CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP013263	Corynebacterium pseudotuberculosis strain MB66, complete genome	2 crisprs	cas1,cas8e,cse2gr11,cas7,cas5,DEDDh,csa3,DinG,cas3,cas4,WYL	0	8	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013263_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013263_1

22354-22567

TypeI-E

I-C,I-E,II-B

Consensus_repeat	Method
ACGGGAACTACCTCCGCATACGCGGAGAAAAGT	PILER-CR
GGAACTACCTCCGCATACGCGGAGAAAAG	CRISPRCasFinder
GGAACTACCTCCGCATACGCGGAGAAAAGT	CRT

3 spacers

cas2,cas1,cas8e,cse2gr11,cas7,cas5

The CRISPR arrays of NZ_CP013263_1

>merge|NZ_CP013263|1|22354-22567|PILER-CR,CRISPRCasFinder,CRT
GGGAACTACCTCCGCATACGCGGAGAAAAGTCAGCAACGGTGAGAATCTTTTTTTCGCGACGGGAACTACCTCCGTATACGCGGAGAAAAGTTGGTGTTCCAATAATGCTTTTGCTGCCAACTGGAACTACCTCCGCATACGCGGAGAAAAGTGCCTGATTCACTGTCAGCCCGTAAAGCTCACGGAACTACCTCCGCATACGCGGAGAAAAGA

>NZ_CP013263|1|1|22354-22506|PILER-CR
GGGAACTACCTCCGCATACGCGGAGAAAAGTCA	GCAACGGTGAGAATCTTTTTTTCGCGAC
GGGAACTACCTCCGTATACGCGGAGAAAAGTTG	GTGTTCCAATAATGCTTTTGCTGCCAAC
TGGAACTACCTCCGCATACGCGGAGAAAAGT

>NZ_CP013263|1|1|22355-22566|CRISPRCasFinder
GGAACTACCTCCGCATACGCGGAGAAAAG	TCAGCAACGGTGAGAATCTTTTTTTCGCGACG
GGAACTACCTCCGTATACGCGGAGAAAAG	TTGGTGTTCCAATAATGCTTTTGCTGCCAACT
GGAACTACCTCCGCATACGCGGAGAAAAG	TGCCTGATTCACTGTCAGCCCGTAAAGCTCAC
GGAACTACCTCCGCATACGCGGAGAAAAG

>NZ_CP013263|1|1|22355-22567|CRT
GGAACTACCTCCGCATACGCGGAGAAAAGT	CAGCAACGGTGAGAATCTTTTTTTCGCGACG
GGAACTACCTCCGTATACGCGGAGAAAAGT	TGGTGTTCCAATAATGCTTTTGCTGCCAACT
GGAACTACCTCCGCATACGCGGAGAAAAGT	GCCTGATTCACTGTCAGCCCGTAAAGCTCAC
GGAACTACCTCCGCATACGCGGAGAAAAGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013263.1\|WP_014366232.1\|33040_33964_+\|phospholipase-D	unknown	unknown	gnl\|CDD\|176518
NZ_CP013263.1\|WP_129559136.1\|21720_22023_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013263.1\|WP_014523731.1\|18992_19763_+\|rhomboid-family-intramembrane-serine-protease	unknown	unknown	gnl\|CDD\|366759
NZ_CP013263.1\|WP_014523732.1\|20727_20919_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013263.1\|WP_014523730.1\|15683_16769_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224093
NZ_CP013263.1\|WP_032802277.1\|27543_29157_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cls000721_cas8e_CAS-I-E	gnl\|CDD\|378189
NZ_CP013263.1\|WP_014367522.1\|22956_23910_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
NZ_CP013263.1\|WP_014366233.1\|34016_34883_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP013263.1\|WP_014366217.1\|12431_13211_+\|YwiC-like-family-protein	unknown	unknown	gnl\|CDD\|379525
NZ_CP013263.1\|WP_014300357.1\|13538_14054_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|214520
NZ_CP013263.1\|WP_014523733.1\|35876_36944_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	unknown	unknown	gnl\|CDD\|182464
NZ_CP013263.1\|WP_014366220.1\|16770_17544_+\|sugar-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224053
NZ_CP013263.1\|WP_032802276.1\|29153_29747_+\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	mkCas0096_cse2gr11_CAS-I-E	gnl\|CDD\|274193
NZ_CP013263.1\|WP_014300358.1\|14685_15687_+\|sugar-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380535
NZ_CP013263.1\|WP_032802275.1\|29746_30814_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
NZ_CP013263.1\|WP_014522929.1\|31592_32633_-\|transposase	unknown	unknown	gnl\|CDD\|226202
NZ_CP013263.1\|WP_014367523.1\|22584_22956_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	cas2	pfam09707_cas2_CAS-I-E	gnl\|CDD\|378244
NZ_CP013263.1\|WP_014366222.1\|18394_18931_+\|peptidylprolyl-isomerase	unknown	unknown	gnl\|CDD\|223725
NZ_CP013263.1\|WP_014522928.1\|30825_31518_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	gnl\|CDD\|187776
NZ_CP013263.1\|WP_014366221.1\|17645_18317_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP013263.1\|WP_014366232.1\|33040_33964_+\|phospholipase-D	gnl\|CDD\|176518	cd08576, GDPD_like_SMaseD_PLD, Glycerophosphodiester phosphodiesterase-like domain of spider venom sphingomyelinases D, bacterial phospholipase D, and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase-like domain (GDPD-like) present in sphingomyelinases D (SMases D) (sphingomyelin phosphodiesterase D, EC 3.1.4.4) from spider venom, the Corynebacterium pseudotuberculosis Phospholipase D (PLD)-like protein from pathogenic bacteria, and the Ajellomyces capsulatus H143 PLD-like protein from ascomycetes. Spider SMases D and bacterial PLD proteins catalyze the Mg2+-dependent hydrolysis of sphingomyelin producing choline and ceramide 1-phosphate (C1P), which possess a number of biological functions, such as regulating cell proliferation and apoptosis, participating in inflammatory responses, and playing a key role in phagocytosis. In the presence of Mg2+, SMases D can function as lysophospholipase D and hydrolyze lysophosphatidylcholine (LPC) to choline and lysophosphatidic acid (LPA), which is a multifunctional phospholipid involved in platelet aggregation, endothelial hyperpermeability, and pro-inflammatory responses. Loxosceles spider venoms' SMases D are the principal toxins responsible for dermonecrosis and complement dependent haemolysis induced by spider venom. Due to amino acid substitutions at the entrance to the active-site pocket, some members lack activity. The typical GDPD domain consists of a TIM barrel and a small insertion domain named as the GDPD-insertion (GDPD-I) domain, which is specific for GDPD proteins. Although proteins in this family contain a non-typical GDPD domain which lacks the GDPD-I, their catalytic mechanisms are based on Mg2+-dependent acid-base reactions similar to GDPD proteins. They might be divergent members of the GDPD family. Moreover, this family does not belong to phospholipase D (PLD) superfamily, since it lacks the conserved HKD sequence motif that characterizes the catalytic center of the PLD superfamily. It belongs to the superfamily of PLC-like phosphodiesterases.	7.16899e-90
NZ_CP013263.1\|WP_014366222.1\|18394_18931_+\|peptidylprolyl-isomerase	gnl\|CDD\|223725	COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones].	2.26866e-65
NZ_CP013263.1\|WP_014523731.1\|18992_19763_+\|rhomboid-family-intramembrane-serine-protease	gnl\|CDD\|366759	pfam01694, Rhomboid, Rhomboid family. This family contains integral membrane proteins that are related to Drosophila rhomboid protein. Members of this family are found in bacteria and eukaryotes. Rhomboid promotes the cleavage of the membrane-anchored TGF-alpha-like growth factor Spitz, allowing it to activate the Drosophila EGF receptor. Analysis has shown that Rhomboid-1 is an intramembrane serine protease (EC:3.4.21.105). Parasite-encoded rhomboid enzymes are also important for invasion of host cells by Toxoplasma and the malaria parasite.	5.66481e-21
NZ_CP013263.1\|WP_014523730.1\|15683_16769_+\|ABC-transporter-permease	gnl\|CDD\|224093	COG1172, AraH, Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components [Carbohydrate transport and metabolism].	3.93829e-61
NZ_CP013263.1\|WP_014367522.1\|22956_23910_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	1.18457e-72
NZ_CP013263.1\|WP_014366233.1\|34016_34883_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	2.72604e-116
NZ_CP013263.1\|WP_032802277.1\|27543_29157_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	0.00762068
NZ_CP013263.1\|WP_014300357.1\|13538_14054_+\|hypothetical-protein	gnl\|CDD\|214520	smart00112, CA, Cadherin repeats. Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. Cadherin domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium.	0.000416352
NZ_CP013263.1\|WP_014523733.1\|35876_36944_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	gnl\|CDD\|182464	PRK10441, PRK10441, Fe(3+)-siderophore ABC transporter permease.	1.10582e-87
NZ_CP013263.1\|WP_014366220.1\|16770_17544_+\|sugar-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224053	COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism].	1.35107e-102
NZ_CP013263.1\|WP_014522929.1\|31592_32633_-\|transposase	gnl\|CDD\|226202	COG3677, COG3677, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	0.00655325
NZ_CP013263.1\|WP_032802276.1\|29153_29747_+\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|274193	TIGR02548, CRISPR_system_Cascade_subunit_CasB, CRISPR type I-E/ECOLI-associated protein CasB/Cse2. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This model family is found in Ecoli subtype CRISPR/Cas regions of many bacteria, most of which are mesophiles, and not in Archaea. It was designated Cse2 originally, and renamed CasB based on its characterization in the CASCADE complex.	5.93072e-07
NZ_CP013263.1\|WP_032802275.1\|29746_30814_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	1.30424e-81
NZ_CP013263.1\|WP_014300358.1\|14685_15687_+\|sugar-ABC-transporter-substrate-binding-protein	gnl\|CDD\|380535	cd06312, PBP1_ABC_sugar_binding-like, periplasmic sugar-binding domain of uncharacterized ABC-type transport systems. Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type 1 periplasmic binding protein superfamily, which consists of two domains connected by a three-stranded hinge. The substrate specificity of this group is not known, but it is predicted to be involved in the transport of sugar-containing molecules and chemotaxis.	5.09443e-86
NZ_CP013263.1\|WP_014366217.1\|12431_13211_+\|YwiC-like-family-protein	gnl\|CDD\|379525	pfam14256, YwiC, YwiC-like protein. The YwiC-like protein family includes the B. subtilis YwiC protein, which is functionally uncharacterized. This domain family is found in bacteria, and is approximately 130 amino acids in length. There is a single completely conserved residue G that may be functionally important.	2.86564e-35
NZ_CP013263.1\|WP_014522928.1\|30825_31518_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|187776	cd09645, Cas5_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex.	6.80198e-27
NZ_CP013263.1\|WP_014367523.1\|22584_22956_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|378244	pfam09707, Cas_Cas2CT1978, CRISPR-associated protein (Cas_Cas2CT1978). This entry represents a minor branch of the Cas2 family of CRISPR-associated protein which are found in IPR003799. Cas proteins are found adjacent to a characteristic short, palindromic repeat cluster termed CRISPR, a probable mobile DNA element.	3.51848e-22

>NZ_CP013263.1|WP_129559136.1|21720_22023_-|hypothetical-protein
MMDFYDAITRIEATPSVSVRYGDSGVQDFELEEFLAGLVQEKAVVSDVEAKREFLSWFDEDDEWLDPDWDAPMVEQTVRDLHVFAGLEPKVEIHIPMPPA
>NZ_CP013263.1|WP_014523732.1|20727_20919_+|hypothetical-protein
MKSGTIKLTNWDVHHEKQLDKDASCVIKEEDADAASERKHSLKWSVDSEEKRRGVRNHIHQAA
>NZ_CP013263.1|WP_014523731.1|18992_19763_+|rhomboid-family-intramembrane-serine-protease
MFHENGGMSDPRILHAAYKQAPVTALLSLSTLIIFLITAFQSQSITDNLYDSWIGTHWILYTPEMHEPLGMLRAIGSMFLHIGPGHLAINIFLLFFLGREIEQCIGSALFCAAYFISGLGASLMIMIMDPLSPTAGASGAIYGLMAIMVAIAITRKTDIRAPLILVAVNVGYSLIADNVSLWGHIGGLVAGSVVALPLMAFHRKHVIAGGTGGFLVYGTPRNHHAFTKDRLITWFVVAAIVVCEAIGIWIVGMKLL
>NZ_CP013263.1|WP_014366222.1|18394_18931_+|peptidylprolyl-isomerase
MMVRMTLKTATAILHTNRGDVAIELFGNHAPKTVENFVTLADGSADYKTENASGTTEGPFYDGAVFHRIIDGFMIQGGDPTGTGRGGPGYMFADEFHPELQFDRPFLLAMANAGPGTNGSQFFITVVPTPHLNNHHTIFGEVTDPASQKVVMDIAQTATDRMDRPVEPVVIESVEITE
>NZ_CP013263.1|WP_014366221.1|17645_18317_-|hypothetical-protein
MNSSTIRGAILVTKAAYDKYANYRDRKTREAYDALLNAADSYDDIHKDVKANVTEFYDQSQERVSSLTEQARKRLDSAIADAAAAKDNTVKTVNKKSKKAQKAARKAAKSAKKSAAPKKQPSFGKRLFNFSVFTTILATIGAVAYYFLSKRDVVSTEPPHVEDFGADSVNTEESRLVYSTQTPVDDEEEHVSSPEEGATERDEKLLGSLEDQLRQHTDSKDTK
>NZ_CP013263.1|WP_014366220.1|16770_17544_+|sugar-ABC-transporter-ATP-binding-protein
MDMSTTPIIELRDITKSYGAFDALRGVNLSVASGEVTCVLGDNGAGKSTLIKILSGLHKQSSGELLIDGQPVTFSGPREALDNGIATVHQNLAVVGQMSVWRNFFLGQELTGFLGRLRESEMRSIAQEQLKTMGIDLPDIDVEVESLSGGQRQVVAIARAVYFGARVIILDEPTAALGVKQSGMVLRFVAAARDKGLGVVLITHNPHHAYLVGDRFTILNLGNQILNASRDQVTLEQLTQQMAGGGELEALSHELSR
>NZ_CP013263.1|WP_014523730.1|15683_16769_+|ABC-transporter-permease
MIIPRPTAQSAAASTADVGTATKSDDRLRRRTGFSALIRRPEFASLLGAVAIFVLFLSVAPSFRSIDALTTVLYASSTLGIVAVSVGLLMIGSEFDLSSGVAVTTAALAATMLNYNLHLNSWVGALLSLFIALAIGALNGYLVTKTGIDSFLITLAAFLMLQGLNLAITKLVTSQVATPSIADMEGFPSAQKVFAGTVHIGSVSVRATVFWWIFFVAVGSWLLFKTRFGNWIFAVGGDANAARASGVPVARVKIILFMFVGFAAWFVGMHNLFTFDSIQAGQGVGNEFLYIIAAVIGGCAMTGGRGTIIGTAIGALIFGMTNQGIVYAGWNPDWFKFFLGAMLLFAVLTNTSFATLTKGRK
>NZ_CP013263.1|WP_014300358.1|14685_15687_+|sugar-ABC-transporter-substrate-binding-protein
MKNLRFPLHAAVITLAASVVLSACSATGGAPRSSNITGGQSGGVDTPRYVVAMVTHGAPGDTFWDLIRKGAEDAAKKSNIELRYASDPEAPNQSNLIQNAIDSKVDGIAVTMPNAEAIGPTAKKAVAAKIPTVALNAGLDAYQKYDISAFFGQEEKVAGTLAGKRLAQDGAKHALCVIHEQGNSSQEARCAGLKEGLADADVEILYVNGKDMTSVQSTVQAKLAQDKSIDWVMGLVAPVALTSVDAVKNSGSSAKISTFDTNAQLVTAIKNGTVQWAVDQQPYLQGYLAIDALWLAQRNGSTVGGNRPVYTGPSFVDATNVDKIADSAKEGLR
>NZ_CP013263.1|WP_014300357.1|13538_14054_+|hypothetical-protein
MSSNKNVALRNLAVAAGATALGLGAVFGTAGAAMAADEPATPPAVNAEKPAPSIEQDTPVDVDKPETLDPDEKTPEIDDRDDVLKYEPTTVKAGHTAYAEIKGDVDEDTIFGYSQSGIPEGWFVSVDEETGKVSVSASPDAKPGDTYTVKVKVVDLDGKVTWAEAPFTVGE
>NZ_CP013263.1|WP_014366217.1|12431_13211_+|YwiC-like-family-protein
MTRVSTPRKSRRSPGWIPNQHGAWFMVTVPAIIGVALAPAWIDIPLLLLWWCGYFAFFAASVWMRGRYRKRHLPPLVTYGVVTGLSGLVVLLCQWQLVVWIPAFLPLIGIAVYETWRRRPRSLLSGLATVCAACLILPVITWAGDGLTVRVWAICGVLLLYFAGSIPYVKTLIRERGSRPWLIGSITFHIVFLIIACVAAAYQMVHVAVAVVAGILLLRAWLMPVTGARRERLWTPRQVGLLDALLGVLVVLTAVLPPA
>NZ_CP013263.1|WP_014367523.1|22584_22956_-|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MFTVIQGHNLPNHLNGYLSRFLSEVDAGLYVGVLSRAVMENLWEKCQSVDLAGSLTLIHPQYDAEQGFRIRTTGKQRRPVVDLDGLFLSARGLIEDVRFADPLDEADAIIPDEVLEDFCPESE
>NZ_CP013263.1|WP_014367522.1|22956_23910_-|type-I-E-CRISPR-associated-endonuclease-Cas1
MSYSNESLAFSTIPASEQIRLEDRVSFLYLEYCLIRQDRTGVIAVSRGDEKAPAELKDLPIKARIQLPVGGIAVLMLGPGTSISQPAATSCARAGVSVLFTGGGGVQAYSLSTPLTSSARWAIAQARLASNEAKQRTAARILYKRQLGIEEIEADSIAVMRGIEGRTIRNLYKRLSAKYKIKNFKRDTNATDPVNTNLNLGNSILYGCAASACAALGINPALGIIHRGDIRSLLFDLADLYKPTLTIPAAFKCANNDDDGSEFRRLVRSEIVKQDLLKNMIHIMMEILAPYLPERTDDRLIGGRNREVPGHTQYGGK
>NZ_CP013263.1|WP_032802277.1|27543_29157_+|type-I-E-CRISPR-associated-protein-Cse1/CasA
MKSNVFKDFPFIKTNKGPMTVEEFFHSSHEKSLHLDLSIPGYEYGAIWRLLTSLTAVLMQRDPLFLKGKETSSELRFDPEFISQILDDLGSKISLTEGKNLFFQRTLLEGENPKDTARYVGPGKDPAWKLSPTAPSEKSQVYWNLEKLKPESLEAVDAIVALMVFSMYSFTGNSKYDGAKCLNGSPGIRFLGGGNTATEFIIEAQTPLLSLLKSIPSEWCEPGGLPAWLDRTGAESRKPNGEMHPLWRATWSSNTAACCWDGDTLIGVKIGGIPPEWYALEMGSKSEARKEWWDQRNTEDPFYFYKPDNGGALKAKRLDLSRDLTELAVEWVAEDLPTALVERVRGRALRVDFKKEDSLLFIRHQIGGNASSAMIRESVVSKARKQQWVFDPTGALQKEVRGKAVFILSLRNIVLSPFRRENKSDRDRGRRVLDSLASERPKMNETFWREIAPIYEEFILYFTEQVSGDETRKEVRAQAKKTLKELGKDAVRTAQKAFDMVLEPYLLQNPSQAYEVRRRIHSYLASTIAETNEGDQK
>NZ_CP013263.1|WP_032802276.1|29153_29747_+|type-I-E-CRISPR-associated-protein-Cse2/CasB
MTTSRPKQSWTPLVAEFAQRKKDKEFRAKRSALRAGAGTYTEFRAYSYVLPFLGEKASAAQRTALLRCMAALAEYPDVVSSGEKATASSVGQWVNRVAFDGKQGQSEPDSMVASRIKYLHTQDLEEAISSLRRIMAFADRKNVTTKLNPYQFVELFWYWGNGFTDASTKHRLSVLRDFYSTKQKENTDPQSSSEGEK
>NZ_CP013263.1|WP_032802275.1|29746_30814_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MSRHLTIHVVASVPYSNLNRDDSGTPKNVRRGGVTCALLSSQSIKKGIRTKYEDASLDTSVRSGRIADDVLERAKVLAPEADTKALEKAVKKIIGTLTKAAEVNESEDESDRSIWLSAEELEAAAVSVVEQAEKKDFIEDGRTGSLAIAAFGRMFAAAPKKGTEAALSVSPAVTTHGVTIATDYFSTVDDIRERNRDTGATYLGVAQYTTGVFYRTVTIDKEQLRESWTGLDREDAKENLAALVNAIIYGLPRGKQRSTAPFVQPALILAEEQSYRCAYDFESPVQADAREGGYLKPTMEELKRQYDSARAFDADNFGETQVVSGTYPEVSEFFAGAKYADKNGFIDEVVAWIQR
>NZ_CP013263.1|WP_014522928.1|30825_31518_+|type-I-E-CRISPR-associated-protein-Cas5/CasD
MTTTSVYLRLAGPLQSWAGPAVTGNFVRTAPIPTHSALVGLIAGACGYRRDEWPDWLDRLSFRVRVDHPGKFVDDFQTVSAHEEEMLFRERLIFATGKRPSAKTTRLTPDGRGMTSIIQRTYLAEAEFIVEVASDTHGELLRDALRAPKFSTYLGRKAFAPAFPFFLGATADVDVLHRIPACDLSGTKRDTARVQIHHRSAGLQTSAEHINVPAVQERSDWLEKTKALFT
>NZ_CP013263.1|WP_014522929.1|31592_32633_-|transposase
MIMASHPYRNHCNVCGNLLKKNGKTSTGKTRYRCKGCGASSTATRSGTLHQRQMKDFITWLLGPTSRYNNDISRAQRRSMSWCWQVPVPQPEMLDNAYILVMDKGASFRPEHLLVAYNSSHVQGWKWVDKDNKTACMQVHDHFSQPSAAVIDGGQSTAQTIQAIWPGIPVRRCLSHIRKSVDQKTSQTPRTQPAIEIKELTDSLKNVYTSEQAKLWLARYARWEDRWKELLKHRTNVSKDNCSIDGYEWEWTHKELRTIRFMYRKLIKKEELFLPFYGSDIVAHNAILSRRDSQLGETISTDITNLFSAHRGINHDHGCRMVEWYLNSKTESPFIPERIISHDHWR
>NZ_CP013263.1|WP_014366232.1|33040_33964_+|phospholipase-D
MREKFALLLSIIMAIMLPVGNAAAAPVVHNPASTANRPVYAIAHRVLTTQGVDDAVAIGANALEIDFTAWGRGWWADHDGIPTSAGATAEEIFKHIADKRKQGANITFTWLDIKNPDYCRDARSVCSINALRDLARKYLEPAGVRVLYGFYKTVGGPAWKTITADLRDGEAVALSGPAQDVLNDFARSGNKILTKQKIADYGYYDINQGFGNCYGTWNRTCDQLRKSSEARDQGKLGKTFGWTIATGQDARVNDLLGKANVDGLIFGFKMTHFYRHPDTENSFKAIKRWVDKHSATHHLATVADNPW
>NZ_CP013263.1|WP_014366233.1|34016_34883_-|ABC-transporter-ATP-binding-protein
MHTPKTTSTDLPTTAGISTDHMSALRTENVTLSWDKHVVSTDLSVDIPTGKFTAIIGPNGCGKSTLLKSCARILAPDTGSIYLNQHNLTHLHTKEIAKQLAFLPQSTITPTDITVEELVRRGRFPHHNWLHQWTAEDTRAVDAALNAASVKELTHKRVTDLSGGQRQRVWLAMVLAQNTPTVLLDEPTTFLDIAHQYQLLELARSLTTQLNRTVVAVLHDLQQAVRYADHLIVMKNGSIVATGSPQEVISAELISEVFNITVRTMLIDDQLIVIPTELPVPNVAMMQG
>NZ_CP013263.1|WP_014523733.1|35876_36944_-|iron-chelate-uptake-ABC-transporter-family-permease-subunit
MVSTASSNPSPIRGFLRKSQPNVQRTRRSLLVVVLLLAVLLVVGSIASVMIGARLIPLPEILNALFHPDSTNVSSTIVWDRRVPRTLLAIVAGMSLGLAGTLSQTLTRNPLADTGALGINSGAAFAIVVGIALFGASSPWAFLALALLGACGAAAVVYSVGTHRSATADPVRLVLSGVALSAILSGIGEGLSLVNPQAFDRLKSWMVGSVDVGTLMPLGIAGVGLTCGIVLTIACAHGLNALALGDAMATSIGASTARIRFISFIAVVILAASATAAAGVIIFLGLMVPHVARWIVGPDLPRVLITSLLLGPLVLVVADIVGRLIVPGEFPAGVVVSFIGAPFLIAYAQSRKGDM

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP013263_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013263_2

27384-27455

TypeI-E

Consensus_repeat	Method
TTCCTCGCGTCCTGCGGGGGTAG	CRISPRCasFinder

1 spacers

cas1,cas2,cas8e,cse2gr11,cas7,cas5

The CRISPR arrays of NZ_CP013263_2

>merge|NZ_CP013263|2|27384-27455|CRISPRCasFinder
TTCCTCGCGTCCTGCGGGGGTAGTTCATGTTAGGTTTTCGGGTTGACTTTTCCTCGCGTCCTGCGGGGGTAA

>NZ_CP013263|2|2|27384-27455|CRISPRCasFinder
TTCCTCGCGTCCTGCGGGGGTAG	TTCATGTTAGGTTTTCGGGTTGACTT
TTCCTCGCGTCCTGCGGGGGTAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013263.1\|WP_014366232.1\|33040_33964_+\|phospholipase-D	unknown	unknown	gnl\|CDD\|176518
NZ_CP013263.1\|WP_013240894.1\|38173_38443_-\|cell-division-protein-CrgA	unknown	unknown	gnl\|CDD\|178907
NZ_CP013263.1\|WP_014366221.1\|17645_18317_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013263.1\|WP_014523731.1\|18992_19763_+\|rhomboid-family-intramembrane-serine-protease	unknown	unknown	gnl\|CDD\|366759
NZ_CP013263.1\|WP_014523732.1\|20727_20919_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013263.1\|WP_014523730.1\|15683_16769_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224093
NZ_CP013263.1\|WP_014367522.1\|22956_23910_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
NZ_CP013263.1\|WP_014366233.1\|34016_34883_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP013263.1\|WP_032802277.1\|27543_29157_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cls000721_cas8e_CAS-I-E	gnl\|CDD\|378189
NZ_CP013263.1\|WP_014523733.1\|35876_36944_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	unknown	unknown	gnl\|CDD\|182464
NZ_CP013263.1\|WP_129559136.1\|21720_22023_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013263.1\|WP_014366220.1\|16770_17544_+\|sugar-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224053
NZ_CP013263.1\|WP_032802276.1\|29153_29747_+\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	mkCas0096_cse2gr11_CAS-I-E	gnl\|CDD\|274193
NZ_CP013263.1\|WP_014300358.1\|14685_15687_+\|sugar-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380535
NZ_CP013263.1\|WP_032802275.1\|29746_30814_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
NZ_CP013263.1\|WP_014522929.1\|31592_32633_-\|transposase	unknown	unknown	gnl\|CDD\|226202
NZ_CP013263.1\|WP_014367523.1\|22584_22956_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	cas2	pfam09707_cas2_CAS-I-E	gnl\|CDD\|378244
NZ_CP013263.1\|WP_014522933.1\|36990_38043_+\|iron-siderophore-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238566
NZ_CP013263.1\|WP_014522928.1\|30825_31518_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	gnl\|CDD\|187776
NZ_CP013263.1\|WP_014366222.1\|18394_18931_+\|peptidylprolyl-isomerase	unknown	unknown	gnl\|CDD\|223725

Protein	Function_ID	Function_description	E-value
NZ_CP013263.1\|WP_014366232.1\|33040_33964_+\|phospholipase-D	gnl\|CDD\|176518	cd08576, GDPD_like_SMaseD_PLD, Glycerophosphodiester phosphodiesterase-like domain of spider venom sphingomyelinases D, bacterial phospholipase D, and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase-like domain (GDPD-like) present in sphingomyelinases D (SMases D) (sphingomyelin phosphodiesterase D, EC 3.1.4.4) from spider venom, the Corynebacterium pseudotuberculosis Phospholipase D (PLD)-like protein from pathogenic bacteria, and the Ajellomyces capsulatus H143 PLD-like protein from ascomycetes. Spider SMases D and bacterial PLD proteins catalyze the Mg2+-dependent hydrolysis of sphingomyelin producing choline and ceramide 1-phosphate (C1P), which possess a number of biological functions, such as regulating cell proliferation and apoptosis, participating in inflammatory responses, and playing a key role in phagocytosis. In the presence of Mg2+, SMases D can function as lysophospholipase D and hydrolyze lysophosphatidylcholine (LPC) to choline and lysophosphatidic acid (LPA), which is a multifunctional phospholipid involved in platelet aggregation, endothelial hyperpermeability, and pro-inflammatory responses. Loxosceles spider venoms' SMases D are the principal toxins responsible for dermonecrosis and complement dependent haemolysis induced by spider venom. Due to amino acid substitutions at the entrance to the active-site pocket, some members lack activity. The typical GDPD domain consists of a TIM barrel and a small insertion domain named as the GDPD-insertion (GDPD-I) domain, which is specific for GDPD proteins. Although proteins in this family contain a non-typical GDPD domain which lacks the GDPD-I, their catalytic mechanisms are based on Mg2+-dependent acid-base reactions similar to GDPD proteins. They might be divergent members of the GDPD family. Moreover, this family does not belong to phospholipase D (PLD) superfamily, since it lacks the conserved HKD sequence motif that characterizes the catalytic center of the PLD superfamily. It belongs to the superfamily of PLC-like phosphodiesterases.	7.16899e-90
NZ_CP013263.1\|WP_013240894.1\|38173_38443_-\|cell-division-protein-CrgA	gnl\|CDD\|178907	PRK00159, PRK00159, putative septation inhibitor protein; Reviewed.	3.68764e-45
NZ_CP013263.1\|WP_014366222.1\|18394_18931_+\|peptidylprolyl-isomerase	gnl\|CDD\|223725	COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones].	2.26866e-65
NZ_CP013263.1\|WP_014523731.1\|18992_19763_+\|rhomboid-family-intramembrane-serine-protease	gnl\|CDD\|366759	pfam01694, Rhomboid, Rhomboid family. This family contains integral membrane proteins that are related to Drosophila rhomboid protein. Members of this family are found in bacteria and eukaryotes. Rhomboid promotes the cleavage of the membrane-anchored TGF-alpha-like growth factor Spitz, allowing it to activate the Drosophila EGF receptor. Analysis has shown that Rhomboid-1 is an intramembrane serine protease (EC:3.4.21.105). Parasite-encoded rhomboid enzymes are also important for invasion of host cells by Toxoplasma and the malaria parasite.	5.66481e-21
NZ_CP013263.1\|WP_014523730.1\|15683_16769_+\|ABC-transporter-permease	gnl\|CDD\|224093	COG1172, AraH, Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components [Carbohydrate transport and metabolism].	3.93829e-61
NZ_CP013263.1\|WP_014522928.1\|30825_31518_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|187776	cd09645, Cas5_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex.	6.80198e-27
NZ_CP013263.1\|WP_014366233.1\|34016_34883_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	2.72604e-116
NZ_CP013263.1\|WP_032802277.1\|27543_29157_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	0.00762068
NZ_CP013263.1\|WP_014523733.1\|35876_36944_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	gnl\|CDD\|182464	PRK10441, PRK10441, Fe(3+)-siderophore ABC transporter permease.	1.10582e-87
NZ_CP013263.1\|WP_014366220.1\|16770_17544_+\|sugar-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224053	COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism].	1.35107e-102
NZ_CP013263.1\|WP_014522929.1\|31592_32633_-\|transposase	gnl\|CDD\|226202	COG3677, COG3677, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	0.00655325
NZ_CP013263.1\|WP_032802276.1\|29153_29747_+\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|274193	TIGR02548, CRISPR_system_Cascade_subunit_CasB, CRISPR type I-E/ECOLI-associated protein CasB/Cse2. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This model family is found in Ecoli subtype CRISPR/Cas regions of many bacteria, most of which are mesophiles, and not in Archaea. It was designated Cse2 originally, and renamed CasB based on its characterization in the CASCADE complex.	5.93072e-07
NZ_CP013263.1\|WP_032802275.1\|29746_30814_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	1.30424e-81
NZ_CP013263.1\|WP_014367523.1\|22584_22956_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|378244	pfam09707, Cas_Cas2CT1978, CRISPR-associated protein (Cas_Cas2CT1978). This entry represents a minor branch of the Cas2 family of CRISPR-associated protein which are found in IPR003799. Cas proteins are found adjacent to a characteristic short, palindromic repeat cluster termed CRISPR, a probable mobile DNA element.	3.51848e-22
NZ_CP013263.1\|WP_014522933.1\|36990_38043_+\|iron-siderophore-ABC-transporter-substrate-binding-protein	gnl\|CDD\|238566	cd01146, FhuD, Fe3+-siderophore binding domain FhuD. These proteins have been shown to function as initial receptors in ABC transport of Fe3+-siderophores in many eubacterial species. They belong to the TroA-like superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA-like protein is comprised of two globular subdomains connected by a long alpha helix and binds its specific ligands in the cleft between these domains.	5.68021e-81
NZ_CP013263.1\|WP_014367522.1\|22956_23910_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	1.18457e-72
NZ_CP013263.1\|WP_014300358.1\|14685_15687_+\|sugar-ABC-transporter-substrate-binding-protein	gnl\|CDD\|380535	cd06312, PBP1_ABC_sugar_binding-like, periplasmic sugar-binding domain of uncharacterized ABC-type transport systems. Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type 1 periplasmic binding protein superfamily, which consists of two domains connected by a three-stranded hinge. The substrate specificity of this group is not known, but it is predicted to be involved in the transport of sugar-containing molecules and chemotaxis.	5.09443e-86

>NZ_CP013263.1|WP_014367522.1|22956_23910_-|type-I-E-CRISPR-associated-endonuclease-Cas1
MSYSNESLAFSTIPASEQIRLEDRVSFLYLEYCLIRQDRTGVIAVSRGDEKAPAELKDLPIKARIQLPVGGIAVLMLGPGTSISQPAATSCARAGVSVLFTGGGGVQAYSLSTPLTSSARWAIAQARLASNEAKQRTAARILYKRQLGIEEIEADSIAVMRGIEGRTIRNLYKRLSAKYKIKNFKRDTNATDPVNTNLNLGNSILYGCAASACAALGINPALGIIHRGDIRSLLFDLADLYKPTLTIPAAFKCANNDDDGSEFRRLVRSEIVKQDLLKNMIHIMMEILAPYLPERTDDRLIGGRNREVPGHTQYGGK
>NZ_CP013263.1|WP_014367523.1|22584_22956_-|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MFTVIQGHNLPNHLNGYLSRFLSEVDAGLYVGVLSRAVMENLWEKCQSVDLAGSLTLIHPQYDAEQGFRIRTTGKQRRPVVDLDGLFLSARGLIEDVRFADPLDEADAIIPDEVLEDFCPESE
>NZ_CP013263.1|WP_129559136.1|21720_22023_-|hypothetical-protein
MMDFYDAITRIEATPSVSVRYGDSGVQDFELEEFLAGLVQEKAVVSDVEAKREFLSWFDEDDEWLDPDWDAPMVEQTVRDLHVFAGLEPKVEIHIPMPPA
>NZ_CP013263.1|WP_014523732.1|20727_20919_+|hypothetical-protein
MKSGTIKLTNWDVHHEKQLDKDASCVIKEEDADAASERKHSLKWSVDSEEKRRGVRNHIHQAA
>NZ_CP013263.1|WP_014523731.1|18992_19763_+|rhomboid-family-intramembrane-serine-protease
MFHENGGMSDPRILHAAYKQAPVTALLSLSTLIIFLITAFQSQSITDNLYDSWIGTHWILYTPEMHEPLGMLRAIGSMFLHIGPGHLAINIFLLFFLGREIEQCIGSALFCAAYFISGLGASLMIMIMDPLSPTAGASGAIYGLMAIMVAIAITRKTDIRAPLILVAVNVGYSLIADNVSLWGHIGGLVAGSVVALPLMAFHRKHVIAGGTGGFLVYGTPRNHHAFTKDRLITWFVVAAIVVCEAIGIWIVGMKLL
>NZ_CP013263.1|WP_014366222.1|18394_18931_+|peptidylprolyl-isomerase
MMVRMTLKTATAILHTNRGDVAIELFGNHAPKTVENFVTLADGSADYKTENASGTTEGPFYDGAVFHRIIDGFMIQGGDPTGTGRGGPGYMFADEFHPELQFDRPFLLAMANAGPGTNGSQFFITVVPTPHLNNHHTIFGEVTDPASQKVVMDIAQTATDRMDRPVEPVVIESVEITE
>NZ_CP013263.1|WP_014366221.1|17645_18317_-|hypothetical-protein
MNSSTIRGAILVTKAAYDKYANYRDRKTREAYDALLNAADSYDDIHKDVKANVTEFYDQSQERVSSLTEQARKRLDSAIADAAAAKDNTVKTVNKKSKKAQKAARKAAKSAKKSAAPKKQPSFGKRLFNFSVFTTILATIGAVAYYFLSKRDVVSTEPPHVEDFGADSVNTEESRLVYSTQTPVDDEEEHVSSPEEGATERDEKLLGSLEDQLRQHTDSKDTK
>NZ_CP013263.1|WP_014366220.1|16770_17544_+|sugar-ABC-transporter-ATP-binding-protein
MDMSTTPIIELRDITKSYGAFDALRGVNLSVASGEVTCVLGDNGAGKSTLIKILSGLHKQSSGELLIDGQPVTFSGPREALDNGIATVHQNLAVVGQMSVWRNFFLGQELTGFLGRLRESEMRSIAQEQLKTMGIDLPDIDVEVESLSGGQRQVVAIARAVYFGARVIILDEPTAALGVKQSGMVLRFVAAARDKGLGVVLITHNPHHAYLVGDRFTILNLGNQILNASRDQVTLEQLTQQMAGGGELEALSHELSR
>NZ_CP013263.1|WP_014523730.1|15683_16769_+|ABC-transporter-permease
MIIPRPTAQSAAASTADVGTATKSDDRLRRRTGFSALIRRPEFASLLGAVAIFVLFLSVAPSFRSIDALTTVLYASSTLGIVAVSVGLLMIGSEFDLSSGVAVTTAALAATMLNYNLHLNSWVGALLSLFIALAIGALNGYLVTKTGIDSFLITLAAFLMLQGLNLAITKLVTSQVATPSIADMEGFPSAQKVFAGTVHIGSVSVRATVFWWIFFVAVGSWLLFKTRFGNWIFAVGGDANAARASGVPVARVKIILFMFVGFAAWFVGMHNLFTFDSIQAGQGVGNEFLYIIAAVIGGCAMTGGRGTIIGTAIGALIFGMTNQGIVYAGWNPDWFKFFLGAMLLFAVLTNTSFATLTKGRK
>NZ_CP013263.1|WP_014300358.1|14685_15687_+|sugar-ABC-transporter-substrate-binding-protein
MKNLRFPLHAAVITLAASVVLSACSATGGAPRSSNITGGQSGGVDTPRYVVAMVTHGAPGDTFWDLIRKGAEDAAKKSNIELRYASDPEAPNQSNLIQNAIDSKVDGIAVTMPNAEAIGPTAKKAVAAKIPTVALNAGLDAYQKYDISAFFGQEEKVAGTLAGKRLAQDGAKHALCVIHEQGNSSQEARCAGLKEGLADADVEILYVNGKDMTSVQSTVQAKLAQDKSIDWVMGLVAPVALTSVDAVKNSGSSAKISTFDTNAQLVTAIKNGTVQWAVDQQPYLQGYLAIDALWLAQRNGSTVGGNRPVYTGPSFVDATNVDKIADSAKEGLR
>NZ_CP013263.1|WP_032802277.1|27543_29157_+|type-I-E-CRISPR-associated-protein-Cse1/CasA
MKSNVFKDFPFIKTNKGPMTVEEFFHSSHEKSLHLDLSIPGYEYGAIWRLLTSLTAVLMQRDPLFLKGKETSSELRFDPEFISQILDDLGSKISLTEGKNLFFQRTLLEGENPKDTARYVGPGKDPAWKLSPTAPSEKSQVYWNLEKLKPESLEAVDAIVALMVFSMYSFTGNSKYDGAKCLNGSPGIRFLGGGNTATEFIIEAQTPLLSLLKSIPSEWCEPGGLPAWLDRTGAESRKPNGEMHPLWRATWSSNTAACCWDGDTLIGVKIGGIPPEWYALEMGSKSEARKEWWDQRNTEDPFYFYKPDNGGALKAKRLDLSRDLTELAVEWVAEDLPTALVERVRGRALRVDFKKEDSLLFIRHQIGGNASSAMIRESVVSKARKQQWVFDPTGALQKEVRGKAVFILSLRNIVLSPFRRENKSDRDRGRRVLDSLASERPKMNETFWREIAPIYEEFILYFTEQVSGDETRKEVRAQAKKTLKELGKDAVRTAQKAFDMVLEPYLLQNPSQAYEVRRRIHSYLASTIAETNEGDQK
>NZ_CP013263.1|WP_032802276.1|29153_29747_+|type-I-E-CRISPR-associated-protein-Cse2/CasB
MTTSRPKQSWTPLVAEFAQRKKDKEFRAKRSALRAGAGTYTEFRAYSYVLPFLGEKASAAQRTALLRCMAALAEYPDVVSSGEKATASSVGQWVNRVAFDGKQGQSEPDSMVASRIKYLHTQDLEEAISSLRRIMAFADRKNVTTKLNPYQFVELFWYWGNGFTDASTKHRLSVLRDFYSTKQKENTDPQSSSEGEK
>NZ_CP013263.1|WP_032802275.1|29746_30814_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MSRHLTIHVVASVPYSNLNRDDSGTPKNVRRGGVTCALLSSQSIKKGIRTKYEDASLDTSVRSGRIADDVLERAKVLAPEADTKALEKAVKKIIGTLTKAAEVNESEDESDRSIWLSAEELEAAAVSVVEQAEKKDFIEDGRTGSLAIAAFGRMFAAAPKKGTEAALSVSPAVTTHGVTIATDYFSTVDDIRERNRDTGATYLGVAQYTTGVFYRTVTIDKEQLRESWTGLDREDAKENLAALVNAIIYGLPRGKQRSTAPFVQPALILAEEQSYRCAYDFESPVQADAREGGYLKPTMEELKRQYDSARAFDADNFGETQVVSGTYPEVSEFFAGAKYADKNGFIDEVVAWIQR
>NZ_CP013263.1|WP_014522928.1|30825_31518_+|type-I-E-CRISPR-associated-protein-Cas5/CasD
MTTTSVYLRLAGPLQSWAGPAVTGNFVRTAPIPTHSALVGLIAGACGYRRDEWPDWLDRLSFRVRVDHPGKFVDDFQTVSAHEEEMLFRERLIFATGKRPSAKTTRLTPDGRGMTSIIQRTYLAEAEFIVEVASDTHGELLRDALRAPKFSTYLGRKAFAPAFPFFLGATADVDVLHRIPACDLSGTKRDTARVQIHHRSAGLQTSAEHINVPAVQERSDWLEKTKALFT
>NZ_CP013263.1|WP_014522929.1|31592_32633_-|transposase
MIMASHPYRNHCNVCGNLLKKNGKTSTGKTRYRCKGCGASSTATRSGTLHQRQMKDFITWLLGPTSRYNNDISRAQRRSMSWCWQVPVPQPEMLDNAYILVMDKGASFRPEHLLVAYNSSHVQGWKWVDKDNKTACMQVHDHFSQPSAAVIDGGQSTAQTIQAIWPGIPVRRCLSHIRKSVDQKTSQTPRTQPAIEIKELTDSLKNVYTSEQAKLWLARYARWEDRWKELLKHRTNVSKDNCSIDGYEWEWTHKELRTIRFMYRKLIKKEELFLPFYGSDIVAHNAILSRRDSQLGETISTDITNLFSAHRGINHDHGCRMVEWYLNSKTESPFIPERIISHDHWR
>NZ_CP013263.1|WP_014366232.1|33040_33964_+|phospholipase-D
MREKFALLLSIIMAIMLPVGNAAAAPVVHNPASTANRPVYAIAHRVLTTQGVDDAVAIGANALEIDFTAWGRGWWADHDGIPTSAGATAEEIFKHIADKRKQGANITFTWLDIKNPDYCRDARSVCSINALRDLARKYLEPAGVRVLYGFYKTVGGPAWKTITADLRDGEAVALSGPAQDVLNDFARSGNKILTKQKIADYGYYDINQGFGNCYGTWNRTCDQLRKSSEARDQGKLGKTFGWTIATGQDARVNDLLGKANVDGLIFGFKMTHFYRHPDTENSFKAIKRWVDKHSATHHLATVADNPW
>NZ_CP013263.1|WP_014366233.1|34016_34883_-|ABC-transporter-ATP-binding-protein
MHTPKTTSTDLPTTAGISTDHMSALRTENVTLSWDKHVVSTDLSVDIPTGKFTAIIGPNGCGKSTLLKSCARILAPDTGSIYLNQHNLTHLHTKEIAKQLAFLPQSTITPTDITVEELVRRGRFPHHNWLHQWTAEDTRAVDAALNAASVKELTHKRVTDLSGGQRQRVWLAMVLAQNTPTVLLDEPTTFLDIAHQYQLLELARSLTTQLNRTVVAVLHDLQQAVRYADHLIVMKNGSIVATGSPQEVISAELISEVFNITVRTMLIDDQLIVIPTELPVPNVAMMQG
>NZ_CP013263.1|WP_014523733.1|35876_36944_-|iron-chelate-uptake-ABC-transporter-family-permease-subunit
MVSTASSNPSPIRGFLRKSQPNVQRTRRSLLVVVLLLAVLLVVGSIASVMIGARLIPLPEILNALFHPDSTNVSSTIVWDRRVPRTLLAIVAGMSLGLAGTLSQTLTRNPLADTGALGINSGAAFAIVVGIALFGASSPWAFLALALLGACGAAAVVYSVGTHRSATADPVRLVLSGVALSAILSGIGEGLSLVNPQAFDRLKSWMVGSVDVGTLMPLGIAGVGLTCGIVLTIACAHGLNALALGDAMATSIGASTARIRFISFIAVVILAASATAAAGVIIFLGLMVPHVARWIVGPDLPRVLITSLLLGPLVLVVADIVGRLIVPGEFPAGVVVSFIGAPFLIAYAQSRKGDM
>NZ_CP013263.1|WP_014522933.1|36990_38043_+|iron-siderophore-ABC-transporter-substrate-binding-protein
MKDTQSLNTWSHRIAVMLALFLSISLIFSLAACSSEEKQSKDAGQGNADVATGGAHFSTADAETAKLGSDAAPGEFPRTVKHALGETEIKEQPKRVVVLDTGELDSVLSLGITPVGMVTTKGSNPVPSYLADKVKDVKSVGTINEINVEEIAALQPDLILGSKLRADKIYAQLAEVAPTVFSIRPGFPWKENFLLIGDALGKEKEAEAKLNEYTEKVETIKASVPADTTVSLLRFMPKRIRLYGNKSLLGVILKDAGLARPENQNIDELATEISPETIDQAEGSVIFYSSYGKPDATGQDAIVNGAAWKNLNAVKNGQAHEVNDDVWFLGLGPTGAMQIVEELKELLPKK
>NZ_CP013263.1|WP_013240894.1|38173_38443_-|cell-division-protein-CrgA
MPKSKITQSSAPFASSSTSNRTPVKINSTGTPVWYKTIMFGLILAGLLWLIVNYLAGEDIAFMMSLGAWNYGIGFGLFIVGLLMTMGWR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP013263_1	1.2\|22448\|28\|NZ_CP013263\|PILER-CR	22448-22475	28	NZ_CP019064	Rahnella sp. ERMR1:05 plasmid unnamed2, complete sequence	112232-112259	6	0.786
NZ_CP013263_1	1.8\|22507\|31\|NZ_CP013263\|CRT	22507-22537	31	NZ_CP027853	Plesiomonas shigelloides strain MS-17-188 plasmid pPS-MS-17-188-1, complete sequence	223320-223350	6	0.806
NZ_CP013263_1	1.1\|22387\|28\|NZ_CP013263\|PILER-CR	22387-22414	28	KU160495	Exiguobacterium phage vB_EauS-123, complete genome	10947-10974	7	0.75
NZ_CP013263_1	1.2\|22448\|28\|NZ_CP013263\|PILER-CR	22448-22475	28	NZ_AP019800	Vibrio rotiferianus strain AM7 plasmid pAM7, complete sequence	14661-14688	7	0.75
NZ_CP013263_1	1.2\|22448\|28\|NZ_CP013263\|PILER-CR	22448-22475	28	GQ866233	Aggregatibacter phage S1249, complete sequence	27861-27888	7	0.75
NZ_CP013263_1	1.5\|22506\|32\|NZ_CP013263\|CRISPRCasFinder	22506-22537	32	NZ_CP027853	Plesiomonas shigelloides strain MS-17-188 plasmid pPS-MS-17-188-1