFGTFIPIFVGNISNEKSKEIENKYALRVEGENINAIYDLEKWVGFYEQVIKRYSNIDPSYNANSQYDQFYMGKIFYNPNEVNKDNVKIYLINKETNEEVRIN
>NZ_CP010993.1|WP_003459198.1|1297227_1297458_+|DUF4318-domain-containing-protein
MARKCFFIDLDDMPKTDEDICLEVERYCGKNNLPFDFIKKTSPVIAKIKDNNYEITKKYENGRFLNRWILSCKAVN
>NZ_CP010993.1|WP_061415421.1|1297818_1298049_+|DUF4318-domain-containing-protein
MFKKGFLIDLDVEPKTDEDICLEVAKYCGKDGLAFDFIKRTSPVIAMIDGTKYEIQKRYQTVRLLNCWVLSCREID

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP010993_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010993_3

2403007-2403119

Orphan

Consensus_repeat	Method
TTCTATTTAAATCTATTACTTTACATAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP010993_3

>merge|NZ_CP010993|3|2403007-2403119|CRISPRCasFinder
TTCTATTTAAATCTATTACTTTACATAAGAAATTATTCTAATTATTTTTAAAATAATAAATCTTTTTTGGAGACCTCTTCTTCTCTTCTATTTAAATTTATTACTTTACATAA

>NZ_CP010993|3|3|2403007-2403119|CRISPRCasFinder
TTCTATTTAAATCTATTACTTTACATAA	GAAATTATTCTAATTATTTTTAAAATAATAAATCTTTTTTGGAGACCTCTTCTTCTC
TTCTATTTAAATTTATTACTTTACATAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010993.1\|WP_003458718.1\|2403188_2403551_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010993.1\|WP_003451336.1\|2398329_2398935_-\|stage-III-sporulation-protein-AG	unknown	unknown	gnl\|CDD\|274319
NZ_CP010993.1\|WP_003458670.1\|2401444_2401960_-\|stage-III-sporulation-protein-SpoAB	unknown	unknown	gnl\|CDD\|131880
NZ_CP010993.1\|WP_003458668.1\|2406119_2406416_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010993.1\|WP_003481876.1\|2404736_2405177_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010993.1\|WP_003451406.1\|2400697_2401084_-\|stage-III-sporulation-protein-AD	unknown	unknown	gnl\|CDD\|131896
NZ_CP010993.1\|WP_011590962.1\|2404392_2404740_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010993.1\|WP_003475135.1\|2406550_2407063_-\|type-II-secretion-system-protein	unknown	unknown	gnl\|CDD\|225076
NZ_CP010993.1\|WP_003468981.1\|2398949_2399507_-\|stage-III-sporulation-protein-AF	unknown	unknown	gnl\|CDD\|131942
NZ_CP010993.1\|WP_003451649.1\|2403664_2404222_-\|elongation-factor-P	unknown	unknown	gnl\|CDD\|234788
NZ_CP010993.1\|WP_011590964.1\|2405722_2406133_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010993.1\|WP_003451671.1\|2401171_2401369_-\|stage-III-sporulation-protein-AC	unknown	unknown	gnl\|CDD\|131895
NZ_CP010993.1\|WP_057231741.1\|2399514_2400687_-\|stage-III-sporulation-protein-AE	unknown	unknown	gnl\|CDD\|213743
NZ_CP010993.1\|WP_003451410.1\|2397332_2397722_-\|Asp23/Gls24-family-envelope-stress-response-protein	unknown	unknown	gnl\|CDD\|377129
NZ_CP010993.1\|WP_003458726.1\|2405136_2405748_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010993.1\|WP_003451187.1\|2396806_2397214_-\|transcription-antitermination-factor-NusB	unknown	unknown	gnl\|CDD\|234686
NZ_CP010993.1\|WP_057231743.1\|2402106_2402991_-\|stage-III-sporulation-protein-AA	unknown	unknown	gnl\|CDD\|274324
NZ_CP010993.1\|WP_003468964.1\|2407503_2408523_-\|type-II-secretion-system-F-family-protein	unknown	unknown	gnl\|CDD\|224376
NZ_CP010993.1\|WP_003451536.1\|2397806_2398304_-\|SpoIIIAH-like-family-protein	unknown	unknown	gnl\|CDD\|378918
NZ_CP010993.1\|WP_003451501.1\|2407082_2407511_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	unknown	unknown	gnl\|CDD\|236714

Protein	Function_ID	Function_description	E-value
NZ_CP010993.1\|WP_003451336.1\|2398329_2398935_-\|stage-III-sporulation-protein-AG	gnl\|CDD\|274319	TIGR02830, Stage_III_sporulation_protein_AG, stage III sporulation protein AG. CC A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, a member of this panel, is found in a spore formation operon and is designated stage III sporulation protein AG. [Cellular processes, Sporulation and germination].	2.26928e-69
NZ_CP010993.1\|WP_003458670.1\|2401444_2401960_-\|stage-III-sporulation-protein-SpoAB	gnl\|CDD\|131880	TIGR02833, Stage_III_sporulation_protein_AB, stage III sporulation protein AB. A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, a member of this panel, is designated stage III sporulation protein AB. [Cellular processes, Sporulation and germination].	1.85407e-76
NZ_CP010993.1\|WP_003451501.1\|2407082_2407511_-\|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein	gnl\|CDD\|236714	PRK10557, PRK10557, prepilin peptidase-dependent protein.	0.0024359
NZ_CP010993.1\|WP_003475135.1\|2406550_2407063_-\|type-II-secretion-system-protein	gnl\|CDD\|225076	COG2165, PulG, Type II secretory pathway, pseudopilin PulG [Cell motility and secretion / Intracellular trafficking and secretion].	0.000651586
NZ_CP010993.1\|WP_003451406.1\|2400697_2401084_-\|stage-III-sporulation-protein-AD	gnl\|CDD\|131896	TIGR02849, Stage_III_sporulation_protein_AD, stage III sporulation protein AD. Members of this family are the uncharacterized protein SpoIIIAD, part of the spoIIIA operon that acts at sporulation stage III as part of a cascade of events leading to endospore formation. Note that the start sites of members of this family as annotated tend to be variable; quite a few members have apparent homologous protein-coding regions continuing upstream of the first available start codon. The length of the alignment and the scoring cutoff thresholds for the model have been set to try to detect all valid members of the family, even if annotation of the start site begins too far downstream. [Cellular processes, Sporulation and germination].	5.58273e-33
NZ_CP010993.1\|WP_003468981.1\|2398949_2399507_-\|stage-III-sporulation-protein-AF	gnl\|CDD\|131942	TIGR02896, Stage_III_sporulation_protein_AF, stage III sporulation protein AF. This family represents the stage III sporulation protein AF of the bacterial endospore formation program, which exists in some but not all members of the Firmicutes (formerly called low-GC Gram-positives). The C-terminal region of this protein is poorly conserved, so only the N-terminal region, which includes two predicted transmembrane domains, is included in the seed alignment. [Cellular processes, Sporulation and germination].	1.64506e-24
NZ_CP010993.1\|WP_003451649.1\|2403664_2404222_-\|elongation-factor-P	gnl\|CDD\|234788	PRK00529, PRK00529, elongation factor P; Validated.	2.22205e-107
NZ_CP010993.1\|WP_003451671.1\|2401171_2401369_-\|stage-III-sporulation-protein-AC	gnl\|CDD\|131895	TIGR02848, Stage_III_sporulation_protein_AC, stage III sporulation protein AC. Members of this protein family are designated SpoIIIAC, part of the spoIIIA operon of sporulation genes whose mutant phenotype is linked to sporulation stage III. Members of this family are encoded by the genome of a species if and only if that species is capable of endospore formation, as in Bacillus subtilis. The molecular function of this small, probable integral membrane protein is unknown. [Cellular processes, Sporulation and germination].	1.97477e-14
NZ_CP010993.1\|WP_057231741.1\|2399514_2400687_-\|stage-III-sporulation-protein-AE	gnl\|CDD\|213743	TIGR02829, Stage_III_sporulation_protein_AE, stage III sporulation protein AE. A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, a member of this panel, is found in a spore formation operon and is designated stage III sporulation protein AE. [Cellular processes, Sporulation and germination].	5.42768e-149
NZ_CP010993.1\|WP_003451410.1\|2397332_2397722_-\|Asp23/Gls24-family-envelope-stress-response-protein	gnl\|CDD\|377129	pfam03780, Asp23, Asp23 family, cell envelope-related function. The alkaline shock protein Asp23 was identified as an alkaline shock protein that was expressed in a sigmaB-dependent manner in Staphylococcus aureus. Following an alkaline shock Asp23 accumulates in the soluble protein fraction of the S. aureus cell. Asp23 is one of the most abundant proteins in the cytosolic protein fraction of stationary S. aureus cells, with a copy-number of >25000 per cell. A second Asp23-family protein, AmaP, which is encoded within the asp23-operon, is required to localize Asp23 to the cell membrane. The overall function for the family is thus a cell envelope-related one in Gram-positive bacteria.	5.69298e-30
NZ_CP010993.1\|WP_003451187.1\|2396806_2397214_-\|transcription-antitermination-factor-NusB	gnl\|CDD\|234686	PRK00202, nusB, transcription antitermination factor NusB.	2.5545e-50
NZ_CP010993.1\|WP_057231743.1\|2402106_2402991_-\|stage-III-sporulation-protein-AA	gnl\|CDD\|274324	TIGR02858, Stage_III_sporulation_protein_AA, stage III sporulation protein AA. Members of this protein are the stage III sporulation protein AA, encoded by one of several genes in the spoIIIA locus. It seems that this protein is found in a species if and only if that species is capable of endospore formation. [Cellular processes, Sporulation and germination].	1.50843e-160
NZ_CP010993.1\|WP_003468964.1\|2407503_2408523_-\|type-II-secretion-system-F-family-protein	gnl\|CDD\|224376	COG1459, PulF, Type II secretory pathway, component PulF [Cell motility and secretion / Intracellular trafficking and secretion].	3.16251e-51
NZ_CP010993.1\|WP_003451536.1\|2397806_2398304_-\|SpoIIIAH-like-family-protein	gnl\|CDD\|378918	pfam12685, SpoIIIAH, SpoIIIAH-like protein. Stage III sporulation protein AH (SpoIIIAH) is a protein that is involved in forespore engulfment. It forms a channel with SpoIIIAH that is open on the forespore end and closed (or gated) on the mother cell end. This allows sigma-E-directed gene expression in the mother-cell compartment of the sporangium to trigger the activation of sigma-G forespore-specific gene expression by a pathway of intercellular signaling. This family of proteins is found in bacteria, archaea and eukaryotes and so must have a wider function that in sporulation. Proteins in this family are typically between 174 and 223 amino acids in length.	3.45938e-23

>NZ_CP010993.1|WP_057231743.1|2402106_2402991_-|stage-III-sporulation-protein-AA
MKEIFDVLPDKINSCLKDKSNLNKLQEIRVKVGKPLNIVLDNTETIFNYVIRREDVKAIIQKISNYSLYAFEEDIRQGYITIQGGHRVGLAGQCVIEDNSIKTIRNITFLNIRVCREIVGCSNSLMNSLVENNRVNNTLIISPPKCGKTTLLRDITRNISNGISQIGFKGKRTVVIDERSEIAACYNGIPQMNVGMRTDVYDNCIKSEGMMMAVRGLSPEVIICDEIGTYKDMEGLMMAYNSGVSIIATLHGRNVEELYRRPVFREIVENNIINKVVVLSGKKGIGTIEGIYNV
>NZ_CP010993.1|WP_003458670.1|2401444_2401960_-|stage-III-sporulation-protein-SpoAB
MKVFFLLIIVLLSSLIGYLYGEGFRNRLSQLRELKRALIDFENDIVYTYTPLPESIESIALKAKSPIKELFNEISFKLKNNEVENVYMAFKESINEHKKEMNLRNKDFEILLDLSKSLGETNVEGQIKIFNLAKEKLDIELEIAEDECNKNTKVYRYLGVAVGAMIAIFLV
>NZ_CP010993.1|WP_003451671.1|2401171_2401369_-|stage-III-sporulation-protein-AC
MSDLSLIFQIAGVGIVLVILDKVLDQSGKKEYATLANIVGVVIILTMMIQLISRLFSSVKSMFLF
>NZ_CP010993.1|WP_003451406.1|2400697_2401084_-|stage-III-sporulation-protein-AD
MDVVIQVISFVLISLFLYLVLKDNKSTFAVFLLLGAGIVIFLFVMPYVNEIIAFMQDIARESGMDSSYIAIVMKIIAIAYLSTFCSYICNDAGVTVLGKKVEFTGKIMILLLAIPIMANILNSILSIM
>NZ_CP010993.1|WP_057231741.1|2399514_2400687_-|stage-III-sporulation-protein-AE
MKKLINIILLSLIFVFCFNLKVLANDNLESSKEKIDNDSRIERFYDYINNLETEEDILGNMSAKEYIMNYLESGEDPITLKKIGTSILSYIFRELNIVLKFIASILVIALLSALLKNLQDAFNIEEGVTQIAFFACYALLIMLLTKSFFISLNLGKEVLTSIIDFMNVIVPVIVMLIATSGGVTSAVTIDPIVLGAVSITPRIYTYFLFPLILAYFTLQFVNNLSSEFKIDRMCKFIKQVVMISQGFILTIFVGILTLRGMTADTLDAVAVKTVKFAVDNFVPIVGKAFSDAITTVAGYSLAMKSVITSLGVIVIVVIVIYPIIKIGLMAICFKLTSAVIEPVVDSKISSSVETVGEALFMIMSCIISVSIMFFIMASMMATAGNFIVGG
>NZ_CP010993.1|WP_003468981.1|2398949_2399507_-|stage-III-sporulation-protein-AF
MELLKNWISTLCVVIVIISIAHIILPNSSIKKHVKFAFSLIILSVMLSPIIGLLTMNKDIDETVFQEKISDVTRSDEEKKSLYDEEAILKSVEKNLEKSLKDEFYENEFEVNLIGKIDFDEVKFNIEKAEITVLDEKKVKKVDKVVVGKEKVNKEEKKDSFLEKIEKFVEKELEISHENIIVSYA
>NZ_CP010993.1|WP_003451336.1|2398329_2398935_-|stage-III-sporulation-protein-AG
MHELKEKIANLFKQKNITNLIILLLLVIMFYLVVSYFTGVNNITKSEKTNLEKVSKEDMNSNSQKDSEVLSYQEKQEKDLERILGKINGVGSVDVVINFQSSEVKVPAVDNSSQKSTTEETDSEGGTRVNSQETDGDKIVMSNSSNGSEPVILKTEKPEVLGVMVVAEGAEDSKIKYEITKAISSLYNISVDKVNVLAMKK
>NZ_CP010993.1|WP_003451536.1|2397806_2398304_-|SpoIIIAH-like-family-protein
MNRKQAGIILTLLALIVCTGVLATRVNNQIKESMGEVPTAFGENDDNATETSSNYFYESRNLREQKDSKTIDNLKAIVEDKNTSAEQKEEAEKELTEKTMARDYETRIELSIKSKGYEDVICFIDGDNAKVVVKTNEELTQEKMVEIQDIVMNVSKVYDVDIEKK
>NZ_CP010993.1|WP_003451410.1|2397332_2397722_-|Asp23/Gls24-family-envelope-stress-response-protein
MNEMNRDEANLGIVNISDEVIGVVAGIAASEIDGILEINHNNSTGIGHKFSKKSLGKGIKVNVENGEAVIEIGVTVQYGIKIPDVVSQVQENVRRTVEAITGLKVALVNIYVQNIIILKEEDKNEILKK
>NZ_CP010993.1|WP_003451187.1|2396806_2397214_-|transcription-antitermination-factor-NusB
MNRVKSREYLLQLAYQMEITSETALETFNSFMENEDISKDDLDLAYIKSGLLGIEENKEKLDSLIESQLVKWKLNRISKVNLSILRISTYEILFAEDVPGKVSINEAIELCKKYSDNKSVSFINGVLDKVYKNMQ
>NZ_CP010993.1|WP_003458718.1|2403188_2403551_-|hypothetical-protein
MKDIKNNISNLLKAMDKNTELDKEFKDSLLNVISSLVDKIEELQVNVETLDENVNLLNDDLSGVQDELFEELTLEELEEYDDEYCEVVCDKCHKPIYIEKDILNRSESIPCPYCGNEFEV
>NZ_CP010993.1|WP_003451649.1|2403664_2404222_-|elongation-factor-P
MISGSDLRKGTTFELDGQVYTVIDFLHVKPGKGAAFVRTKLRNVIMGGVTDRTFNPTDKLQEAIIERKEMQYLYSDGELYYFMDQETFEQIPLNHEKVEDAIKFLKENMNAVIKFYKGEAFSVEAPNFVELLITECEPSVKGNTATTAMKTAVVETGATVMVPMFVEEGNTIRIDTRTGEYMERV
>NZ_CP010993.1|WP_011590962.1|2404392_2404740_-|hypothetical-protein
MKKLKLDVTLATIFIVILLVQGIELFQLRNYEIPVLTNSIGEMDLNTVLKNIENKDCTVLQLEYKEGWIGKVLFTGSLEDLSNYVNLLKNNNINIKNYKIEKSEELRCFLDLKVV
>NZ_CP010993.1|WP_003481876.1|2404736_2405177_-|hypothetical-protein
MRLEVRRIYIKKYKNFLPIEYVEEYNRKIKKKLNIYILLLLLFNLFFYGKIKTENNKIKNYLSEIKGVNRERSLDKEFLEDINKLKEIIKDEKILNLSLERKSFEVEVNSIYKNSLINYINKINGRVYDISLNESNNTYRLKGELR
>NZ_CP010993.1|WP_003458726.1|2405136_2405748_-|hypothetical-protein
MLIKTLVINDTNDISKLKELKDKRVKIILLNEKIFIETLRVDKKCNIEEKIEQLIRDRFFNYTPLVHYEVLKYKKSLFLIVYFIGCDERFKSLLYERKDFALTFPELKNKNILSFKKATFELKNLKISIYIKGKLVLLKSVKDSNIIEVIEESLKGLEKDFGVSLKDFTFKIQKEYLKEEIKEWFKGLKLNEIRGEENLYQKI
>NZ_CP010993.1|WP_011590964.1|2405722_2406133_-|hypothetical-protein
MKRRKGFVSIEVMLVSLICSMIVTILMDNSFQRRKELDRSFKIISSNIDKNNSEEQFLKYMLKEKILNIDNINKLDFTLNNMNATYIEDKKAIHIKSKDKISGVFKDTYYGIDFRNDDIILSKRGNYEFVNKDLSN
>NZ_CP010993.1|WP_003458668.1|2406119_2406416_-|hypothetical-protein
MYLNHRFWDNMVENIKINKDKNYILVKFWRDGIVAEDKIEKIKNKLYVYYNYTGYGRNYSPALIEDVEKFDLMEKGNLFYIKLKVKNQEERIYCYEKA
>NZ_CP010993.1|WP_003475135.1|2406550_2407063_-|type-II-secretion-system-protein
MEGKINKKKGYLLVDMVLALALISILFLGIGKSYSTYIKNNYYIKEKIKVAEIINSLAMELKHNISFEDLRSINSGTYKISTLKINDLINSDIKEFLRKNLILHNKNHNDLGWTINISHFDQYESIINIIYKNEKPYISENKEVKIYKFLEKSFQNLENPPQKEEEKHIY
>NZ_CP010993.1|WP_003451501.1|2407082_2407511_-|prepilin-type-N-terminal-cleavage/methylation-domain-containing-protein
MYRKRKGFTLSEVIIYLAITSLILAIPTSFMIIKDRGYELKVEGEISKIHDFLMEAKQLSKKDNLYGEIIFDILDNKLIYENAIRTTSLKLNGVKVSFNRDNLITINETGMISIAGTITIIDKNNKQREITIVPGIWKINVK
>NZ_CP010993.1|WP_003468964.1|2407503_2408523_-|type-II-secretion-system-F-family-protein
MFGFKDEASYICLNLSTYVKSGMPIGRSLDLIKNTVKDKKYKESLKRIEKKVLNGEALSKAFKEEGNLYPDLMKDMMKIGEESGNLEEVLEKCARNILAEKEIKNKIIKSLRYPVSLLIGLIIMIFGYVTYILPQFVDMYELREIEGSKIMTLLNNYINFVEENPNVEVIVFCYFSCALISLYLLFKVIPSEKILEKIEVYRMYYEIRILFLINMILNSGISLNNSLSVFGESLSDVKLRKYIKSINEELIKGTTLSSSIGKINVISHVSKGFLITGEESGLFSKNIEELLKIREKDFDRALNKTVGKIEPAMFIILGFVISAMMLLVLVPTFEGMKYV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

421892 : 490755

Clostridium_phage(81.82%)

terminase,integrase,capsid,holin

attL 463473:463490|attR 494793:494810

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061414373.1\|421892_422264_+\|holin	phage holin family protein	NA	NA	NA	NA
WP_061414376.1\|422338_423010_-	cyclic nucleotide-binding domain-containing protein	NA	NA	NA	NA
WP_061414380.1\|423953_426773_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	57.2
WP_061414383.1\|427105_427540_+	FHA domain-containing protein	NA	NA	NA	NA
WP_003457997.1\|427553_428783_+	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_061414386.1\|428783_430247_+	penicillin-binding protein	NA	NA	NA	NA
WP_060669536.1\|430403_432266_+	excinuclease ABC subunit UvrC	NA	NA	NA	NA
WP_003457971.1\|432414_433329_+	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_003457961.1\|433568_434453_+	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	2.0e-10	28.5
WP_003458089.1\|434449_435796_+	YvcK family protein	A1IMD5	Streptococcus_phage	1.2e-46	34.4
WP_003457993.1\|435798_436749_+	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	1.0e-44	34.6
WP_061414389.1\|436921_437476_+	hypothetical protein	NA	NA	NA	NA
WP_061416086.1\|437609_438854_-	DUF4179 domain-containing protein	NA	NA	NA	NA
WP_003479012.1\|438867_439404_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_004457476.1\|439872_441123_+	DNA polymerase III subunit alpha	Q8W6C3	Saccharomonospora_phage	6.6e-84	39.9
WP_004457554.1\|441327_442107_+	LAGLIDADG family homing endonuclease	A0A0E3XA08	Staphylococcus_phage	9.7e-09	28.2
WP_003455617.1\|445255_446215_+	6-phosphofructokinase	NA	NA	NA	NA
WP_011590151.1\|446308_447712_+	pyruvate kinase	NA	NA	NA	NA
WP_003479007.1\|448291_448648_+	DUF1540 domain-containing protein	NA	NA	NA	NA
WP_011590152.1\|448956_449754_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_057230510.1\|449925_451461_+	cardiolipin synthase	NA	NA	NA	NA
WP_003479004.1\|451666_451825_-	DUF1540 domain-containing protein	NA	NA	NA	NA
WP_061414392.1\|452091_453654_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_061414395.1\|453781_455149_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	1.3e-109	43.8
WP_061414398.1\|455213_456356_-\|integrase	site-specific integrase	A0A0A8WIE1	Clostridium_phage	4.3e-122	58.0
WP_061414401.1\|456429_456870_-	ImmA/IrrE family metallo-endopeptidase	M9Q1J0	Clostridium_phage	3.1e-65	84.4
WP_061414404.1\|456972_457407_-	helix-turn-helix transcriptional regulator	M9Q2L3	Clostridium_phage	4.5e-40	66.0
WP_061414407.1\|457590_457785_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_061414409.1\|457835_458033_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_061414412.1\|458044_458224_+	hypothetical protein	M9Q2G4	Clostridium_phage	4.3e-21	93.2
WP_061414415.1\|458235_458784_+	sigma-70 family RNA polymerase sigma factor	M9Q2I8	Clostridium_phage	2.7e-42	49.2
WP_061414419.1\|459507_460329_+	hypothetical protein	M9Q2G6	Clostridium_phage	1.2e-150	97.8
WP_081111417.1\|460300_461038_+	ATP-binding protein	M9Q1J4	Clostridium_phage	1.2e-133	94.3
WP_061414422.1\|461098_461407_+	hypothetical protein	M9Q2L5	Clostridium_phage	4.2e-40	77.2
WP_061414425.1\|461407_462289_+	hypothetical protein	NA	NA	NA	NA
WP_061414428.1\|462301_463339_+	nucleoid-associated protein	J9QE81	Clostridium_phage	4.1e-39	30.7
WP_061414431.1\|463415_463691_+	MarR family transcriptional regulator	M9Q2I9	Clostridium_phage	8.3e-40	92.3
463473:463490	attL	NA	NA	NA	NA
WP_061414433.1\|463699_464002_+	sporulation transcriptional regulator SpoIIID	M9Q261	Clostridium_phage	2.1e-44	92.0
WP_061414436.1\|464003_464345_+	sigma-70 family RNA polymerase sigma factor	M9Q2G8	Clostridium_phage	1.5e-14	43.4
WP_061414439.1\|465407_466067_+\|integrase	tyrosine-type recombinase/integrase	M9Q2H0	Clostridium_phage	6.3e-118	96.8
WP_061414442.1\|466549_467113_+	recombinase family protein	M9Q1K0	Clostridium_phage	1.9e-94	96.2
WP_061414443.1\|467928_469296_+\|terminase	terminase	M9Q2I1	Clostridium_phage	5.8e-267	97.6
WP_061414446.1\|469298_469508_+	hypothetical protein	NA	NA	NA	NA
WP_061414449.1\|469509_471030_+\|capsid	capsid protein	M9Q246	Clostridium_phage	1.1e-282	96.4
WP_061414452.1\|471013_472153_+\|capsid	capsid protein	M9Q2F2	Clostridium_phage	4.3e-199	94.3
WP_061414455.1\|472220_473405_+	AAA family ATPase	C7BGE8	Burkholderia_phage	1.8e-38	29.4
WP_061414459.1\|473388_474153_+	hypothetical protein	NA	NA	NA	NA
WP_061414461.1\|474279_474894_+	hypothetical protein	M9Q248	Clostridium_phage	2.6e-65	80.4
WP_061414464.1\|474914_475820_+	hypothetical protein	M9Q2F4	Clostridium_phage	4.0e-155	88.7
WP_061414468.1\|475836_476106_+	hypothetical protein	M9Q1H8	Clostridium_phage	7.6e-22	98.1
WP_061414471.1\|476142_476505_+	hypothetical protein	M9Q2K9	Clostridium_phage	1.5e-57	95.8
WP_061414474.1\|476507_476834_+	hypothetical protein	M9Q2I3	Clostridium_phage	2.8e-55	95.4
WP_061414477.1\|476833_477217_+	hypothetical protein	M9Q249	Clostridium_phage	2.0e-63	94.5
WP_061414480.1\|477216_477603_+	hypothetical protein	M9Q2F6	Clostridium_phage	4.0e-64	93.0
WP_061414483.1\|477612_478062_+	hypothetical protein	M9Q1I1	Clostridium_phage	2.5e-73	92.4
WP_061414486.1\|478078_478447_+	hypothetical protein	M9Q2L0	Clostridium_phage	4.1e-42	75.4
WP_061414490.1\|478436_478769_+	hypothetical protein	M9Q2I4	Clostridium_phage	2.3e-52	93.6
WP_061414493.1\|478810_482029_+	hypothetical protein	M9Q251	Clostridium_phage	0.0e+00	92.4
WP_061414496.1\|482032_482386_+	hypothetical protein	M9Q2F8	Clostridium_phage	2.5e-57	94.7
WP_061414499.1\|482459_482642_+	hypothetical protein	NA	NA	NA	NA
WP_061414502.1\|482711_482975_+	hypothetical protein	Q0SPL4	Clostridium_phage	3.0e-15	51.9
WP_061414505.1\|483040_483421_+	DUF1617 family protein	M9Q2L1	Clostridium_phage	1.3e-56	88.1
WP_061414507.1\|483456_487563_+	hypothetical protein	M9Q2I5	Clostridium_phage	1.8e-242	85.1
WP_061414510.1\|487578_487821_+	hypothetical protein	NA	NA	NA	NA
WP_061414513.1\|487833_488250_+\|holin	phage holin family protein	M9Q253	Clostridium_phage	8.6e-65	91.3
WP_061414516.1\|488290_488707_+	hypothetical protein	M9Q2G0	Clostridium_phage	8.1e-63	96.4
WP_061414519.1\|488824_489868_+	N-acetylmuramoyl-L-alanine amidase	Q8SBN4	Clostridium_phage	2.7e-179	86.5
WP_061414522.1\|490110_490755_+	PH domain-containing protein	M9Q2L2	Clostridium_phage	4.6e-89	79.0
494793:494810	attR	NA	NA	NA	NA

DBSCAN-SWA_2

872634 : 885224

Synechococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003471934.1\|872634_873285_+	aminotransferase	A0A1B1P8C0	Bacillus_phage	2.9e-14	31.1
WP_003456962.1\|873789_875100_+	phosphomethylpyrimidine synthase ThiC	NA	NA	NA	NA
WP_061414910.1\|875337_879138_+	phosphoribosylformylglycinamidine synthase	A6N228	Microbacterium_phage	4.7e-32	24.9
WP_003453078.1\|879448_879928_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.6e-28	47.4
WP_003456948.1\|879927_880635_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	2.8e-47	43.8
WP_011009969.1\|880656_882102_+	amidophosphoribosyltransferase	A0A1B1ISH6	uncultured_Mediterranean_phage	1.4e-56	33.0
WP_003468449.1\|882102_883104_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3FGG1	Synechococcus_phage	6.7e-71	49.0
WP_003468450.1\|883091_883706_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.2e-24	38.3
WP_061414913.1\|883718_885224_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	1.2e-66	47.2

DBSCAN-SWA_3

2038289 : 2051546

Clostridium_phage(22.22%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003457168.1\|2038289_2039327_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	5.4e-31	36.0
WP_003454568.1\|2039527_2039797_+	ACT domain-containing protein	NA	NA	NA	NA
WP_061415724.1\|2039813_2041166_+	PFL family protein	NA	NA	NA	NA
WP_061415726.1\|2041377_2041881_-	QueT transporter family protein	E7DN70	Pneumococcus_phage	1.1e-13	37.2
WP_003457231.1\|2042205_2043081_-	MBL fold metallo-hydrolase	Q332C0	Clostridium_botulinum_C_phage	1.1e-64	50.2
WP_011590863.1\|2043251_2044574_-	sensor histidine kinase	X5JAC0	Clostridium_phage	3.6e-72	37.8
WP_003449818.1\|2044567_2045278_-	response regulator transcription factor	A0A2R2ZGH8	Clostridioides_phage	3.3e-32	31.8
WP_003456038.1\|2045416_2046430_-	N-acetylmuramoyl-L-alanine amidase	Q8SBN4	Clostridium_phage	2.5e-121	64.0
WP_003455890.1\|2046526_2046814_-	thiamine-binding protein	NA	NA	NA	NA
WP_003456055.1\|2047037_2048051_-	DUF348 domain-containing protein	A0A143FMI2	Bacillus_phage	3.5e-19	52.0
WP_003455941.1\|2048476_2049775_-	uracil permease	Q9KX94	Enterobacteria_phage	3.6e-69	39.3
WP_003456099.1\|2049962_2051546_+	ATP-binding cassette domain-containing protein	A0A1V0SGN0	Hokovirus	8.5e-44	25.6

DBSCAN-SWA_4

2508612 : 2518122

Orpheovirus(33.33%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003470991.1\|2508612_2509860_-\|tRNA	histidine--tRNA ligase	A0A2I2L577	Orpheovirus	1.5e-27	26.3
WP_061415837.1\|2509891_2511334_-	coproporphyrinogen III oxidase	NA	NA	NA	NA
WP_003468751.1\|2511323_2511944_-	MBL fold metallo-hydrolase	A0A1X9I5D3	Streptococcus_phage	4.5e-25	32.3
WP_003451157.1\|2512103_2512553_-\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_003468756.1\|2512567_2514748_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2I2L310	Orpheovirus	1.4e-12	36.9
WP_003451591.1\|2514899_2515418_-	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	2.1e-28	43.1
WP_003451668.1\|2515461_2516316_-	DHH family phosphoesterase	NA	NA	NA	NA
WP_003448635.1\|2516598_2517069_-\|transposase	IS200/IS605 family transposase	A0A1P8BMC0	Lactococcus_phage	1.1e-18	35.5
WP_003451195.1\|2517252_2518122_-	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	2.0e-34	38.7

DBSCAN-SWA_5

2780100 : 2845906

Clostridium_phage(15.38%)

tRNA,coat,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061415923.1\|2780100_2781300_+\|transposase	transposase	Q331V1	Clostridium_botulinum_C_phage	2.3e-166	75.8
WP_003468158.1\|2781458_2781923_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_003468132.1\|2781916_2782621_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_061415925.1\|2782620_2783067_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_003468145.1\|2783348_2783945_-	ECF transporter S component	NA	NA	NA	NA
WP_049040054.1\|2784292_2786455_-	RNA-binding transcriptional accessory protein Tex	NA	NA	NA	NA
WP_049040052.1\|2786566_2787910_+	Zn-dependent exopeptidase M28	NA	NA	NA	NA
WP_139320904.1\|2788158_2789254_-	peptide chain release factor 2	A0A2I2MPK0	Mycobacterium_phage	2.2e-06	50.0
WP_049040049.1\|2789507_2792030_-	preprotein translocase subunit SecA	NA	NA	NA	NA
WP_003452413.1\|2792265_2792805_-	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_061415929.1\|2793256_2793916_-	ComF family protein	NA	NA	NA	NA
WP_003470573.1\|2793891_2794854_-	hypothetical protein	NA	NA	NA	NA
WP_003468230.1\|2794871_2797106_-	ATP-dependent RecD-like DNA helicase	A0A0K2FLP8	Brevibacillus_phage	2.7e-72	32.0
WP_003452520.1\|2797242_2798379_+	N-acetylglucosamine-6-phosphate deacetylase	NA	NA	NA	NA
WP_061415931.1\|2798515_2799691_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	2.0e-151	67.9
WP_003468164.1\|2800909_2801572_-	hypothetical protein	NA	NA	NA	NA
WP_003468202.1\|2801659_2802190_+\|protease	spore protease YyaC	G3M9W0	Bacillus_virus	1.0e-17	38.5
WP_003452335.1\|2802228_2803266_-	rod shape-determining protein	NA	NA	NA	NA
WP_003452341.1\|2803356_2803608_-	sporulation transcriptional regulator SpoIIID	M9Q261	Clostridium_phage	2.4e-17	58.7
WP_003468140.1\|2803682_2804453_-	M23 family metallopeptidase	NA	NA	NA	NA
WP_003468179.1\|2804563_2805586_-	stage II sporulation protein D	Q2XU88	Pseudomonas_phage	3.0e-34	35.9
WP_003470895.1\|2805697_2806963_-	UDP-N-acetylglucosamine 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_003468192.1\|2806985_2807630_-	hypothetical protein	NA	NA	NA	NA
WP_003448635.1\|2807902_2808373_-\|transposase	IS200/IS605 family transposase	A0A1P8BMC0	Lactococcus_phage	1.1e-18	35.5
WP_003452358.1\|2808548_2808950_-	F0F1 ATP synthase subunit epsilon	NA	NA	NA	NA
WP_003452277.1\|2808965_2810363_-	F0F1 ATP synthase subunit beta	NA	NA	NA	NA
WP_003452288.1\|2810376_2811228_-	F0F1 ATP synthase subunit gamma	NA	NA	NA	NA
WP_003452357.1\|2811292_2812801_-	F0F1 ATP synthase subunit alpha	NA	NA	NA	NA
WP_003457416.1\|2812811_2813351_-	F0F1 ATP synthase subunit delta	NA	NA	NA	NA
WP_003452454.1\|2813353_2813833_-	F0F1 ATP synthase subunit B	NA	NA	NA	NA
WP_003452423.1\|2813932_2814151_-	ATP synthase F0 subunit C	NA	NA	NA	NA
WP_003452429.1\|2814211_2814886_-	F0F1 ATP synthase subunit A	NA	NA	NA	NA
WP_003482158.1\|2814951_2815308_-	ATP synthase subunit I	NA	NA	NA	NA
WP_003457425.1\|2815989_2817168_-	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
WP_003468131.1\|2817435_2818590_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A1V0SAG5	Catovirus	2.9e-25	25.5
WP_003452430.1\|2818653_2819283_-	uracil phosphoribosyltransferase	NA	NA	NA	NA
WP_003457391.1\|2819327_2819777_-	ribose 5-phosphate isomerase B	NA	NA	NA	NA
WP_003452339.1\|2820040_2821093_-	threonylcarbamoyl-AMP synthase	A0A291ATS8	Pandoravirus	8.4e-48	36.7
WP_003452379.1\|2821115_2821706_-	hypothetical protein	NA	NA	NA	NA
WP_003452315.1\|2821784_2822867_-	peptide chain release factor 1	NA	NA	NA	NA
WP_003457428.1\|2822923_2824687_-	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_003452353.1\|2824712_2825312_-	thymidine kinase	A0A249XXF6	Clostridium_phage	6.6e-50	48.7
WP_003452406.1\|2825467_2825674_+	50S ribosomal protein L31	NA	NA	NA	NA
WP_003457423.1\|2825782_2826907_+	glycosyltransferase	NA	NA	NA	NA
WP_003452426.1\|2826949_2828410_-	transcription termination factor Rho	NA	NA	NA	NA
WP_003452392.1\|2828675_2830283_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	8.0e-159	53.4
WP_003452275.1\|2830623_2831043_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_011591068.1\|2831065_2832046_-\|tRNA	tRNA 4-thiouridine(8) synthase ThiI	NA	NA	NA	NA
WP_061415933.1\|2832091_2832721_-	stage II sporulation protein R	NA	NA	NA	NA
WP_003471015.1\|2832789_2833656_-	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_061415934.1\|2833791_2836416_-	cyanophycin synthetase	NA	NA	NA	NA
WP_003452400.1\|2836402_2837230_-	cyanophycinase	NA	NA	NA	NA
WP_003457329.1\|2837329_2838892_-	DUF3794 domain-containing protein	NA	NA	NA	NA
WP_003462688.1\|2839251_2839488_-	Veg family protein	NA	NA	NA	NA
WP_061415935.1\|2839650_2840538_-	sporulation peptidase YabG	NA	NA	NA	NA
WP_011010823.1\|2840740_2841745_-\|coat	CotS family spore coat protein	NA	NA	NA	NA
WP_011010824.1\|2841853_2842981_+	glycosyltransferase family 4 protein	B6EFC4	Stygiolobus_rod-shaped_virus	1.4e-05	36.6
WP_011010825.1\|2843163_2844192_-\|coat	CotS family spore coat protein	NA	NA	NA	NA
WP_011010826.1\|2844207_2844891_-	hypothetical protein	NA	NA	NA	NA
WP_011010827.1\|2844898_2845906_-\|coat	CotS family spore coat protein	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP013044

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013044_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013044_1

12123-12216

Orphan

Consensus_repeat	Method
CTGTCATTTTGACTGTTCTCAGAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013044_1

>merge|NZ_CP013044|1|12123-12216|CRISPRCasFinder
CTGTCATTTTGAGAGCTGTCATTTTGACTGTTCTCAGAAAAAGTAGTATTTATGCCATTTTTATCAGCACTGTCATTTTGACTGTTCTCAGAAA

>NZ_CP013044|1|1|12123-12216|CRISPRCasFinder
CTGTCATTTTGAGAGCTGTCATTTT	GACTGTTCTCAGAAAAAGTAGTATTTATGCCATTTTTATCAGCA
CTGTCATTTTGACTGTTCTCAGAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013044.1\|WP_004461153.1\|2252_2906_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP013044.1\|WP_003482664.1\|16586_17561_+\|choloylglycine-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|238303
NZ_CP013044.1\|WP_162485793.1\|14197_15430_+\|ParB-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|319263
NZ_CP013044.1\|WP_003482659.1\|13386_14139_+\|ParA-family-protein	unknown	unknown	gnl\|CDD\|379293
NZ_CP013044.1\|WP_061416414.1\|28476_29046_+\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NZ_CP013044.1\|WP_061416408.1\|24832_25630_+\|class-C-sortase	unknown	unknown	gnl\|CDD\|320676
NZ_CP013044.1\|WP_061416405.1\|23131_24691_+\|SpaH/EbpB-family-LPXTG-anchored-major-pilin	unknown	unknown	gnl\|CDD\|374637
NZ_CP013044.1\|WP_061416398.1\|18760_20218_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|368260
NZ_CP013044.1\|WP_061416386.1\|8432_9476_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|349398
NZ_CP013044.1\|WP_011264106.1\|436_655_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013044.1\|WP_050808869.1\|7959_8322_-\|type-II-toxin-antitoxin-system-PemK/MazF-family-toxin	unknown	unknown	gnl\|CDD\|367091
NZ_CP013044.1\|WP_061416392.1\|10320_11427_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|234688
NZ_CP013044.1\|WP_011264107.1\|936_2256_-\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP013044.1\|WP_061416401.1\|20858_23132_+\|Cys-Gln-thioester-bond-forming-surface-protein	unknown	unknown	gnl\|CDD\|227268
NZ_CP013044.1\|WP_011264110.1\|5087_6365_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223650
NZ_CP013044.1\|WP_011264109.1\|4421_5078_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224059
NZ_CP013044.1\|WP_003453396.1\|25864_26275_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013044.1\|WP_061416389.1\|9521_10007_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|197715
NZ_CP013044.1\|WP_011264108.1\|3045_4422_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223650
NZ_CP013044.1\|WP_061416410.1\|26769_28026_+\|4Fe-4S-cluster-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|275256

Protein	Function_ID	Function_description	E-value
NZ_CP013044.1\|WP_004461153.1\|2252_2906_-\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	4.64685e-68
NZ_CP013044.1\|WP_003482664.1\|16586_17561_+\|choloylglycine-hydrolase-family-protein	gnl\|CDD\|238303	cd00542, Ntn_PVA, Penicillin V acylase (PVA), also known as conjugated bile salt acid hydrolase (CBAH), catalyzes the hydrolysis of penicillin V to yield 6-amino penicillanic acid (6-APA), an important key intermediate of semisynthetic penicillins. PVA has an N-terminal nucleophilic cysteine, as do other members of the Ntn hydrolase family to which PVA belongs. This nucleophilic cysteine is exposed by post-translational prossessing of the PVA precursor. PVA forms a homotetramer.	1.76922e-135
NZ_CP013044.1\|WP_003482659.1\|13386_14139_+\|ParA-family-protein	gnl\|CDD\|379293	pfam13614, AAA_31, AAA domain. This family includes a wide variety of AAA domains including some that have lost essential nucleotide binding residues in the P-loop.	5.53348e-63
NZ_CP013044.1\|WP_061416414.1\|28476_29046_+\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	1.55668e-47
NZ_CP013044.1\|WP_061416408.1\|24832_25630_+\|class-C-sortase	gnl\|CDD\|320676	cd05827, Sortase_C, Sortase domain found in class C sortases. Class C sortases are membrane-bound cysteine transpeptidases broadly distributed in Gram-positive bacteria (mainly present in Firmicutes and Actinobacteria). They function as pilin polymerases responsible for the assembly of pili, which are multi-subunit hair-like fibres that extend from the cell surface to promote microbial adhesion and biofilm formation. First, one or more class C sortases form the long thin shaft of the pilus through linking together pilin subunits via isopeptide bonds. The base of the pilus is then anchored to the cell wall by a housekeeping sortase or, in some cases, the class C sortase itself. Depending upon the organism both the number and type of sortase enzymes involved varies, and in some cases, accessory factors appear to be needed. In three-component spaA pilus from Corynebacterium diphtheriae, the prototypical class C sortase (named Cd-SrtA) catalyzes polymerization of the SpaA-type pilus, consisting of the shaft pilin SpaA, tip pilin SpaC and minor pilin SpaB. The pilus shaft is then attached to the cell wall by a housekeeping class E sortase, Cd-SrtF. In the absence of Cd-SrtF, Cd-SrtA attaches the pilus to the cell wall, albeit at a reduced rate. Cd-SrtA can recognize two distinct sorting signals (LPLTG in SpaA and SpaC, and LAFTG in SpaB) and it can employ lysine residues that originate from different proteins (either Lys190 within the pilin motif of SpaA or Lys139 in SpaB). However, Cd-SrtA cannot be able to polymerize the major pilin subunit SpaH, even though it contains LPLTG motif. In two-component pili of prototypical Bacillus cereus, the class C sortase (named Bc-SrtD) cleaves related sorting signals within a major pilin protein BcpA (LPVTG) and a minor tip pilin BcpB (IPNTG), and catalyzes a transpeptidation that joins the threonine residues in each signal to the side-chain of Lys162 in BcpA (located within a pilin motif). Unlike the SpaA pilus in C. diphtheriae, in B. cereus Bc-SrtD is unable to covalently attach the pilus to the cell wall without the help of the housekeeping sortase.	7.83115e-75
NZ_CP013044.1\|WP_061416405.1\|23131_24691_+\|SpaH/EbpB-family-LPXTG-anchored-major-pilin	gnl\|CDD\|374637	pfam16569, GramPos_pilinBB, Gram-positive pilin backbone subunit 2, Cna-B-like domain. GramPos_pilinBB is one of the major backbone units of Gram-positive pili, such as those from S.pneumoniae. There are three major pilin subunits that form the polymeric backbone of the pilin from S. pneumoniae, constructed of three transthyretin-like, CnaB, domains along with a crucial N-terminal domain, D1. The three Cna-B like domains are stabilized by internal Lys-Asn isopeptdie bonds, Gram-positive pili are formed from a single chain of covalently linked subunit proteins (pilins), usually comprising an adhesin at the distal tip, a major pilin that forms the polymer shaft and a minor pilin that mediates cell wall anchoring at the base.	1.16764e-22
NZ_CP013044.1\|WP_061416386.1\|8432_9476_-\|hypothetical-protein	gnl\|CDD\|349398	cd05379, CAP_bacterial, Bacterial CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain proteins. Little is known about bacterial and archaeal members of the CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain family. The wider family of CAP domain containing proteins includes plant pathogenesis-related protein 1 (PR-1), cysteine-rich secretory proteins (CRISPs), and allergen 5 from vespid venom, among others. Studies of eukaryotic proteins show that CAP domains have several functions, including the binding of cholesterol, lipids and heparan sulfate. This group includes Borrelia burgdorferi outer surface protein BB0689, which does not bind to cholesterol, lipids, or heparan sulfate, and whose function is unknown.	1.12069e-20
NZ_CP013044.1\|WP_061416398.1\|18760_20218_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|368260	pfam05043, Mga, Mga helix-turn-helix domain. M regulator protein trans-acting positive regulator (Mga) is a DNA-binding protein that activates the expression of several important virulence genes in group A streptococcus in response to changing environmental conditions. This domain is found in the centre of the Mga proteins. This family also contains a number of bacterial RofA transcriptional regulators that seem to be largely restricted to streptococci. These proteins have been shown to regulate the expression of important bacterial adhesins. This is presumably a DNA-binding domain.	8.46537e-13
NZ_CP013044.1\|WP_162485793.1\|14197_15430_+\|ParB-N-terminal-domain-containing-protein	gnl\|CDD\|319263	cd16406, ParB_N_like, ParB N-terminal, parA-binding, -like domain of bacterial and plasmid parABS partitioning systems. This family represents the N-terminal domain of ParB, a DNA-binding component of the prokaryotic parABS partitioning system. parABS contributes to the efficient segregation of chromosomes and low-copy number plasmids to daughter cells during prokaryotic cell division. The process includes the parA (Walker box) ATPase, the ParB DNA-binding protein and a parS cis-acting DNA sites. Binding of ParB to centromere-like parS sites is followed by non-specific binding to DNA ("spreading", which has been implicated in gene silencing in plasmid P1) and oligomerization of additional ParB molecules near the parS sites. It has been proposed that ParB-ParB cross-linking compacts the DNA, binds to parA via the N-terminal region, and leads to parA separating the ParB-parS complexes and the recruitment of the SMC (structural maintenance of chromosomes) complexes. The ParB N-terminal domain of Bacillus subtilis and other species contains a Arginine-rich ParB Box II with residues essential for bridging of the ParB-parS complexes. The arginine-rich ParB Box II consensus (I[VIL]AGERR[FYW]RA[AS] identified in several species is partially conserved with this family and related families. Mutations within the basic columns particularly debilitate spreading from the parS sites and impair SMC recruitment. The C-terminal domain contains a HTH DNA-binding motif and is the primary homo-dimerization domain, and binds to parS DNA sites. Additional homo-dimerization contacts are found along the N-terminal domain, but dimerization of the N-terminus may only occur after concentration at ParB-parS foci.	1.81972e-13
NZ_CP013044.1\|WP_061416410.1\|26769_28026_+\|4Fe-4S-cluster-binding-domain-containing-protein	gnl\|CDD\|275256	TIGR04463, Radical_SAM_domain_protein, radical SAM/SPASM domain protein maturase. Members of this family are probable protein/peptide-modifying radical SAM/SPASM domain proteins. The majority of members of this family seem to target Cys-rich repetitive regions of large proteins rather than of bacteriocin-sized small precursors. This arrangement suggests the modification target may be multifunctional, with the C-terminal domain behaving like a bacteriocin but other parts of the same precursor serving an immunity function, as occurs for the halocin C8 precursor.	7.39827e-35
NZ_CP013044.1\|WP_061416392.1\|10320_11427_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|234688	PRK00215, PRK00215, transcriptional repressor LexA.	3.90907e-28
NZ_CP013044.1\|WP_050808869.1\|7959_8322_-\|type-II-toxin-antitoxin-system-PemK/MazF-family-toxin	gnl\|CDD\|367091	pfam02452, PemK_toxin, PemK-like, MazF-like toxin of type II toxin-antitoxin system. PemK is a growth inhibitor in E. coli known to bind to the promoter region of the Pem operon, auto-regulating synthesis. This family represents the toxin molecule of a typical bacterial toxin-antitoxin system pairing. The family includes a number of different toxins, such as MazF, Kid, PemK, ChpA, ChpB and ChpAK.	1.3785e-20
NZ_CP013044.1\|WP_061416401.1\|20858_23132_+\|Cys-Gln-thioester-bond-forming-surface-protein	gnl\|CDD\|227268	COG4932, COG4932, Predicted outer membrane protein [Cell envelope biogenesis, outer membrane].	6.17113e-102
NZ_CP013044.1\|WP_011264110.1\|5087_6365_-\|ABC-transporter-permease	gnl\|CDD\|223650	COG0577, SalY, ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms].	7.04818e-07
NZ_CP013044.1\|WP_011264109.1\|4421_5078_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224059	COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms].	1.30784e-76
NZ_CP013044.1\|WP_061416389.1\|9521_10007_-\|hypothetical-protein	gnl\|CDD\|197715	smart00421, HTH_LUXR, helix_turn_helix, Lux Regulon. lux regulon (activates the bioluminescence operon.	0.00053949
NZ_CP013044.1\|WP_011264108.1\|3045_4422_-\|ABC-transporter-permease	gnl\|CDD\|223650	COG0577, SalY, ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms].	1.81034e-09
NZ_CP013044.1\|WP_011264107.1\|936_2256_-\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	3.33286e-18

>NZ_CP013044.1|WP_061416392.1|10320_11427_+|helix-turn-helix-domain-containing-protein
MITIDWSTFSKNIKKYRKSQKLTQEDLANKLGISRSTLSYYEHGNIEPNIFVLITLSKLMNCSIDSLIGLSKKRKVQDPSIPDESNYKLEESENQNNENFKLEIEEIREERKKILEKTKRSFTELEMSKKRADRMYNEFEMSKKRADRMYNEFETSKRQVDRIINQLETSKKRLDKMLEELEMSKKRTDYMYKELFRTINREKTIDDSILKLDNLEKERKLDILKAQAIDNNYIGFIKLNILGEISAGLPHYACENLIDTVYLPNQFFKPNFEYFGLRIFGDSMNKIFDNDFTIIVRKTNSFINGDIVVAIIGDEATCKEIKQVENYIYLIPHSTNPEHQIQKYKADQVMILGVVEQTIKSILDKIDI
>NZ_CP013044.1|WP_061416389.1|9521_10007_-|hypothetical-protein
MRILDELSEHEKRQLEIMDLYNAGYTYKDIGRIMFMSENTIKGIVKNWIDSLPAPNRERIRKIHRQASFSRSDTRKALDYEAKKEIRDKAFILKNRSIYNTKRNGDIVLKSESEIGCSVSFDTPRKLINENKEIEYKNLKDEEIKLEVLSFYSRKNRDKLN
>NZ_CP013044.1|WP_061416386.1|8432_9476_-|hypothetical-protein
MSKKLKELIRVIKEHKKTSIGVAVALAIAITGGVSYSILSNTYNKTNNTALSEKINDTKEANKDNIKTDEAEATNDEATNESEANKSTPEDGIEVEQTKDGNVIVKDQKTGNIIADSSKGDDVKKVINSKKDAGSSITIKNDKTGKVEKVEDIKDVTATGEGTIIIVKPENKPENTENNKPDSSSENKPESKPESKPENNEKEEQPAEQPEETPQPSKPVEKPVEQPKNVQYMVDMSEQLWSDFNAYRQSKGLNALSWSGKYATWTKNHVEEMAKKNTGSYHVDYPEGGQVTRSNSNKNLTASEILQQFKNSPAHNKNILDDELTEGACAVYKSADGGYYFAIGFDY
>NZ_CP013044.1|WP_050808869.1|7959_8322_-|type-II-toxin-antitoxin-system-PemK/MazF-family-toxin
MEIILKVKRNFYKGKVYKGDIFYANLGKRKQGSEQQGIRPVAILQNFGSSFIVAPMTSQVKNKMKVHTEIENSCLEKPSTILLEQITTIYRHQLSEKKGTLTNNEIKRLNRALVISLGLI
>NZ_CP013044.1|WP_011264110.1|5087_6365_-|ABC-transporter-permease
MIKNAIAYITRKKNRTFIIFVILTIVFSCLYSCLSIMKSSASLEKSLYKISNSSLSITKKDGGYFDINQFKDIEKIKEVEETIFQYNGLAKPIKAKVVGGEQKIERDNLPDEFKNILSLEATNKTKRNILFNSGVFTIKDGRNIEENDRRKILVHEDFAKKNNLKLNDEISLELIEMENKGQKKEFKFEIIGIFSGKKQEKYTGLSSDFSENMVFVDYATSQEALNRAENNKIANKILIFSSSEESTNLALKKIKELKIDWSKYSIEKDTNAFEESLESVSGIKHIIKIMTYSIMLGGIVVLSLILILWLRERIYEIGILLSIGISKIKIVIQFILELIFISLPSIISTLVLGNLLLRQIVDGFIRSDNSMIVSNSLLNKSNSILNLGTLIQSYFILISIIILSVIVASSMILVKKPKEILSKIS
>NZ_CP013044.1|WP_011264109.1|4421_5078_-|ABC-transporter-ATP-binding-protein
MDILEIKNVSYSYTNSREKVLSSVNQKFELGKFYAIIGKSGTGKSTLLSLLAGLDKPQTGQVLFKNENIDKKGYSNHRKNNISLVFQNYNLIDYLSPIENIRLVNKKASESILIELGLDEKQIKRNVMKLSGGQQQRVAIARALVSKAPIILADEPTGNLDSATAGEIIDILKTLAKERNKCVIVVTHSKEVAEAADIILELSGKKLKKVSKINSEVQ
>NZ_CP013044.1|WP_011264108.1|3045_4422_-|ABC-transporter-permease
MIKNAFAYVTRKSLKSVIILLVVLAMSALSLISLSIKDATNRASEETFGNITSSFSMEINRQVNPGTPRGGGNVKGEDIKKISENKNIYSYVKRINSVADLIDHDIVETKETLANQSPERSKNFKRTVMLTGVNESSKENKFVSGAYKLIEGKHLENQDKNKVLMHKDLAKKNNLKVGDKIKVKSNLFDADNEKGANETVEVEIKGLFDGHNNGVVSAPQELYENTLITDINTAAKVYGNTEDTAAYQDATFFVKGDKNLEKVIKDIGKLDINWREYNLIKSSSNYPALQQSISGIYSIANKLFAGSLIFAGVVVSLLLFLWINARKKEIAVLLSLGISKLTIFGQFLIELIFISIPAFIGSYFLASYTGDKLGNNILNRVTGDIAKKIAKQSLSSQLGGGAEVDGFNKTLTSLDINILPKSMMYVILFMSLVLIISLIISSYSILKKNPKELLIDND
>NZ_CP013044.1|WP_004461153.1|2252_2906_-|response-regulator-transcription-factor
MKILIVEDDKIIREGISEYLSEFGYIIIEAKDGREALSKFNNDINLIILDIQIPYVNGLDVLKEIRKKSKLPILILTAFSDEEYKIDAFTNFADGYVEKPFSLPVLKARIDSLIKKNFGQIEKFEYKNIDVNFNSYTVKINGENIYIYAKELEILKYLVDNEGQVLTRMQIIDNVWKETEEIPYDRVIDVYIKELRKKLKLDCITTIRNVGYKLERK
>NZ_CP013044.1|WP_011264107.1|936_2256_-|HAMP-domain-containing-histidine-kinase
MKDLKIFPKIFIQTFSVIGIIIILMHLLIFLIFPRTYLDTRKAEIYNKANEISRNMNGKELNYIEQTLDFYSNTGEIKAFIKDVNDNNEVKIKKQVNINLESNNNSLIIEEREITINNGKKIYLQFVSTADMQKDAKNLSLKFLPYSLLISLLFSSIISLAYAKSIKNNIQEIKNVTDKMMKLDKKARLKLDSNDEVGQLKEQINDLYTTLLRTIDDLKFKNKEILKLEKLKYNFFKGASHELKTPLASLKIILENMKYNIGKYKERDIYINECIDIVDSLTKNISQILSVHSIENLNNDEEYLKINDVLEGVLKKYEVLVNQKNITINNYILDENIYIGKTALNIILSNLISNAVKYTDANGIINIGLDRDWLYIENSYGDNKVSDIDKLFEFKFDLNKENSNGLGLYIVSNLLNNYNKKFKVLQNREYFVFKIKLSS
>NZ_CP013044.1|WP_011264106.1|436_655_-|hypothetical-protein
MAREVLEQLDKKNQLLLFSSLDYDGYFINNIVDESVYVEKIVETQIMIESVRVAIYITLILMIYNHLRYTLK
>NZ_CP013044.1|WP_003482659.1|13386_14139_+|ParA-family-protein
MKKISVFNIKGGVAKTTSTANFGACLEEKGDRVLLVDLDPQSNLTKLFKAYSMEDVSIADVLLDKNLDIEKVIKKTDFENIDILPSNVTLAFAERKILLDVNRSQQNRLAKALEEIEDKYDYCLIDCPPALNMITVNALCASDEVLVPIKIDKFALDGLEYLLDSIEEIKEEFNPNLNFKGCFITMDSSTTVNNVIKQELKSVLGEKMFNTSIHQNIKVVESTFEECPVVFSSKKARASLNYKDLSKEIF
>NZ_CP013044.1|WP_162485793.1|14197_15430_+|ParB-N-terminal-domain-containing-protein
MAKKFSISEGMLNGISKNTRKVEEFKAKDNFKIDYINIDRIKRNEKNFYEIVDIESLAEDIKLNGLNHNLVVRKLDNDMYELISGERRYTALNKLINEGNKEFNLVPCKVIESNDIDSEIILIQANAQSRELTEVEKLTQVERLKELYKIKKKNGEKVPGKIRDIIANDLKLSPTQVGRYERINNKLIPELKAVIEQGNLTIANASEFSSLSEENQRVILSIIDDKTNMSKQEAVDLKNKLKKIEEEKELELKKAYEEKELELKRLEEEKKNQVSKLKSENENLKKKLDNNIEEERKEIEGQIKIEFEEKLKNEKVILEEELKSKYDKKIEDITNEVKENNLEKQRLKDELSKLKEKSNNEVDIKNTKENFVLVQNLKLIDNSFKDLKSQINKMKKKMLKLQKKLKLKSF
>NZ_CP013044.1|WP_003482664.1|16586_17561_+|choloylglycine-hydrolase-family-protein
MCTAITYTTKNNYFGRNFDYEISYNEKVVITPRNFPFKFRKVNDINQHYAFIGVATVVDDYPLYYDATNEKGLSIAGLNFEGNAYYGEEVKGKLNIAPFEFIPWILGQCSTIKEVKKLLEQINFVNINFSEKLPLSPLHWLVADKNESIVIENLKTGLKIYDNPVGVLTNNPTFDYQLFNLNNYQNLSTQTPNNLFSKNINLNSYSRGMGGLGLPGDLSSMSRFVKATFTKLNSVSGDSESESISQFFHILGSVEQQKGLCDVGGKNYEYTIYSSCCNIDRGIYYYKTYENSQITAVDMNKEDLESSTLFTYNLINNQIINYLN
>NZ_CP013044.1|WP_061416398.1|18760_20218_-|helix-turn-helix-domain-containing-protein
MFKEDLLEKSEKLQFKILKKIYLNNGRIAKYELCNTFNISPPTLKSHIEKIDFLLKDNYHNKVQITYSKNDIILKYENYINLEQLMSSCIKKSLKYKLLRYLFENSNNLSSGIKICNELNISLSTLNRKIFECNCLLKEFDINIKNYRLEGSQSQIYYFFYSLFIVTGTVSTNSNFLFNKLINFFNKKFKISFNIKQKYSLYVWTTIINNRKFFFKKEFFNNNFYKDNIKKLNNNVFFLELKTFFEKNYFNKNIGEYISFMTICFILSFDLFPIDFIFNNIEFKNNMAFKTYKLIFNQINELYISPTNNFNNTLKCNLLSICYKQYFFKGILYSNDYITTNHYLSEFSSYSRKKFVENLLLKIHNSTTNYHIDDEYFKFCVILTLNYINGNTKYPINIGVLSQSENLTLSSTINDLNNALRKKFDVIVEIYDENKKRYDLVITNFNINFKCLVNNCDNIYFFTNLGIKYDLENIIKLLDKIEEKK
>NZ_CP013044.1|WP_061416401.1|20858_23132_+|Cys-Gln-thioester-bond-forming-surface-protein
MKKFFYKLSFITLIFFSFSLLNVFANQKEYWAYTKSTSEGSAFFVDDDGEKTVYCYNHDYNQPGSSIINSSNKTYYTRTESYLNTNDELMDVYGKEKKERIAAALAYGYPVNSSDLISKCGINEDEARYITQQLIWDICSGNDGPYGYEYGKFGYYDKLLELSKIKKFEQGNLNLIGDFKFTERGGQYSTDNLSTTGSVGSFMITNLPDDMVVKDWNTGQILNDKPIKVGQEFYIESSIKPNPDLKLKINYDYQEVKFYFYKYSRGGIKGKPDKPFQSLIRAELEDKTNEKSYEISIDGNFVPNQNIGKVVLTKKDFQNGSELQGAVFNLQDQKGNNIRTDLTTDENGQISLNDLAPGDYQFVETKAPDGYELDATPVKFTIVVGQKEAIKIEKVNIATPGSVILTKKDSQSGYALKGAVFNLQDQKGNNIRTDLTTDENGQISLNDLAPGDYQFVETKAPDGYELDATPVKFTIVVGQKEAIKIEKVNIATPGSVILTKKDSQSGHALKGAVFNLQDQKGNNIRTDLTTDENGQISLNDLAPGDYQFVETKAPDGYELDTTPVKFTIVVGQKEAIKIEKVNDPNQVELKISKVDKENAKPLEGAEFEIFSINDIKNPLKFRFSNLYQKYEFNNQGDSTLKANNSDSSFTINKLGYGDYILKEIKAPNGYKLGKDIYIHLDSNNSYYKVGEDGKNINLDKNESLNLYEINVENEKGIVLPETGGNGFIFQRNVAILILVISFFLIINLLINKKRRFN
>NZ_CP013044.1|WP_061416405.1|23131_24691_+|SpaH/EbpB-family-LPXTG-anchored-major-pilin
MEKLFKKITVIVSSLAMMLTLSTPVFAANTPSIDKDAPKTGSITITKEGAGFTAYQVLKATQSGDAYDYTATDNFKGFFNNPKYGNYTENQIKDLTTTDDIKEFASQLHKYAIDNKISNGIQVDSGVKTNVDLGYYLVLETSEQSTGNAVVSTAMLVSVPQVENDKWNYNVTLNPKDNAPSIEKKIIENNKLVDTSSANIGDTIKYKVTATIPTYEKNATNIVYKIKDTMSKGLTYDSNSGIKITSRNKTFVENTDYTVKSNKISDGTTNIEIDFVYDNIKAYATDGLTLEYQATLNENALIDTKVNEGNPNNITLEYTNNPDIQNSNKTINDKVTSYTWGFGVKKVDSEDITKDLAGAEFSVRDANKNIVGKYTYNESGNVVILQGNGVTNENGVVTFTGLEEGDYFITEEKAPKGYSLLKEPVKVTITAQKDSNDDYTGQATIAVTNGNEAGSIVNNINMNDKNVLFNVQIKNYAGISLPGTGGLGTAGFTKIGLCLLGLVFVLGSGYVVLDKKKRV
>NZ_CP013044.1|WP_061416408.1|24832_25630_+|class-C-sortase
MKILKRIYLMLLILITLIAIGVLLYPSVSNYINNKYAVSTITKYEKDIENTEKEEINKLMKKAVMYNSDIARGIISKSKFENGYMLGYVDIPKINIKLPIYEGTSDEVLKKGVGVIDGTSIPIGGESTHSVLSAHTGLTTQKLFTDIDQLKEGDFFYINIFGERLAYKVDEINIVKPNDTSKINISPNKDYVTLLTCYPYGINTERLLVRGERVFQKDDNFNKAENLVNDNNSRYINKELIFIVGVLTLFLILIIIVILRRKIKN
>NZ_CP013044.1|WP_003453396.1|25864_26275_+|hypothetical-protein
MNFKSKILGATLLAAVSVGSITNVAYASDYVHQNGTVYVTNWDNYSYNSCHTRGITLKDEYGNNPTFAQNSDYDWVSNVVTVRGYGCFPFRFYPYNDRVKVYDFDTRKEIKDGYLVGGQRIYIVSKDDPTYIILNI
>NZ_CP013044.1|WP_061416410.1|26769_28026_+|4Fe-4S-cluster-binding-domain-containing-protein
MKKSMYNIYIQGKNETAIFNLLTRNIIVISNDEYLNFDKLINDEECKEELKSMGFSLENNINEIELMKCTLNKGKFSEKSMTLFLSLTRQCNLNCSYCYQDKRKMMDKENSFLNKNDWFKIFEFLKKKSVNLNELHITLFGGEPLLNKSIILQIIDDLNSLKNRNLKIYINLITNGVLLDKDFCEKIYKSINYIQITLDGNKSTHNKVKVFPDGSGSFDIIYNNLREIINLFENKIELRINVNEEIILNCFSLFKRLRKDSLNKSIAVNLHPIFENQSSFEYGCNKNTDNSLILKINDLYYYLSKNNFKFRKNFIEGPCIAKHINSFAIDENLNIYKCPGFLYSKSNGFINDIGEVNFLNSDFFKEVNSEQECIKSCLYAPICYGGCTWQNKCNKKLLDLTLKPQLKAYLISRYNFEV
>NZ_CP013044.1|WP_061416414.1|28476_29046_+|recombinase-family-protein
MLVGYARVSTEEQSLNRQIDMLIDYGVDKRNIYQEKISGMKSNREQLDKMIDELQKGDTVIITDLTRISRSTKDLLNIIDRIKAKGASIKSIKDTWLDTSSDNPYNSFLLTVMSGLSQLERDLISQRTKEGLKSAKARGRNGGRPSKRNDKADIVGLLYREGYKIVDIVKQTGLSRATVYRVLNDLKLK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP013044_1	1.1\|12148\|44\|NZ_CP013044\|CRISPRCasFinder	12148-12191	44	NZ_CP013044	Clostridium perfringens strain JP55 plasmid pJFP55J, complete sequence	12148-12191	0	1.0

1. spacer 1.1|12148|44|NZ_CP013044|CRISPRCasFinder matches to NZ_CP013044 (Clostridium perfringens strain JP55 plasmid pJFP55J, complete sequence) position: , mismatch: 0, identity: 1.0

gactgttctcagaaaaagtagtatttatgccatttttatcagca	CRISPR spacer
gactgttctcagaaaaagtagtatttatgccatttttatcagca	Protospacer
********************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP010993

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP013044

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection