CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP013261	Corynebacterium pseudotuberculosis strain MB14, complete genome	3 crisprs	cas1,cas6e,cse2gr11,cas7,cas5,DEDDh,cas3,WYL,cas4,csa3,DinG	0	8	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013261_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013261_1

22354-22567

TypeI-E

I-C,I-E,II-B

Consensus_repeat	Method
ACGGGAACTACCTCCGCATACGCGGAGAAAAGT	PILER-CR
GGAACTACCTCCGCATACGCGGAGAAAAG	CRISPRCasFinder
GGAACTACCTCCGCATACGCGGAGAAAAGT	CRT

3 spacers

cas2,cas1,cas6e,cse2gr11,cas7,cas5

The CRISPR arrays of NZ_CP013261_1

>merge|NZ_CP013261|1|22354-22567|PILER-CR,CRISPRCasFinder,CRT
GGGAACTACCTCCGCATACGCGGAGAAAAGTCAGCAACGGTGAGAATCTTTTTTTCGCGACGGGAACTACCTCCGTATACGCGGAGAAAAGTTGGTGTTCCAATAATGCTTTTGCTGCCAACTGGAACTACCTCCGCATACGCGGAGAAAAGTGCCTGATTCACTGTCAGCCCGTAAAGCTCACGGAACTACCTCCGCATACGCGGAGAAAAGA

>NZ_CP013261|1|1|22354-22506|PILER-CR
GGGAACTACCTCCGCATACGCGGAGAAAAGTCA	GCAACGGTGAGAATCTTTTTTTCGCGAC
GGGAACTACCTCCGTATACGCGGAGAAAAGTTG	GTGTTCCAATAATGCTTTTGCTGCCAAC
TGGAACTACCTCCGCATACGCGGAGAAAAGT

>NZ_CP013261|1|1|22355-22566|CRISPRCasFinder
GGAACTACCTCCGCATACGCGGAGAAAAG	TCAGCAACGGTGAGAATCTTTTTTTCGCGACG
GGAACTACCTCCGTATACGCGGAGAAAAG	TTGGTGTTCCAATAATGCTTTTGCTGCCAACT
GGAACTACCTCCGCATACGCGGAGAAAAG	TGCCTGATTCACTGTCAGCCCGTAAAGCTCAC
GGAACTACCTCCGCATACGCGGAGAAAAG

>NZ_CP013261|1|1|22355-22567|CRT
GGAACTACCTCCGCATACGCGGAGAAAAGT	CAGCAACGGTGAGAATCTTTTTTTCGCGACG
GGAACTACCTCCGTATACGCGGAGAAAAGT	TGGTGTTCCAATAATGCTTTTGCTGCCAACT
GGAACTACCTCCGCATACGCGGAGAAAAGT	GCCTGATTCACTGTCAGCCCGTAAAGCTCAC
GGAACTACCTCCGCATACGCGGAGAAAAGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013261.1\|WP_014523731.1\|18992_19763_+\|rhomboid-family-intramembrane-serine-protease	unknown	unknown	gnl\|CDD\|366759
NZ_CP013261.1\|WP_014367522.1\|22956_23910_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
NZ_CP013261.1\|WP_014366234.1\|34893_35880_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	unknown	unknown	gnl\|CDD\|182463
NZ_CP013261.1\|WP_014300357.1\|13538_14054_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|214520
NZ_CP013261.1\|WP_014523733.1\|35879_36947_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	unknown	unknown	gnl\|CDD\|182464
NZ_CP013261.1\|WP_014366217.1\|12430_13210_+\|YwiC-like-family-protein	unknown	unknown	gnl\|CDD\|379525
NZ_CP013261.1\|WP_014733049.1\|26621_27332_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	cd09727_cas6e_CAS-I-E	gnl\|CDD\|187858
NZ_CP013261.1\|WP_014366232.1\|33042_33966_+\|phospholipase-D	unknown	unknown	gnl\|CDD\|176518
NZ_CP013261.1\|WP_129559136.1\|21720_22023_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013261.1\|WP_014366220.1\|16770_17544_+\|sugar-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224053
NZ_CP013261.1\|WP_014522928.1\|30825_31518_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	gnl\|CDD\|187776
NZ_CP013261.1\|WP_014367523.1\|22584_22956_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	cas2	pfam09707_cas2_CAS-I-E	gnl\|CDD\|378244
NZ_CP013261.1\|WP_032802276.1\|29153_29747_+\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	mkCas0096_cse2gr11_CAS-I-E	gnl\|CDD\|274193
NZ_CP013261.1\|WP_032802275.1\|29746_30814_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
NZ_CP013261.1\|WP_014366222.1\|18394_18931_+\|peptidylprolyl-isomerase	unknown	unknown	gnl\|CDD\|223725
NZ_CP013261.1\|WP_014366233.1\|34018_34885_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP013261.1\|WP_014523730.1\|15683_16769_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224093
NZ_CP013261.1\|WP_014300358.1\|14685_15687_+\|sugar-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380535
NZ_CP013261.1\|WP_014366221.1\|17645_18317_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013261.1\|WP_014523732.1\|20727_20919_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP013261.1\|WP_014523731.1\|18992_19763_+\|rhomboid-family-intramembrane-serine-protease	gnl\|CDD\|366759	pfam01694, Rhomboid, Rhomboid family. This family contains integral membrane proteins that are related to Drosophila rhomboid protein. Members of this family are found in bacteria and eukaryotes. Rhomboid promotes the cleavage of the membrane-anchored TGF-alpha-like growth factor Spitz, allowing it to activate the Drosophila EGF receptor. Analysis has shown that Rhomboid-1 is an intramembrane serine protease (EC:3.4.21.105). Parasite-encoded rhomboid enzymes are also important for invasion of host cells by Toxoplasma and the malaria parasite.	5.66481e-21
NZ_CP013261.1\|WP_014366234.1\|34893_35880_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	gnl\|CDD\|182463	PRK10440, PRK10440, iron-enterobactin ABC transporter permease.	7.09769e-96
NZ_CP013261.1\|WP_014300357.1\|13538_14054_+\|hypothetical-protein	gnl\|CDD\|214520	smart00112, CA, Cadherin repeats. Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. Cadherin domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium.	0.000416352
NZ_CP013261.1\|WP_014523733.1\|35879_36947_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	gnl\|CDD\|182464	PRK10441, PRK10441, Fe(3+)-siderophore ABC transporter permease.	1.10582e-87
NZ_CP013261.1\|WP_014366217.1\|12430_13210_+\|YwiC-like-family-protein	gnl\|CDD\|379525	pfam14256, YwiC, YwiC-like protein. The YwiC-like protein family includes the B. subtilis YwiC protein, which is functionally uncharacterized. This domain family is found in bacteria, and is approximately 130 amino acids in length. There is a single completely conserved residue G that may be functionally important.	2.86564e-35
NZ_CP013261.1\|WP_014733049.1\|26621_27332_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|187858	cd09727, Cas6_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas6e. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas6e is an endoribonuclease that generates crRNA; This family is specific for CRISPR/Cas system I-E subtype; Homologous to Cas6 (RAMP superfamily protein); Possesses double RRM/ferredoxin fold; also known as Cse3 family.	1.17921e-34
NZ_CP013261.1\|WP_014366232.1\|33042_33966_+\|phospholipase-D	gnl\|CDD\|176518	cd08576, GDPD_like_SMaseD_PLD, Glycerophosphodiester phosphodiesterase-like domain of spider venom sphingomyelinases D, bacterial phospholipase D, and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase-like domain (GDPD-like) present in sphingomyelinases D (SMases D) (sphingomyelin phosphodiesterase D, EC 3.1.4.4) from spider venom, the Corynebacterium pseudotuberculosis Phospholipase D (PLD)-like protein from pathogenic bacteria, and the Ajellomyces capsulatus H143 PLD-like protein from ascomycetes. Spider SMases D and bacterial PLD proteins catalyze the Mg2+-dependent hydrolysis of sphingomyelin producing choline and ceramide 1-phosphate (C1P), which possess a number of biological functions, such as regulating cell proliferation and apoptosis, participating in inflammatory responses, and playing a key role in phagocytosis. In the presence of Mg2+, SMases D can function as lysophospholipase D and hydrolyze lysophosphatidylcholine (LPC) to choline and lysophosphatidic acid (LPA), which is a multifunctional phospholipid involved in platelet aggregation, endothelial hyperpermeability, and pro-inflammatory responses. Loxosceles spider venoms' SMases D are the principal toxins responsible for dermonecrosis and complement dependent haemolysis induced by spider venom. Due to amino acid substitutions at the entrance to the active-site pocket, some members lack activity. The typical GDPD domain consists of a TIM barrel and a small insertion domain named as the GDPD-insertion (GDPD-I) domain, which is specific for GDPD proteins. Although proteins in this family contain a non-typical GDPD domain which lacks the GDPD-I, their catalytic mechanisms are based on Mg2+-dependent acid-base reactions similar to GDPD proteins. They might be divergent members of the GDPD family. Moreover, this family does not belong to phospholipase D (PLD) superfamily, since it lacks the conserved HKD sequence motif that characterizes the catalytic center of the PLD superfamily. It belongs to the superfamily of PLC-like phosphodiesterases.	7.16899e-90
NZ_CP013261.1\|WP_014366220.1\|16770_17544_+\|sugar-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224053	COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism].	1.35107e-102
NZ_CP013261.1\|WP_014522928.1\|30825_31518_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|187776	cd09645, Cas5_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex.	6.80198e-27
NZ_CP013261.1\|WP_014367523.1\|22584_22956_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|378244	pfam09707, Cas_Cas2CT1978, CRISPR-associated protein (Cas_Cas2CT1978). This entry represents a minor branch of the Cas2 family of CRISPR-associated protein which are found in IPR003799. Cas proteins are found adjacent to a characteristic short, palindromic repeat cluster termed CRISPR, a probable mobile DNA element.	3.51848e-22
NZ_CP013261.1\|WP_032802276.1\|29153_29747_+\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|274193	TIGR02548, CRISPR_system_Cascade_subunit_CasB, CRISPR type I-E/ECOLI-associated protein CasB/Cse2. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This model family is found in Ecoli subtype CRISPR/Cas regions of many bacteria, most of which are mesophiles, and not in Archaea. It was designated Cse2 originally, and renamed CasB based on its characterization in the CASCADE complex.	5.93072e-07
NZ_CP013261.1\|WP_032802275.1\|29746_30814_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	1.30424e-81
NZ_CP013261.1\|WP_014366222.1\|18394_18931_+\|peptidylprolyl-isomerase	gnl\|CDD\|223725	COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones].	2.26866e-65
NZ_CP013261.1\|WP_014366233.1\|34018_34885_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	2.72604e-116
NZ_CP013261.1\|WP_014523730.1\|15683_16769_+\|ABC-transporter-permease	gnl\|CDD\|224093	COG1172, AraH, Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components [Carbohydrate transport and metabolism].	3.93829e-61
NZ_CP013261.1\|WP_014367522.1\|22956_23910_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	1.18457e-72
NZ_CP013261.1\|WP_014300358.1\|14685_15687_+\|sugar-ABC-transporter-substrate-binding-protein	gnl\|CDD\|380535	cd06312, PBP1_ABC_sugar_binding-like, periplasmic sugar-binding domain of uncharacterized ABC-type transport systems. Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type 1 periplasmic binding protein superfamily, which consists of two domains connected by a three-stranded hinge. The substrate specificity of this group is not known, but it is predicted to be involved in the transport of sugar-containing molecules and chemotaxis.	5.09443e-86

>NZ_CP013261.1|WP_129559136.1|21720_22023_-|hypothetical-protein
MMDFYDAITRIEATPSVSVRYGDSGVQDFELEEFLAGLVQEKAVVSDVEAKREFLSWFDEDDEWLDPDWDAPMVEQTVRDLHVFAGLEPKVEIHIPMPPA
>NZ_CP013261.1|WP_014523732.1|20727_20919_+|hypothetical-protein
MKSGTIKLTNWDVHHEKQLDKDASCVIKEEDADAASERKHSLKWSVDSEEKRRGVRNHIHQAA
>NZ_CP013261.1|WP_014523731.1|18992_19763_+|rhomboid-family-intramembrane-serine-protease
MFHENGGMSDPRILHAAYKQAPVTALLSLSTLIIFLITAFQSQSITDNLYDSWIGTHWILYTPEMHEPLGMLRAIGSMFLHIGPGHLAINIFLLFFLGREIEQCIGSALFCAAYFISGLGASLMIMIMDPLSPTAGASGAIYGLMAIMVAIAITRKTDIRAPLILVAVNVGYSLIADNVSLWGHIGGLVAGSVVALPLMAFHRKHVIAGGTGGFLVYGTPRNHHAFTKDRLITWFVVAAIVVCEAIGIWIVGMKLL
>NZ_CP013261.1|WP_014366222.1|18394_18931_+|peptidylprolyl-isomerase
MMVRMTLKTATAILHTNRGDVAIELFGNHAPKTVENFVTLADGSADYKTENASGTTEGPFYDGAVFHRIIDGFMIQGGDPTGTGRGGPGYMFADEFHPELQFDRPFLLAMANAGPGTNGSQFFITVVPTPHLNNHHTIFGEVTDPASQKVVMDIAQTATDRMDRPVEPVVIESVEITE
>NZ_CP013261.1|WP_014366221.1|17645_18317_-|hypothetical-protein
MNSSTIRGAILVTKAAYDKYANYRDRKTREAYDALLNAADSYDDIHKDVKANVTEFYDQSQERVSSLTEQARKRLDSAIADAAAAKDNTVKTVNKKSKKAQKAARKAAKSAKKSAAPKKQPSFGKRLFNFSVFTTILATIGAVAYYFLSKRDVVSTEPPHVEDFGADSVNTEESRLVYSTQTPVDDEEEHVSSPEEGATERDEKLLGSLEDQLRQHTDSKDTK
>NZ_CP013261.1|WP_014366220.1|16770_17544_+|sugar-ABC-transporter-ATP-binding-protein
MDMSTTPIIELRDITKSYGAFDALRGVNLSVASGEVTCVLGDNGAGKSTLIKILSGLHKQSSGELLIDGQPVTFSGPREALDNGIATVHQNLAVVGQMSVWRNFFLGQELTGFLGRLRESEMRSIAQEQLKTMGIDLPDIDVEVESLSGGQRQVVAIARAVYFGARVIILDEPTAALGVKQSGMVLRFVAAARDKGLGVVLITHNPHHAYLVGDRFTILNLGNQILNASRDQVTLEQLTQQMAGGGELEALSHELSR
>NZ_CP013261.1|WP_014523730.1|15683_16769_+|ABC-transporter-permease
MIIPRPTAQSAAASTADVGTATKSDDRLRRRTGFSALIRRPEFASLLGAVAIFVLFLSVAPSFRSIDALTTVLYASSTLGIVAVSVGLLMIGSEFDLSSGVAVTTAALAATMLNYNLHLNSWVGALLSLFIALAIGALNGYLVTKTGIDSFLITLAAFLMLQGLNLAITKLVTSQVATPSIADMEGFPSAQKVFAGTVHIGSVSVRATVFWWIFFVAVGSWLLFKTRFGNWIFAVGGDANAARASGVPVARVKIILFMFVGFAAWFVGMHNLFTFDSIQAGQGVGNEFLYIIAAVIGGCAMTGGRGTIIGTAIGALIFGMTNQGIVYAGWNPDWFKFFLGAMLLFAVLTNTSFATLTKGRK
>NZ_CP013261.1|WP_014300358.1|14685_15687_+|sugar-ABC-transporter-substrate-binding-protein
MKNLRFPLHAAVITLAASVVLSACSATGGAPRSSNITGGQSGGVDTPRYVVAMVTHGAPGDTFWDLIRKGAEDAAKKSNIELRYASDPEAPNQSNLIQNAIDSKVDGIAVTMPNAEAIGPTAKKAVAAKIPTVALNAGLDAYQKYDISAFFGQEEKVAGTLAGKRLAQDGAKHALCVIHEQGNSSQEARCAGLKEGLADADVEILYVNGKDMTSVQSTVQAKLAQDKSIDWVMGLVAPVALTSVDAVKNSGSSAKISTFDTNAQLVTAIKNGTVQWAVDQQPYLQGYLAIDALWLAQRNGSTVGGNRPVYTGPSFVDATNVDKIADSAKEGLR
>NZ_CP013261.1|WP_014300357.1|13538_14054_+|hypothetical-protein
MSSNKNVALRNLAVAAGATALGLGAVFGTAGAAMAADEPATPPAVNAEKPAPSIEQDTPVDVDKPETLDPDEKTPEIDDRDDVLKYEPTTVKAGHTAYAEIKGDVDEDTIFGYSQSGIPEGWFVSVDEETGKVSVSASPDAKPGDTYTVKVKVVDLDGKVTWAEAPFTVGE
>NZ_CP013261.1|WP_014366217.1|12430_13210_+|YwiC-like-family-protein
MTRVSTPRKSRRSPGWIPNQHGAWFMVTVPAIIGVALAPAWIDIPLLLLWWCGYFAFFAASVWMRGRYRKRHLPPLVTYGVVTGLSGLVVLLCQWQLVVWIPAFLPLIGIAVYETWRRRPRSLLSGLATVCAACLILPVITWAGDGLTVRVWAICGVLLLYFAGSIPYVKTLIRERGSRPWLIGSITFHIVFLIIACVAAAYQMVHVAVAVVAGILLLRAWLMPVTGARRERLWTPRQVGLLDALLGVLVVLTAVLPPA
>NZ_CP013261.1|WP_014367523.1|22584_22956_-|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MFTVIQGHNLPNHLNGYLSRFLSEVDAGLYVGVLSRAVMENLWEKCQSVDLAGSLTLIHPQYDAEQGFRIRTTGKQRRPVVDLDGLFLSARGLIEDVRFADPLDEADAIIPDEVLEDFCPESE
>NZ_CP013261.1|WP_014367522.1|22956_23910_-|type-I-E-CRISPR-associated-endonuclease-Cas1
MSYSNESLAFSTIPASEQIRLEDRVSFLYLEYCLIRQDRTGVIAVSRGDEKAPAELKDLPIKARIQLPVGGIAVLMLGPGTSISQPAATSCARAGVSVLFTGGGGVQAYSLSTPLTSSARWAIAQARLASNEAKQRTAARILYKRQLGIEEIEADSIAVMRGIEGRTIRNLYKRLSAKYKIKNFKRDTNATDPVNTNLNLGNSILYGCAASACAALGINPALGIIHRGDIRSLLFDLADLYKPTLTIPAAFKCANNDDDGSEFRRLVRSEIVKQDLLKNMIHIMMEILAPYLPERTDDRLIGGRNREVPGHTQYGGK
>NZ_CP013261.1|WP_014733049.1|26621_27332_-|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MPKATYWTHFPAHIALNKSLILGDFATENSKNKPHWDIDDPVFRHRAVMALFPEHQSDNARADSNILFRLEVLPGQEPYFFIQSSIKPSNHNLDKHIETRQVDLMSPEAGTPIEFRLSINAVRRKTIDAAKDAKRKIKTTCLPLDALSSDPTETSAGQWVKEKLSPALENIDIVRHGRQVLGANRNGKKTSTRTVQVDTIDGFAHVKDPAELQKILIHGIGRAKSYGCGMLTFRPI
>NZ_CP013261.1|WP_032802276.1|29153_29747_+|type-I-E-CRISPR-associated-protein-Cse2/CasB
MTTSRPKQSWTPLVAEFAQRKKDKEFRAKRSALRAGAGTYTEFRAYSYVLPFLGEKASAAQRTALLRCMAALAEYPDVVSSGEKATASSVGQWVNRVAFDGKQGQSEPDSMVASRIKYLHTQDLEEAISSLRRIMAFADRKNVTTKLNPYQFVELFWYWGNGFTDASTKHRLSVLRDFYSTKQKENTDPQSSSEGEK
>NZ_CP013261.1|WP_032802275.1|29746_30814_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MSRHLTIHVVASVPYSNLNRDDSGTPKNVRRGGVTCALLSSQSIKKGIRTKYEDASLDTSVRSGRIADDVLERAKVLAPEADTKALEKAVKKIIGTLTKAAEVNESEDESDRSIWLSAEELEAAAVSVVEQAEKKDFIEDGRTGSLAIAAFGRMFAAAPKKGTEAALSVSPAVTTHGVTIATDYFSTVDDIRERNRDTGATYLGVAQYTTGVFYRTVTIDKEQLRESWTGLDREDAKENLAALVNAIIYGLPRGKQRSTAPFVQPALILAEEQSYRCAYDFESPVQADAREGGYLKPTMEELKRQYDSARAFDADNFGETQVVSGTYPEVSEFFAGAKYADKNGFIDEVVAWIQR
>NZ_CP013261.1|WP_014522928.1|30825_31518_+|type-I-E-CRISPR-associated-protein-Cas5/CasD
MTTTSVYLRLAGPLQSWAGPAVTGNFVRTAPIPTHSALVGLIAGACGYRRDEWPDWLDRLSFRVRVDHPGKFVDDFQTVSAHEEEMLFRERLIFATGKRPSAKTTRLTPDGRGMTSIIQRTYLAEAEFIVEVASDTHGELLRDALRAPKFSTYLGRKAFAPAFPFFLGATADVDVLHRIPACDLSGTKRDTARVQIHHRSAGLQTSAEHINVPAVQERSDWLEKTKALFT
>NZ_CP013261.1|WP_014366232.1|33042_33966_+|phospholipase-D
MREKFALLLSIIMAIMLPVGNAAAAPVVHNPASTANRPVYAIAHRVLTTQGVDDAVAIGANALEIDFTAWGRGWWADHDGIPTSAGATAEEIFKHIADKRKQGANITFTWLDIKNPDYCRDARSVCSINALRDLARKYLEPAGVRVLYGFYKTVGGPAWKTITADLRDGEAVALSGPAQDVLNDFARSGNKILTKQKIADYGYYDINQGFGNCYGTWNRTCDQLRKSSEARDQGKLGKTFGWTIATGQDARVNDLLGKANVDGLIFGFKMTHFYRHPDTENSFKAIKRWVDKHSATHHLATVADNPW
>NZ_CP013261.1|WP_014366233.1|34018_34885_-|ABC-transporter-ATP-binding-protein
MHTPKTTSTDLPTTAGISTDHMSALRTENVTLSWDKHVVSTDLSVDIPTGKFTAIIGPNGCGKSTLLKSCARILAPDTGSIYLNQHNLTHLHTKEIAKQLAFLPQSTITPTDITVEELVRRGRFPHHNWLHQWTAEDTRAVDAALNAASVKELTHKRVTDLSGGQRQRVWLAMVLAQNTPTVLLDEPTTFLDIAHQYQLLELARSLTTQLNRTVVAVLHDLQQAVRYADHLIVMKNGSIVATGSPQEVISAELISEVFNITVRTMLIDDQLIVIPTELPVPNVAMMQG
>NZ_CP013261.1|WP_014366234.1|34893_35880_-|iron-chelate-uptake-ABC-transporter-family-permease-subunit
MTHRRSWYTALILTLLLAVSAAVAVSLPGAGITTAKVWSVFQGDDSSLAHTIVFSWRAPRIVTALFVGAALGIAGSLFQALTRNPLGSPDIIGFNTGAYTGVLLTMMAGMTSFASVAFGALAGGLATALAVMAFSVRVRIDGLRIILVGLGVSAMLSAFNRWLITRGDLNTALSAASWGAGTLNGIRWAAATPAVIALGIIVALALLLGSRIDILNLGDDTATALGLPVNPSKFVLLIVGVLLIATTTAIAGPISFIALASPHIAQRITASPRTPLLVSALTGATLLLVADIIAQRAFAPVQLPVGLVTVVIGGIYLLSLIASASRRA
>NZ_CP013261.1|WP_014523733.1|35879_36947_-|iron-chelate-uptake-ABC-transporter-family-permease-subunit
MVSTASSNPSPIRGFLRKSQPNVQRTRRSLLVVVLLLAVLLVVGSIASVMIGARLIPLPEILNALFHPDSTNVSSTIVWDRRVPRTLLAIVAGMSLGLAGTLSQTLTRNPLADTGALGINSGAAFAIVVGIALFGASSPWAFLALALLGACGAAAVVYSVGTHRSATADPVRLVLSGVALSAILSGIGEGLSLVNPQAFDRLKSWMVGSVDVGTLMPLGIAGVGLTCGIVLTIACAHGLNALALGDAMATSIGASTARIRFISFIAVVILAASATAAAGVIIFLGLMVPHVARWIVGPDLPRVLITSLLLGPLVLVVADIVGRLIVPGEFPAGVVVSFIGAPFLIAYAQSRKGDM

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP013261_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013261_2

27383-27454

TypeI-E

Consensus_repeat	Method
TTCCTCGCGTCCTGCGGGGGTAG	CRISPRCasFinder

1 spacers

cas6e,cas1,cas2,cse2gr11,cas7,cas5

The CRISPR arrays of NZ_CP013261_2

>merge|NZ_CP013261|2|27383-27454|CRISPRCasFinder
TTCCTCGCGTCCTGCGGGGGTAGTTCATGTTAGGTTTTCGGGTTGACTTTTCCTCGCGTCCTGCGGGGGTAA

>NZ_CP013261|2|2|27383-27454|CRISPRCasFinder
TTCCTCGCGTCCTGCGGGGGTAG	TTCATGTTAGGTTTTCGGGTTGACTT
TTCCTCGCGTCCTGCGGGGGTAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013261.1\|WP_013240894.1\|38176_38446_-\|cell-division-protein-CrgA	unknown	unknown	gnl\|CDD\|178907
NZ_CP013261.1\|WP_014367522.1\|22956_23910_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
NZ_CP013261.1\|WP_013240896.1\|40550_42071_-\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270916
NZ_CP013261.1\|WP_014523733.1\|35879_36947_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	unknown	unknown	gnl\|CDD\|182464
NZ_CP013261.1\|WP_014366233.1\|34018_34885_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP013261.1\|WP_014733049.1\|26621_27332_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	cd09727_cas6e_CAS-I-E	gnl\|CDD\|187858
NZ_CP013261.1\|WP_014366232.1\|33042_33966_+\|phospholipase-D	unknown	unknown	gnl\|CDD\|176518
NZ_CP013261.1\|WP_129559136.1\|21720_22023_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013261.1\|WP_014366220.1\|16770_17544_+\|sugar-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224053
NZ_CP013261.1\|WP_014522928.1\|30825_31518_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	gnl\|CDD\|187776
NZ_CP013261.1\|WP_014367523.1\|22584_22956_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	cas2	pfam09707_cas2_CAS-I-E	gnl\|CDD\|378244
NZ_CP013261.1\|WP_032802276.1\|29153_29747_+\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	mkCas0096_cse2gr11_CAS-I-E	gnl\|CDD\|274193
NZ_CP013261.1\|WP_032802275.1\|29746_30814_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
NZ_CP013261.1\|WP_014366222.1\|18394_18931_+\|peptidylprolyl-isomerase	unknown	unknown	gnl\|CDD\|223725
NZ_CP013261.1\|WP_014366234.1\|34893_35880_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	unknown	unknown	gnl\|CDD\|182463
NZ_CP013261.1\|WP_014523730.1\|15683_16769_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224093
NZ_CP013261.1\|WP_014523732.1\|20727_20919_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013261.1\|WP_014366221.1\|17645_18317_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013261.1\|WP_014523731.1\|18992_19763_+\|rhomboid-family-intramembrane-serine-protease	unknown	unknown	gnl\|CDD\|366759
NZ_CP013261.1\|WP_014522933.1\|36993_38046_+\|iron-siderophore-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238566

Protein	Function_ID	Function_description	E-value
NZ_CP013261.1\|WP_013240894.1\|38176_38446_-\|cell-division-protein-CrgA	gnl\|CDD\|178907	PRK00159, PRK00159, putative septation inhibitor protein; Reviewed.	3.68764e-45
NZ_CP013261.1\|WP_014523733.1\|35879_36947_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	gnl\|CDD\|182464	PRK10441, PRK10441, Fe(3+)-siderophore ABC transporter permease.	1.10582e-87
NZ_CP013261.1\|WP_014366233.1\|34018_34885_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	2.72604e-116
NZ_CP013261.1\|WP_014733049.1\|26621_27332_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|187858	cd09727, Cas6_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas6e. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas6e is an endoribonuclease that generates crRNA; This family is specific for CRISPR/Cas system I-E subtype; Homologous to Cas6 (RAMP superfamily protein); Possesses double RRM/ferredoxin fold; also known as Cse3 family.	1.17921e-34
NZ_CP013261.1\|WP_013240896.1\|40550_42071_-\|serine/threonine-protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	3.14297e-109
NZ_CP013261.1\|WP_014366220.1\|16770_17544_+\|sugar-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224053	COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism].	1.35107e-102
NZ_CP013261.1\|WP_014522928.1\|30825_31518_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|187776	cd09645, Cas5_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex.	6.80198e-27
NZ_CP013261.1\|WP_014523731.1\|18992_19763_+\|rhomboid-family-intramembrane-serine-protease	gnl\|CDD\|366759	pfam01694, Rhomboid, Rhomboid family. This family contains integral membrane proteins that are related to Drosophila rhomboid protein. Members of this family are found in bacteria and eukaryotes. Rhomboid promotes the cleavage of the membrane-anchored TGF-alpha-like growth factor Spitz, allowing it to activate the Drosophila EGF receptor. Analysis has shown that Rhomboid-1 is an intramembrane serine protease (EC:3.4.21.105). Parasite-encoded rhomboid enzymes are also important for invasion of host cells by Toxoplasma and the malaria parasite.	5.66481e-21
NZ_CP013261.1\|WP_032802276.1\|29153_29747_+\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|274193	TIGR02548, CRISPR_system_Cascade_subunit_CasB, CRISPR type I-E/ECOLI-associated protein CasB/Cse2. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This model family is found in Ecoli subtype CRISPR/Cas regions of many bacteria, most of which are mesophiles, and not in Archaea. It was designated Cse2 originally, and renamed CasB based on its characterization in the CASCADE complex.	5.93072e-07
NZ_CP013261.1\|WP_032802275.1\|29746_30814_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	1.30424e-81
NZ_CP013261.1\|WP_014366222.1\|18394_18931_+\|peptidylprolyl-isomerase	gnl\|CDD\|223725	COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones].	2.26866e-65
NZ_CP013261.1\|WP_014366234.1\|34893_35880_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	gnl\|CDD\|182463	PRK10440, PRK10440, iron-enterobactin ABC transporter permease.	7.09769e-96
NZ_CP013261.1\|WP_014523730.1\|15683_16769_+\|ABC-transporter-permease	gnl\|CDD\|224093	COG1172, AraH, Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components [Carbohydrate transport and metabolism].	3.93829e-61
NZ_CP013261.1\|WP_014367522.1\|22956_23910_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	1.18457e-72
NZ_CP013261.1\|WP_014367523.1\|22584_22956_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|378244	pfam09707, Cas_Cas2CT1978, CRISPR-associated protein (Cas_Cas2CT1978). This entry represents a minor branch of the Cas2 family of CRISPR-associated protein which are found in IPR003799. Cas proteins are found adjacent to a characteristic short, palindromic repeat cluster termed CRISPR, a probable mobile DNA element.	3.51848e-22
NZ_CP013261.1\|WP_014366232.1\|33042_33966_+\|phospholipase-D	gnl\|CDD\|176518	cd08576, GDPD_like_SMaseD_PLD, Glycerophosphodiester phosphodiesterase-like domain of spider venom sphingomyelinases D, bacterial phospholipase D, and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase-like domain (GDPD-like) present in sphingomyelinases D (SMases D) (sphingomyelin phosphodiesterase D, EC 3.1.4.4) from spider venom, the Corynebacterium pseudotuberculosis Phospholipase D (PLD)-like protein from pathogenic bacteria, and the Ajellomyces capsulatus H143 PLD-like protein from ascomycetes. Spider SMases D and bacterial PLD proteins catalyze the Mg2+-dependent hydrolysis of sphingomyelin producing choline and ceramide 1-phosphate (C1P), which possess a number of biological functions, such as regulating cell proliferation and apoptosis, participating in inflammatory responses, and playing a key role in phagocytosis. In the presence of Mg2+, SMases D can function as lysophospholipase D and hydrolyze lysophosphatidylcholine (LPC) to choline and lysophosphatidic acid (LPA), which is a multifunctional phospholipid involved in platelet aggregation, endothelial hyperpermeability, and pro-inflammatory responses. Loxosceles spider venoms' SMases D are the principal toxins responsible for dermonecrosis and complement dependent haemolysis induced by spider venom. Due to amino acid substitutions at the entrance to the active-site pocket, some members lack activity. The typical GDPD domain consists of a TIM barrel and a small insertion domain named as the GDPD-insertion (GDPD-I) domain, which is specific for GDPD proteins. Although proteins in this family contain a non-typical GDPD domain which lacks the GDPD-I, their catalytic mechanisms are based on Mg2+-dependent acid-base reactions similar to GDPD proteins. They might be divergent members of the GDPD family. Moreover, this family does not belong to phospholipase D (PLD) superfamily, since it lacks the conserved HKD sequence motif that characterizes the catalytic center of the PLD superfamily. It belongs to the superfamily of PLC-like phosphodiesterases.	7.16899e-90
NZ_CP013261.1\|WP_014522933.1\|36993_38046_+\|iron-siderophore-ABC-transporter-substrate-binding-protein	gnl\|CDD\|238566	cd01146, FhuD, Fe3+-siderophore binding domain FhuD. These proteins have been shown to function as initial receptors in ABC transport of Fe3+-siderophores in many eubacterial species. They belong to the TroA-like superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA-like protein is comprised of two globular subdomains connected by a long alpha helix and binds its specific ligands in the cleft between these domains.	5.68021e-81

>NZ_CP013261.1|WP_014733049.1|26621_27332_-|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MPKATYWTHFPAHIALNKSLILGDFATENSKNKPHWDIDDPVFRHRAVMALFPEHQSDNARADSNILFRLEVLPGQEPYFFIQSSIKPSNHNLDKHIETRQVDLMSPEAGTPIEFRLSINAVRRKTIDAAKDAKRKIKTTCLPLDALSSDPTETSAGQWVKEKLSPALENIDIVRHGRQVLGANRNGKKTSTRTVQVDTIDGFAHVKDPAELQKILIHGIGRAKSYGCGMLTFRPI
>NZ_CP013261.1|WP_014367522.1|22956_23910_-|type-I-E-CRISPR-associated-endonuclease-Cas1
MSYSNESLAFSTIPASEQIRLEDRVSFLYLEYCLIRQDRTGVIAVSRGDEKAPAELKDLPIKARIQLPVGGIAVLMLGPGTSISQPAATSCARAGVSVLFTGGGGVQAYSLSTPLTSSARWAIAQARLASNEAKQRTAARILYKRQLGIEEIEADSIAVMRGIEGRTIRNLYKRLSAKYKIKNFKRDTNATDPVNTNLNLGNSILYGCAASACAALGINPALGIIHRGDIRSLLFDLADLYKPTLTIPAAFKCANNDDDGSEFRRLVRSEIVKQDLLKNMIHIMMEILAPYLPERTDDRLIGGRNREVPGHTQYGGK
>NZ_CP013261.1|WP_014367523.1|22584_22956_-|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MFTVIQGHNLPNHLNGYLSRFLSEVDAGLYVGVLSRAVMENLWEKCQSVDLAGSLTLIHPQYDAEQGFRIRTTGKQRRPVVDLDGLFLSARGLIEDVRFADPLDEADAIIPDEVLEDFCPESE
>NZ_CP013261.1|WP_129559136.1|21720_22023_-|hypothetical-protein
MMDFYDAITRIEATPSVSVRYGDSGVQDFELEEFLAGLVQEKAVVSDVEAKREFLSWFDEDDEWLDPDWDAPMVEQTVRDLHVFAGLEPKVEIHIPMPPA
>NZ_CP013261.1|WP_014523732.1|20727_20919_+|hypothetical-protein
MKSGTIKLTNWDVHHEKQLDKDASCVIKEEDADAASERKHSLKWSVDSEEKRRGVRNHIHQAA
>NZ_CP013261.1|WP_014523731.1|18992_19763_+|rhomboid-family-intramembrane-serine-protease
MFHENGGMSDPRILHAAYKQAPVTALLSLSTLIIFLITAFQSQSITDNLYDSWIGTHWILYTPEMHEPLGMLRAIGSMFLHIGPGHLAINIFLLFFLGREIEQCIGSALFCAAYFISGLGASLMIMIMDPLSPTAGASGAIYGLMAIMVAIAITRKTDIRAPLILVAVNVGYSLIADNVSLWGHIGGLVAGSVVALPLMAFHRKHVIAGGTGGFLVYGTPRNHHAFTKDRLITWFVVAAIVVCEAIGIWIVGMKLL
>NZ_CP013261.1|WP_014366222.1|18394_18931_+|peptidylprolyl-isomerase
MMVRMTLKTATAILHTNRGDVAIELFGNHAPKTVENFVTLADGSADYKTENASGTTEGPFYDGAVFHRIIDGFMIQGGDPTGTGRGGPGYMFADEFHPELQFDRPFLLAMANAGPGTNGSQFFITVVPTPHLNNHHTIFGEVTDPASQKVVMDIAQTATDRMDRPVEPVVIESVEITE
>NZ_CP013261.1|WP_014366221.1|17645_18317_-|hypothetical-protein
MNSSTIRGAILVTKAAYDKYANYRDRKTREAYDALLNAADSYDDIHKDVKANVTEFYDQSQERVSSLTEQARKRLDSAIADAAAAKDNTVKTVNKKSKKAQKAARKAAKSAKKSAAPKKQPSFGKRLFNFSVFTTILATIGAVAYYFLSKRDVVSTEPPHVEDFGADSVNTEESRLVYSTQTPVDDEEEHVSSPEEGATERDEKLLGSLEDQLRQHTDSKDTK
>NZ_CP013261.1|WP_014366220.1|16770_17544_+|sugar-ABC-transporter-ATP-binding-protein
MDMSTTPIIELRDITKSYGAFDALRGVNLSVASGEVTCVLGDNGAGKSTLIKILSGLHKQSSGELLIDGQPVTFSGPREALDNGIATVHQNLAVVGQMSVWRNFFLGQELTGFLGRLRESEMRSIAQEQLKTMGIDLPDIDVEVESLSGGQRQVVAIARAVYFGARVIILDEPTAALGVKQSGMVLRFVAAARDKGLGVVLITHNPHHAYLVGDRFTILNLGNQILNASRDQVTLEQLTQQMAGGGELEALSHELSR
>NZ_CP013261.1|WP_014523730.1|15683_16769_+|ABC-transporter-permease
MIIPRPTAQSAAASTADVGTATKSDDRLRRRTGFSALIRRPEFASLLGAVAIFVLFLSVAPSFRSIDALTTVLYASSTLGIVAVSVGLLMIGSEFDLSSGVAVTTAALAATMLNYNLHLNSWVGALLSLFIALAIGALNGYLVTKTGIDSFLITLAAFLMLQGLNLAITKLVTSQVATPSIADMEGFPSAQKVFAGTVHIGSVSVRATVFWWIFFVAVGSWLLFKTRFGNWIFAVGGDANAARASGVPVARVKIILFMFVGFAAWFVGMHNLFTFDSIQAGQGVGNEFLYIIAAVIGGCAMTGGRGTIIGTAIGALIFGMTNQGIVYAGWNPDWFKFFLGAMLLFAVLTNTSFATLTKGRK
>NZ_CP013261.1|WP_032802276.1|29153_29747_+|type-I-E-CRISPR-associated-protein-Cse2/CasB
MTTSRPKQSWTPLVAEFAQRKKDKEFRAKRSALRAGAGTYTEFRAYSYVLPFLGEKASAAQRTALLRCMAALAEYPDVVSSGEKATASSVGQWVNRVAFDGKQGQSEPDSMVASRIKYLHTQDLEEAISSLRRIMAFADRKNVTTKLNPYQFVELFWYWGNGFTDASTKHRLSVLRDFYSTKQKENTDPQSSSEGEK
>NZ_CP013261.1|WP_032802275.1|29746_30814_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MSRHLTIHVVASVPYSNLNRDDSGTPKNVRRGGVTCALLSSQSIKKGIRTKYEDASLDTSVRSGRIADDVLERAKVLAPEADTKALEKAVKKIIGTLTKAAEVNESEDESDRSIWLSAEELEAAAVSVVEQAEKKDFIEDGRTGSLAIAAFGRMFAAAPKKGTEAALSVSPAVTTHGVTIATDYFSTVDDIRERNRDTGATYLGVAQYTTGVFYRTVTIDKEQLRESWTGLDREDAKENLAALVNAIIYGLPRGKQRSTAPFVQPALILAEEQSYRCAYDFESPVQADAREGGYLKPTMEELKRQYDSARAFDADNFGETQVVSGTYPEVSEFFAGAKYADKNGFIDEVVAWIQR
>NZ_CP013261.1|WP_014522928.1|30825_31518_+|type-I-E-CRISPR-associated-protein-Cas5/CasD
MTTTSVYLRLAGPLQSWAGPAVTGNFVRTAPIPTHSALVGLIAGACGYRRDEWPDWLDRLSFRVRVDHPGKFVDDFQTVSAHEEEMLFRERLIFATGKRPSAKTTRLTPDGRGMTSIIQRTYLAEAEFIVEVASDTHGELLRDALRAPKFSTYLGRKAFAPAFPFFLGATADVDVLHRIPACDLSGTKRDTARVQIHHRSAGLQTSAEHINVPAVQERSDWLEKTKALFT
>NZ_CP013261.1|WP_014366232.1|33042_33966_+|phospholipase-D
MREKFALLLSIIMAIMLPVGNAAAAPVVHNPASTANRPVYAIAHRVLTTQGVDDAVAIGANALEIDFTAWGRGWWADHDGIPTSAGATAEEIFKHIADKRKQGANITFTWLDIKNPDYCRDARSVCSINALRDLARKYLEPAGVRVLYGFYKTVGGPAWKTITADLRDGEAVALSGPAQDVLNDFARSGNKILTKQKIADYGYYDINQGFGNCYGTWNRTCDQLRKSSEARDQGKLGKTFGWTIATGQDARVNDLLGKANVDGLIFGFKMTHFYRHPDTENSFKAIKRWVDKHSATHHLATVADNPW
>NZ_CP013261.1|WP_014366233.1|34018_34885_-|ABC-transporter-ATP-binding-protein
MHTPKTTSTDLPTTAGISTDHMSALRTENVTLSWDKHVVSTDLSVDIPTGKFTAIIGPNGCGKSTLLKSCARILAPDTGSIYLNQHNLTHLHTKEIAKQLAFLPQSTITPTDITVEELVRRGRFPHHNWLHQWTAEDTRAVDAALNAASVKELTHKRVTDLSGGQRQRVWLAMVLAQNTPTVLLDEPTTFLDIAHQYQLLELARSLTTQLNRTVVAVLHDLQQAVRYADHLIVMKNGSIVATGSPQEVISAELISEVFNITVRTMLIDDQLIVIPTELPVPNVAMMQG
>NZ_CP013261.1|WP_014366234.1|34893_35880_-|iron-chelate-uptake-ABC-transporter-family-permease-subunit
MTHRRSWYTALILTLLLAVSAAVAVSLPGAGITTAKVWSVFQGDDSSLAHTIVFSWRAPRIVTALFVGAALGIAGSLFQALTRNPLGSPDIIGFNTGAYTGVLLTMMAGMTSFASVAFGALAGGLATALAVMAFSVRVRIDGLRIILVGLGVSAMLSAFNRWLITRGDLNTALSAASWGAGTLNGIRWAAATPAVIALGIIVALALLLGSRIDILNLGDDTATALGLPVNPSKFVLLIVGVLLIATTTAIAGPISFIALASPHIAQRITASPRTPLLVSALTGATLLLVADIIAQRAFAPVQLPVGLVTVVIGGIYLLSLIASASRRA
>NZ_CP013261.1|WP_014523733.1|35879_36947_-|iron-chelate-uptake-ABC-transporter-family-permease-subunit
MVSTASSNPSPIRGFLRKSQPNVQRTRRSLLVVVLLLAVLLVVGSIASVMIGARLIPLPEILNALFHPDSTNVSSTIVWDRRVPRTLLAIVAGMSLGLAGTLSQTLTRNPLADTGALGINSGAAFAIVVGIALFGASSPWAFLALALLGACGAAAVVYSVGTHRSATADPVRLVLSGVALSAILSGIGEGLSLVNPQAFDRLKSWMVGSVDVGTLMPLGIAGVGLTCGIVLTIACAHGLNALALGDAMATSIGASTARIRFISFIAVVILAASATAAAGVIIFLGLMVPHVARWIVGPDLPRVLITSLLLGPLVLVVADIVGRLIVPGEFPAGVVVSFIGAPFLIAYAQSRKGDM
>NZ_CP013261.1|WP_014522933.1|36993_38046_+|iron-siderophore-ABC-transporter-substrate-binding-protein
MKDTQSLNTWSHRIAVMLALFLSISLIFSLAACSSEEKQSKDAGQGNADVATGGAHFSTADAETAKLGSDAAPGEFPRTVKHALGETEIKEQPKRVVVLDTGELDSVLSLGITPVGMVTTKGSNPVPSYLADKVKDVKSVGTINEINVEEIAALQPDLILGSKLRADKIYAQLAEVAPTVFSIRPGFPWKENFLLIGDALGKEKEAEAKLNEYTEKVETIKASVPADTTVSLLRFMPKRIRLYGNKSLLGVILKDAGLARPENQNIDELATEISPETIDQAEGSVIFYSSYGKPDATGQDAIVNGAAWKNLNAVKNGQAHEVNDDVWFLGLGPTGAMQIVEELKELLPKK
>NZ_CP013261.1|WP_013240894.1|38176_38446_-|cell-division-protein-CrgA
MPKSKITQSSAPFASSSTSNRTPVKINSTGTPVWYKTIMFGLILAGLLWLIVNYLAGEDIAFMMSLGAWNYGIGFGLFIVGLLMTMGWR
>NZ_CP013261.1|WP_013240896.1|40550_42071_-|serine/threonine-protein-kinase
MSIDYASPDPALQALIGDDYRLQWVVGTGGMSTVWLADDTRNQREVAVKVLRPEFSDNNEFLSRFRNEALASENIISENVVQTFDYRELTDPSGRTLCFIVMEYVRGESLADMLARKGTLDEDLALDVLEQAAHGLSIIHRMGMVHRDIKPGNLLITQNGKVKITDFGIAKAAAAVPLTRTGMVVGTAQYVSPEQAQGKDVTEASDVYSLGVVGYEMLAGRRPFTGDSSVSVAIAHINQAPPALPTTVSAPARELIGIALRKDPAHRYADGNELALAVSTTRMGQRPPQPQSAQLQQIAPEPTPTASTHALGQTAQPTTVIPATGEVPQTVSVGQMTGTHTGYSAAPATIPPEEKKKSSGGVGTGLAVGVLLAALFGAGVWAASQGIFGDLLGGSDQPSSSVNPETITATVTETPTIREEPRPIQRPQVTPTISSEPSEFPDASESVVPLPPTDNPRTAPTVDLNERSQVPSTHQNTSPTPTRGNGSDPIADLLNTLNTPEQGGAP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP013261_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013261_3

1843145-1843234

Orphan

I-C,I-E,II-B

Consensus_repeat	Method
CCTTTTCTCCGCGCACGCGGAGGTAGTTC	CRISPRCasFinder

1 spacers

DinG

The CRISPR arrays of NZ_CP013261_3

>merge|NZ_CP013261|3|1843145-1843234|CRISPRCasFinder
CCTTTTCTCCGCGCACGCGGAGGTAGTTCCGGCGGCCCTTATGGTGGGCATACGTCGGGCACCTTTTCTCCGCGCACGCGGAGGTAGTTC

>NZ_CP013261|3|3|1843145-1843234|CRISPRCasFinder
CCTTTTCTCCGCGCACGCGGAGGTAGTTC	CGGCGGCCCTTATGGTGGGCATACGTCGGGCA
CCTTTTCTCCGCGCACGCGGAGGTAGTTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013261.1\|WP_050859131.1\|1834634_1835456_-\|glutamate-racemase	unknown	unknown	gnl\|CDD\|234851
NZ_CP013261.1\|WP_014367517.1\|1835602_1836421_-\|rhomboid-family-intramembrane-serine-protease	unknown	unknown	gnl\|CDD\|366759
NZ_CP013261.1\|WP_014367518.1\|1837644_1839003_+\|nicotinate-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|236426
NZ_CP013261.1\|WP_048480964.1\|1849372_1849609_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|309782
NZ_CP013261.1\|WP_129559145.1\|1849138_1849297_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|309782
NZ_CP013261.1\|WP_032802525.1\|1845321_1846161_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013261.1\|WP_032802524.1\|1844286_1844532_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013261.1\|WP_014367520.1\|1841073_1841571_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379112
NZ_CP013261.1\|WP_032802571.1\|1837138_1837438_-\|ATP-dependent-Clp-protease-adapter-ClpS	unknown	unknown	gnl\|CDD\|178809
NZ_CP013261.1\|WP_014523555.1\|1833794_1834562_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293802
NZ_CP013261.1\|WP_048480962.1\|1844004_1844244_+\|Fic-family-protein	unknown	unknown	gnl\|CDD\|376885
NZ_CP013261.1\|WP_013242516.1\|1836507_1837044_-\|DUF2017-domain-containing-protein	unknown	unknown	gnl\|CDD\|378185
NZ_CP013261.1\|WP_014523558.1\|1841567_1842851_-\|phosphoserine-phosphatase-SerB	unknown	unknown	gnl\|CDD\|319803
NZ_CP013261.1\|WP_032802570.1\|1833021_1833756_-\|ribonuclease-PH	unknown	unknown	gnl\|CDD\|178914
NZ_CP013261.1\|WP_032802521.1\|1843279_1843549_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013261.1\|WP_155719860.1\|1847439_1847733_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013261.1\|WP_014367519.1\|1839055_1841050_+\|ATP-dependent-DNA-helicase	DinG	COG1199_DinG_CAS-IV-A	gnl\|CDD\|224120
NZ_CP013261.1\|WP_048480963.1\|1846887_1847151_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|349760
NZ_CP013261.1\|WP_080562512.1\|1849046_1849199_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|309782
NZ_CP013261.1\|WP_155719859.1\|1847168_1847312_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP013261.1\|WP_050859131.1\|1834634_1835456_-\|glutamate-racemase	gnl\|CDD\|234851	PRK00865, PRK00865, glutamate racemase; Provisional.	7.43641e-133
NZ_CP013261.1\|WP_014367517.1\|1835602_1836421_-\|rhomboid-family-intramembrane-serine-protease	gnl\|CDD\|366759	pfam01694, Rhomboid, Rhomboid family. This family contains integral membrane proteins that are related to Drosophila rhomboid protein. Members of this family are found in bacteria and eukaryotes. Rhomboid promotes the cleavage of the membrane-anchored TGF-alpha-like growth factor Spitz, allowing it to activate the Drosophila EGF receptor. Analysis has shown that Rhomboid-1 is an intramembrane serine protease (EC:3.4.21.105). Parasite-encoded rhomboid enzymes are also important for invasion of host cells by Toxoplasma and the malaria parasite.	3.12334e-23
NZ_CP013261.1\|WP_014367518.1\|1837644_1839003_+\|nicotinate-phosphoribosyltransferase	gnl\|CDD\|236426	PRK09243, PRK09243, nicotinate phosphoribosyltransferase; Validated.	0
NZ_CP013261.1\|WP_080562512.1\|1849046_1849199_-\|hypothetical-protein	gnl\|CDD\|309782	pfam04796, RepA_C, Plasmid encoded RepA protein. Family of plasmid encoded proteins involved in plasmid replication. The role of RepA in the replication process is not clearly understood.	0.000159495
NZ_CP013261.1\|WP_048480964.1\|1849372_1849609_-\|hypothetical-protein	gnl\|CDD\|309782	pfam04796, RepA_C, Plasmid encoded RepA protein. Family of plasmid encoded proteins involved in plasmid replication. The role of RepA in the replication process is not clearly understood.	2.16083e-15
NZ_CP013261.1\|WP_014367520.1\|1841073_1841571_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379112	pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	1.40055e-23
NZ_CP013261.1\|WP_032802571.1\|1837138_1837438_-\|ATP-dependent-Clp-protease-adapter-ClpS	gnl\|CDD\|178809	PRK00033, clpS, ATP-dependent Clp protease adaptor protein ClpS; Reviewed.	6.42082e-37
NZ_CP013261.1\|WP_014523555.1\|1833794_1834562_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293802	cd07716, RNaseZ_short-form-like_MBL-fold, uncharacterized bacterial subgroup of Ribonuclease Z, short form; MBL-fold metallo-hydrolase domain. The tRNA maturase RNase Z (also known as tRNase Z or 3' tRNase) catalyzes the endonucleolytic removal of the 3' extension of the majority of tRNA precursors. Two forms of RNase Z exist in eukaryotes, one long (ELAC2) and one short form (ELAC1), the former may have resulted from a duplication of the shorter enzyme. Only the short form exists in bacteria. Members of this bacterial subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	3.30037e-75
NZ_CP013261.1\|WP_048480962.1\|1844004_1844244_+\|Fic-family-protein	gnl\|CDD\|376885	pfam02661, Fic, Fic/DOC family. This family consists of the Fic (filamentation induced by cAMP) protein and doc (death on curing). The Fic protein is involved in cell division and is suggested to be involved in the synthesis of PAB or folate, indicating that the Fic protein and cAMP are involved in a regulatory mechanism of cell division via folate metabolism. This family contains a central conserved motif HPFXXGNG in most members. The exact molecular function of these proteins is uncertain. P1 lysogens of Escherichia coli carry the prophage as a stable low copy number plasmid. The frequency with which viable cells cured of prophage are produced is about 10(-5) per cell per generation. A significant part of this remarkable stability can be attributed to a plasmid-encoded mechanism that causes death of cells that have lost P1. In other words, the lysogenic cells appear to be addicted to the presence of the prophage. The plasmid withdrawal response depends on a gene named doc (death on curing) that is represented by this family. Doc induces a reversible growth arrest of E. coli cells by targetting the protein synthesis machinery. Doc hosts the C-terminal domain of its antitoxin partner Phd (prevents host death) through fold complementation, a domain that is intrinsically disordered in solution but that folds into an alpha-helix on binding to Doc.This domain forms complexes with Phd antitoxins containing pfam02604.	1.8854e-12
NZ_CP013261.1\|WP_013242516.1\|1836507_1837044_-\|DUF2017-domain-containing-protein	gnl\|CDD\|378185	pfam09438, DUF2017, Domain of unknown function (DUF2017). This is an alpha-helical domain found in gene neighborhoods that contain genes encoding ubiquitin, cysteine synthases and JAB peptidases.	1.38837e-72
NZ_CP013261.1\|WP_014523558.1\|1841567_1842851_-\|phosphoserine-phosphatase-SerB	gnl\|CDD\|319803	cd07500, HAD_PSP, phosphoserine phosphatase (PSP), similar to Methanococcus Jannaschii PSP and Saccharomyces cerevisiae SER2p. This family includes Methanococcus jannaschii PSP, and Saccharomyces cerevisiae phosphoserine phosphatase SER2p, EC 3.1.3.3, which participates in a pathway whereby serine and glycine are synthesized from the glycolytic intermediate 3-phosphoglycerate; phosphoserine phosphatase catalyzes the hydrolysis of phospho-L-serine to L-serine and inorganic phosphate, the third reaction in this pathway. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	3.94316e-95
NZ_CP013261.1\|WP_032802570.1\|1833021_1833756_-\|ribonuclease-PH	gnl\|CDD\|178914	PRK00173, rph, ribonuclease PH; Reviewed.	5.09274e-164
NZ_CP013261.1\|WP_014367519.1\|1839055_1841050_+\|ATP-dependent-DNA-helicase	gnl\|CDD\|224120	COG1199, DinG, Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair].	5.49835e-153
NZ_CP013261.1\|WP_048480963.1\|1846887_1847151_-\|AAA-family-ATPase	gnl\|CDD\|349760	cd02042, ParAB_family, partition proteins ParAB family. ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in Rhizobium etli symbiotic plasmid. This operon is involved in the plasmid replication and partition.	9.60016e-11
NZ_CP013261.1\|WP_129559145.1\|1849138_1849297_-\|hypothetical-protein	gnl\|CDD\|309782	pfam04796, RepA_C, Plasmid encoded RepA protein. Family of plasmid encoded proteins involved in plasmid replication. The role of RepA in the replication process is not clearly understood.	0.000436858

>NZ_CP013261.1|WP_014523558.1|1841567_1842851_-|phosphoserine-phosphatase-SerB
MIELDQPQVTVSLRPELTPAVITISGQDRQGVSAAAFRVLAANGVQILDVEQSQFRGFLGLAVFAGVEASKVEILEVGLKETLKTYGQNVKIELQEVAQSSRPRSTHEVVILGNPVEAHDLSRVAQTLANFDANIDTIRGISDYPVTGLELKITVAKREPGAAMPLRKALAELTAELGVDIAIERAGLLRRSKRLICFDCDSTLITGEVIEMLAAHAGREKEVAEVTERAMRGELDFEESLRERVKALAGLDASVIGEVADSIELTPGGRTTIRTLKRLGYKTAVVSGGFIQVLEELAEDLGLDYVRANTLEVVDGKLTGRVIGRIVDRAAKAEFLEEFARESGIEMHQTVAVGDGANDIDMISAAGLGIAFNAKPALREIADTSVNSPFLDEVLHMLGITRADIDAADDSEGKIHRVPLPQQKNEY
>NZ_CP013261.1|WP_014367520.1|1841073_1841571_+|GNAT-family-N-acetyltransferase
MTAHVPTLSNDSVKLRPLLLSDAHDLTATCRDPLTQKYTTVPANYTFAMAEEFIKTEHDNLRWVITVPTSDRFCGQIELRSLATEHNAMNVGYMTAPWARGQGLMTSALLLAVDYAFSRSVRRIELQADSQNKASQRVAEKAGFILMDSSQDTMVYSLLADEYHS
>NZ_CP013261.1|WP_014367519.1|1839055_1841050_+|ATP-dependent-DNA-helicase
MLDATSTLCPMSDSPLALSTDELLDAAVAALGGSRRNGQVSMANAVTKALESERHLAVQAGTGTGKSLAYLVPALRHAQATDSTIIVSTATIALQRQLVERDLPRLADALEPHMSRRPTFAIMKGRANYVCMNKIAAAEEPEDALIDEEDLSWLGKHVARIYEWANETEVGDRDSLDPGVPDLAWRQVSVSAQECIGASRCPHGEECFAELARKKAHDVDVIVTNHALLAIDALSDVNVLPEHEVVIVDEAHELDGRITAVATNEIGVTALTMSSRRAGKLGAGEKDQKLIDIAKEWEDAMLAIEPGRLTSLPDSLKQQTVALRDAIWSLREHISRVPEGEAANDPERHAERMSLSNHLNDQHDSVIRVLSVFEEEDAASQEDVVWVLHDERRGVMIKVAPLSIAGLLHTRLFSENTVVLASATLNIGGNFNAMAASWGLPKGSWDSLDAGTPFNPATSGILYTPNSLPDPGRDGLSPEVLDEIYELIMAAGGRTLGLFSSRRAAQQATDAMRTRLPFDVLCQGDDTTGALVEKFSKQENTCLFGTLSLWQGVDVPGRSCSLVIIDRIPFPRPDDPLLQARKDAADADGRNGFMEVAATHAALLIAQGAGRLLRSVTDRGVVAILDRRIVTKRYGAFFIRSLPAFWRTNDPQVVRGALSRLVAR
>NZ_CP013261.1|WP_014367518.1|1837644_1839003_+|nicotinate-phosphoribosyltransferase
MSCASALSVFKAKLVCVTEFESTALLTDMYELTMLQSALADGTASRSCTFEVFSRRLPNERRYGVVAGTARVLEAIKHYRFTEEQLASLTFLDATTIDFLRSYKFQGQIDGYREGELYFPSSPILTIRGTFAECVILETLILSIMNADSAVASAAARMVTAADGRPIFEMGSRRTHEYAAVTAARAAYLAGFVGTSNLEAVHRYGIPGSGTAAHAWTLLHVNDDGTPNESAAFQSQINVLGVGTTLLVDTYDIAKGVKTAMEVAGPQLGAVRIDSGDLGVMTRKVRQELDSLGAHNTGIVVSSDLDEYAIAGLRGNPVDAFGVGTSVVTGSGAPTAGMVYKLVEVDGHPVAKRSRGKAMVGGTKRAIRTHRATGTAVEEIVFPYDHDTPQIGQLNSYELTIPLMRNGVAVDNLPTLEESRAYLAEQLITLPWEGLALSKDEPVLSTRFIGFK
>NZ_CP013261.1|WP_032802571.1|1837138_1837438_-|ATP-dependent-Clp-protease-adapter-ClpS
MSSPMATPELDEALSVDVASSENLPWMCIVWDDPVNLMSYVTYVFQTILGYSKRRAIELMMQVHTEGKAVVSSGERDKVEGDVKKLHTAGLWATMQQGG
>NZ_CP013261.1|WP_013242516.1|1836507_1837044_-|DUF2017-domain-containing-protein
MQPWKKKKGLMRGVHFACVFEPMEREVLGNLASTVSEALIHRAQSAPKDELAELTGMPSGHKEAPKDPALARLLPDFEKEGDEEFEGDNSLLRCLHETDITRAKIEHLYVLGQALGPDGGVHVDITETEAHAWVAALNDIRLYVASGEVFGEDAEQDRESLVEWLAYNQESLLNAMMG
>NZ_CP013261.1|WP_014367517.1|1835602_1836421_-|rhomboid-family-intramembrane-serine-protease
MSLRYFFTRLCFIMTNRFNPYAQSDKKTYGGVSTSGGYLPHEYGTQYLPTSDYPVNRAVQRGMKRTSLRSMGRKRLADATILALGYVVVIWAVHIVNTVFFGGTLAQELGVHPLDGSSIWHIFTSPLVHGSYMHISANTLPGLIFVFLIGLSGRRPFWEVTMITAVVGGMGTWIFGGIGTTHIGASGLIYGWLAYLVVRGIFNKSFSQVVLGMVLAFMYGGLIWGVLPGDVGVSWQAHLFGAIGGLIAGATITSDDPPALKARREQQALHRA
>NZ_CP013261.1|WP_050859131.1|1834634_1835456_-|glutamate-racemase
MYEGTIDASSPIGIFDSGVGGLTVARAIMEQLPQESVIYIGDTANSPYGSKPIAQVRELSMRIGDELVARGCKMIVIACNTATSAALRDLRERYSIPVVGVILPAVRRAVAATRNGKIGVLGTQGTIASGAYQELFAASPGVEVYAQACPSFVSFVERGITSGRQILGVAQGYTEGLQSAGVDTLVLGCTHYPLLTGVIQLAVGDNVTLISSSEECVKDVLKVLSRNDMLAEATADKSPSRSFESTGDPALFEQLAMRFLGPHVTYVEKLRQV
>NZ_CP013261.1|WP_014523555.1|1833794_1834562_-|MBL-fold-metallo-hydrolase
MKLTILGSSGSLGAPDNAASGYLIQMDNAPSILMDMGPGVLAQLERAQNPSDAHVVFSHLHADHCVDFPSLLVWRRYHPTAAAKGRNLCFGPTDTPVRLGRLSADSVDNIDDMSDTFAFTPWQNAKEELVGTVSITPYSVVHPIESFALRVEHKRSGKVVAYSGDSSYTENLIECARDADVFLCEATWGETSEGKVPNMHMSGEEAGRIARIAGAKRLILVHIPPWGNAKAALEKARSEFDGPVDISYQGMEIHI
>NZ_CP013261.1|WP_032802570.1|1833021_1833756_-|ribonuclease-PH
MTTSNFKRADGRAVDQMRTVKITRGFTTNPAGSVLVEFGNTRVMCTASAEIGVPRFKRDSGEGWLTAEYAMLPAATLDRNPRESMRGKVKGRTHEISRLIGRSLRAAVDLSELGENTINIDCDVLQADGGTRTASITGAYVALADAISHLQKQGVVPGNPLKDPVAAVSVGVIDGAVCLDLPYEEDSRADVDMNVIMQNGRFVEIQGTGEHNTFDRDELARILDFAEKGCTELVAAQKAALGIA
>NZ_CP013261.1|WP_032802521.1|1843279_1843549_+|hypothetical-protein
MAQQIRDQKILSSAVEEIFLSLSDRQTAEERAGAAMQKILDLGKPHSFLTSSFSLSTKEVSAMLKASKNSDENRFEQAETSTDDHDESH
>NZ_CP013261.1|WP_048480962.1|1844004_1844244_+|Fic-family-protein
MAKDHSRFESWQEIPELLSRVDMLIEWTDWQALSYNDKVDTLADIHAELNRIHPFREGNGRTTRIVMENLAKIHGIAVD
>NZ_CP013261.1|WP_032802524.1|1844286_1844532_+|hypothetical-protein
MQFPPLSEDSVLPLRLIWDQISAPLPNEQQDQKDFHKAQEMVKDIMGGTGIDFSLESSSQISYELNQNNQVDSFDKHSPEL
>NZ_CP013261.1|WP_032802525.1|1845321_1846161_-|hypothetical-protein
MIEPFPPLENLYKKLKDKDLVAYVDETYASPDGQSHNGFYTICAVLYESCEIKNARNDFVRIAAGNYWHSTQALQTVDGQAKFSAMVNELSRFRDPIVVTVKLNGNFQKESDQLHARSEALEKLAVTLSLAYSHRIKGLIVEKNRRQRLDNLDRTVIAKLYRLGTVPKSLQMLHCSPSSEPLLWTPDITAMAWRRAITHTDASSREFVKLGSQCHIVSIDSERTIHEIPKIPTGNALLDEIYGNSSFLESLRHREMHRLVQNENLPQVIIKEKENQKEL
>NZ_CP013261.1|WP_048480963.1|1846887_1847151_-|AAA-family-ATPase
MLGEKPKNSDLPCLFPVIPGNAHSIRRAPQSDFVLLDCPPGNAQIIDTAVAASDEVIIPVSPSGIEVDRMRDALDLTAEKPTRVLLA
>NZ_CP013261.1|WP_155719859.1|1847168_1847312_+|hypothetical-protein
MISKLEAEMSEMRGKYYEAVHYIRQLHLAYPDAVDANPVTDELEQDF
>NZ_CP013261.1|WP_155719860.1|1847439_1847733_+|hypothetical-protein
MPGLDFFCVPEGESGAEVCYVAWCASVGYVGAPCSFADVAVVGTVFDTPEFASGVFVGDGGVHWWLLLEMMAARVSRVSASIVQAAIVIVVVGRKSR
>NZ_CP013261.1|WP_080562512.1|1849046_1849199_-|hypothetical-protein
MLRPHRRYPIPIDLDILQKLGKPRAMDIYVWITMKKAALHYQNRSSLTLG
>NZ_CP013261.1|WP_129559145.1|1849138_1849297_-|hypothetical-protein
MNQPIADEWKLWLDASNPDQADLEDSYIQLTKRFFDLIADTPSPLTLISSRS
>NZ_CP013261.1|WP_048480964.1|1849372_1849609_-|hypothetical-protein
MITKSPNGLPYGKYPRLIMAYVITSAVVRSHQVEQGYLTAEEARKIPLGESMNEFFRRIGGTTRGTGGNTGTITRIRE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP013261_1	1.2\|22448\|28\|NZ_CP013261\|PILER-CR	22448-22475	28	NZ_CP019064	Rahnella sp. ERMR1:05 plasmid unnamed2, complete sequence	112232-112259	6	0.786
NZ_CP013261_1	1.8\|22507\|31\|NZ_CP013261\|CRT	22507-22537	31	NZ_CP027853	Plesiomonas shigelloides strain MS-17-188 plasmid pPS-MS-17-188-1, complete sequence	223320-223350	6	0.806
NZ_CP013261_1	1.1\|22387\|28\|NZ_CP013261\|PILER-CR	22387-22414	28	KU160495	Exiguobacterium phage vB_EauS-123, complete genome	10947-10974	7	0.75
NZ_CP013261_1	1.2\|22448\|28\|NZ_CP013261\|PILER-CR	22448-22475	28	NZ_AP019800	Vibrio rotiferianus strain AM7 plasmid pAM7, complete sequence	14661-14688	7	0.75
NZ_CP013261_1	1.2\|22448\|28\|NZ_CP013261\|PILER-CR	22448-22475	28	GQ866233	Aggregatibacter phage S1249, complete sequence	27861-27888	7	0.75
NZ_CP013261_1	1.5\|22506\|32\|NZ_CP013261\|CRISPRCasFinder	22506-22537	32	NZ_CP027853	Plesiomonas shigelloides strain MS-17-188 plasmid pPS-MS-17-188-1, complete sequence	223319-223350	7	0.781
NZ_CP013261_1	1.7\|22446\|31\|NZ_CP013261\|CRT	22446-22476	31	NZ_CP019064	Rahnella sp. ERMR1:05 plasmid unnamed2, complete sequence	112232-112262	7	0.774
NZ_CP013261_1	1.7\|22446\|31\|NZ_CP013261\|CRT	22446-22476	31	NC_048639	Pseudomonas phage ZC08, complete genome	14894-14924	8	0.742
NZ_CP013261_1	1.7\|22446\|31\|NZ_CP013261\|CRT	22446-22476	31	NC_048638	Pseudomonas phage ZC03, complete genome	14836-14866	8	0.742
NZ_CP013261_1	1.4\|22445\|32\|NZ_CP013261\|CRISPRCasFinder	22445-22476	32	NC_048639	Pseudomonas phage ZC08, complete genome	14894-14925	9	0.719
NZ_CP013261_1	1.4\|22445\|32\|NZ_CP013261\|CRISPRCasFinder	22445-22476	32	NC_048638	Pseudomonas phage ZC03, complete genome	14836-14867	9	0.719
NZ_CP013261_1	1.6\|22385\|31\|NZ_CP013261\|CRT	22385-22415	31	KU160495	Exiguobacterium phage vB_EauS-123, complete genome	10947-10977	9	0.71
NZ_CP013261_1	1.7\|22446\|31\|NZ_CP013261\|CRT	22446-22476	31	GQ866233	Aggregatibacter phage S1249, complete sequence	27861-27891	9	0.71
NZ_CP013261_1	1.3\|22384\|32\|NZ_CP013261\|CRISPRCasFinder	22384-22415	32	KU160495	Exiguobacterium phage vB_EauS-123, complete genome	10946-10977	10	0.688
NZ_CP013261_1	1.4\|22445\|32\|NZ_CP013261\|CRISPRCasFinder	22445-22476	32	GQ866233	Aggregatibacter phage S1249, complete sequence	27860-27891	10	0.688

1. spacer 1.2|22448|28|NZ_CP013261|PILER-CR matches to NZ_CP019064 (Rahnella sp. ERMR1:05 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

tggtgttccaataatgcttttgctgcca	CRISPR spacer
ttatgttccaataatgcctttgctgaag	Protospacer
* .**************.*******  .

2. spacer 1.8|22507|31|NZ_CP013261|CRT matches to NZ_CP027853 (Plesiomonas shigelloides strain MS-17-188 plasmid pPS-MS-17-188-1, complete sequence) position: , mismatch: 6, identity: 0.806

gcctgattcactgtcagcccgtaaagctcac	CRISPR spacer
ggctgatttactggcagcccgtaaagcactg	Protospacer
* ******.**** ************* *

3. spacer 1.1|22387|28|NZ_CP013261|PILER-CR matches to KU160495 (Exiguobacterium phage vB_EauS-123, complete genome) position: , mismatch: 7, identity: 0.75

cagcaacggtgagaatctttttttcgcg	CRISPR spacer
aagcaaccgtgagaatatttttttgaaa	Protospacer
 ****** ******** ******* . .

4. spacer 1.2|22448|28|NZ_CP013261|PILER-CR matches to NZ_AP019800 (Vibrio rotiferianus strain AM7 plasmid pAM7, complete sequence) position: , mismatch: 7, identity: 0.75

tggtgttccaataatgcttttgctgcca	CRISPR spacer
tctgattccaataatgctttttctgcat	Protospacer
*   .**************** ****

5. spacer 1.2|22448|28|NZ_CP013261|PILER-CR matches to GQ866233 (Aggregatibacter phage S1249, complete sequence) position: , mismatch: 7, identity: 0.75

tggtgttccaataatgcttttgctgcca	CRISPR spacer
cggtgtctcaataatgcttttgctaatt	Protospacer
.*****..****************. .

6. spacer 1.5|22506|32|NZ_CP013261|CRISPRCasFinder matches to NZ_CP027853 (Plesiomonas shigelloides strain MS-17-188 plasmid pPS-MS-17-188-1, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgattcactgtcagcccgtaaagctcac	CRISPR spacer
aggctgatttactggcagcccgtaaagcactg	Protospacer
 * ******.**** ************* *

7. spacer 1.7|22446|31|NZ_CP013261|CRT matches to NZ_CP019064 (Rahnella sp. ERMR1:05 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

tggtgttccaataatgcttttgctgccaact	CRISPR spacer
ttatgttccaataatgcctttgctgaagatt	Protospacer
* .**************.*******  .*.*

8. spacer 1.7|22446|31|NZ_CP013261|CRT matches to NC_048639 (Pseudomonas phage ZC08, complete genome) position: , mismatch: 8, identity: 0.742

tggtgttccaataatgcttttgctgccaact	CRISPR spacer
aagaactccaataatgactttgctgccaacc	Protospacer
 .* ..********** .************.

9. spacer 1.7|22446|31|NZ_CP013261|CRT matches to NC_048638 (Pseudomonas phage ZC03, complete genome) position: , mismatch: 8, identity: 0.742

tggtgttccaataatgcttttgctgccaact	CRISPR spacer
aagaactccaataatgactttgctgccaacc	Protospacer
 .* ..********** .************.

10. spacer 1.4|22445|32|NZ_CP013261|CRISPRCasFinder matches to NC_048639 (Pseudomonas phage ZC08, complete genome) position: , mismatch: 9, identity: 0.719

ttggtgttccaataatgcttttgctgccaact	CRISPR spacer
gaagaactccaataatgactttgctgccaacc	Protospacer
  .* ..********** .************.

11. spacer 1.4|22445|32|NZ_CP013261|CRISPRCasFinder matches to NC_048638 (Pseudomonas phage ZC03, complete genome) position: , mismatch: 9, identity: 0.719

ttggtgttccaataatgcttttgctgccaact	CRISPR spacer
gaagaactccaataatgactttgctgccaacc	Protospacer
  .* ..********** .************.

12. spacer 1.6|22385|31|NZ_CP013261|CRT matches to KU160495 (Exiguobacterium phage vB_EauS-123, complete genome) position: , mismatch: 9, identity: 0.71

cagcaacggtgagaatctttttttcgcgacg	CRISPR spacer
aagcaaccgtgagaatatttttttgaaaatc	Protospacer
 ****** ******** ******* . .*.

13. spacer 1.7|22446|31|NZ_CP013261|CRT matches to GQ866233 (Aggregatibacter phage S1249, complete sequence) position: , mismatch: 9, identity: 0.71

tggtgttccaataatgcttttgctgccaact	CRISPR spacer
cggtgtctcaataatgcttttgctaattccg	Protospacer
.*****..****************. .  *

14. spacer 1.3|22384|32|NZ_CP013261|CRISPRCasFinder matches to KU160495 (Exiguobacterium phage vB_EauS-123, complete genome) position: , mismatch: 10, identity: 0.688

tcagcaacggtgagaatctttttttcgcgacg	CRISPR spacer
aaagcaaccgtgagaatatttttttgaaaatc	Protospacer
  ****** ******** ******* . .*.

15. spacer 1.4|22445|32|NZ_CP013261|CRISPRCasFinder matches to GQ866233 (Aggregatibacter phage S1249, complete sequence) position: , mismatch: 10, identity: 0.688

ttggtgttccaataatgcttttgctgccaact	CRISPR spacer
acggtgtctcaataatgcttttgctaattccg	Protospacer
 .*****..****************. .  *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1758722 : 1836421

Agrobacterium_phage(16.67%)

integrase,bacteriocin,protease

attL 1805590:1805617|attR 1811502:1811529

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014367461.1\|1758722_1760009_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.8e-132	58.4
WP_014523534.1\|1760169_1762974_-	aminodeoxychorismate synthase component I	A0A0B5J984	Pandoravirus	2.8e-82	34.5
WP_013242459.1\|1763050_1763680_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	1.4e-37	43.5
WP_013242460.1\|1763695_1764295_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	1.3e-42	48.3
WP_014524025.1\|1764506_1765859_-	trigger factor	NA	NA	NA	NA
WP_014300878.1\|1766648_1766891_+	hypothetical protein	A0A1W6JRB8	Corynebacterium_phage	3.9e-09	48.4
WP_014523535.1\|1767027_1767804_+	hypothetical protein	NA	NA	NA	NA
WP_014367466.1\|1767890_1768901_-	pirin family protein	NA	NA	NA	NA
WP_013242465.1\|1769018_1769492_-	ribose-5-phosphate isomerase	NA	NA	NA	NA
WP_014367467.1\|1769558_1770179_-	DSBA oxidoreductase	NA	NA	NA	NA
WP_014367469.1\|1770512_1773128_+	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	5.9e-42	29.7
WP_061406475.1\|1773264_1773540_+	hypothetical protein	NA	NA	NA	NA
WP_014523536.1\|1773550_1774129_+	mechanosensitive ion channel	NA	NA	NA	NA
WP_014367472.1\|1774247_1774640_+	globin	NA	NA	NA	NA
WP_013242473.1\|1775550_1776159_-	hypothetical protein	NA	NA	NA	NA
WP_013242474.1\|1776164_1776593_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_014522869.1\|1776800_1778471_-	energy-dependent translational throttle protein EttA	A0A2K9L0W2	Tupanvirus	1.3e-47	27.9
WP_014367473.1\|1778660_1779221_-	single-stranded DNA-binding protein	NA	NA	NA	NA
WP_014367476.1\|1779749_1781504_+	hypothetical protein	NA	NA	NA	NA
WP_014367477.1\|1781500_1783039_+	YcaO-like family protein	NA	NA	NA	NA
WP_014523541.1\|1783065_1784544_+	nitroreductase	NA	NA	NA	NA
WP_014367479.1\|1784540_1787144_+	lantibiotic dehydratase	NA	NA	NA	NA
WP_014367480.1\|1787143_1788157_+	hypothetical protein	NA	NA	NA	NA
WP_014367481.1\|1788153_1789134_+	hypothetical protein	NA	NA	NA	NA
WP_014367482.1\|1789172_1789343_+\|bacteriocin	thiazolylpeptide-type bacteriocin	NA	NA	NA	NA
WP_014733038.1\|1789416_1790868_+	YcaO-like family protein	NA	NA	NA	NA
WP_014367484.1\|1790889_1791648_-	permease	NA	NA	NA	NA
WP_014367485.1\|1791644_1792568_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	4.2e-19	26.1
WP_014367486.1\|1792658_1794704_-	bifunctional copper resistance protein CopD/cytochrome c oxidase assembly protein	NA	NA	NA	NA
WP_014367488.1\|1795296_1797582_+	carbon starvation protein A	NA	NA	NA	NA
WP_014367489.1\|1797601_1797802_+	YbdD/YjiX family protein	NA	NA	NA	NA
WP_014367490.1\|1798142_1799969_-	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	6.8e-29	31.8
WP_014733040.1\|1800244_1801240_+	oxidoreductase	NA	NA	NA	NA
WP_014523547.1\|1801366_1802170_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_014523548.1\|1802235_1802895_+	oligoribonuclease	M4M9I5	Vibrio_phage	8.4e-22	35.0
WP_014367495.1\|1803074_1803902_+	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
WP_014523549.1\|1803955_1805146_-	L,D-transpeptidase	NA	NA	NA	NA
1805590:1805617	attL	NA	NA	NA	NA
WP_050494099.1\|1805764_1806442_+	hypothetical protein	A0A1X9SFC1	Mycobacterium_phage	5.1e-22	34.0
WP_080713377.1\|1806384_1806897_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_032802512.1\|1807348_1808353_-	AAA family ATPase	NA	NA	NA	NA
WP_050494101.1\|1808349_1809159_-	hypothetical protein	NA	NA	NA	NA
WP_014367498.1\|1810240_1810798_+	recombinase family protein	M9Q1K0	Clostridium_phage	4.0e-33	46.2
WP_014367502.1\|1811841_1812840_+	NADP-dependent oxidoreductase	NA	NA	NA	NA
1811502:1811529	attR	NA	NA	NA	NA
WP_013242498.1\|1814070_1814346_-	DUF3618 domain-containing protein	NA	NA	NA	NA
WP_013242499.1\|1814434_1814914_+	thioredoxin-dependent thiol peroxidase	NA	NA	NA	NA
WP_013242500.1\|1814951_1815605_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_013242501.1\|1815617_1816007_-	holo-ACP synthase	NA	NA	NA	NA
WP_014367505.1\|1816137_1825236_-	type I polyketide synthase	NA	NA	NA	NA
WP_014523551.1\|1825460_1825766_-	hypothetical protein	NA	NA	NA	NA
WP_014655722.1\|1825926_1827042_+	two-component sensor histidine kinase	NA	NA	NA	NA
WP_014367508.1\|1827038_1827665_+	response regulator transcription factor	NA	NA	NA	NA
WP_014367509.1\|1827708_1828740_+	DUF418 domain-containing protein	NA	NA	NA	NA
WP_014524035.1\|1828922_1829681_-	hypothetical protein	NA	NA	NA	NA
WP_014367512.1\|1831439_1831886_+	hypothetical protein	NA	NA	NA	NA
WP_014367513.1\|1831973_1832333_+	DUF3817 domain-containing protein	NA	NA	NA	NA
WP_014367514.1\|1832401_1833025_-	RdgB/HAM1 family non-canonical purine NTP pyrophosphatase	NA	NA	NA	NA
WP_032802570.1\|1833021_1833756_-	ribonuclease PH	NA	NA	NA	NA
WP_014523555.1\|1833794_1834562_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_050859131.1\|1834634_1835456_-	glutamate racemase	NA	NA	NA	NA
WP_014367517.1\|1835602_1836421_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA

DBSCAN-SWA_2

1985385 : 1993846

Pandoravirus(33.33%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014367621.1\|1985385_1987134_+\|holin	choline dehydrogenase	A0A1V0SI18	Klosneuvirus	4.9e-61	31.5
WP_014367622.1\|1987111_1987780_-	hypothetical protein	NA	NA	NA	NA
WP_014367623.1\|1987787_1988174_-	hypothetical protein	NA	NA	NA	NA
WP_014367624.1\|1988170_1988686_-	hypothetical protein	NA	NA	NA	NA
WP_013242641.1\|1988696_1989143_-	DUF3180 domain-containing protein	NA	NA	NA	NA
WP_014367625.1\|1989139_1989595_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	S4W084	Pandoravirus	1.1e-09	33.8
WP_014655799.1\|1989596_1989938_-	dihydroneopterin aldolase	NA	NA	NA	NA
WP_014523608.1\|1989924_1990707_-	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	6.5e-21	32.2
WP_014367628.1\|1990708_1991272_-	GTP cyclohydrolase I FolE	A0A1W7AF02	Streptococcus_virus	2.6e-48	57.8
WP_088428658.1\|1991264_1993220_-	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	E5EQU5	Bathycoccus_sp._RCC1105_virus	7.6e-111	50.3
WP_014300955.1\|1993264_1993846_-	hypoxanthine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	3.0e-15	31.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP013261

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection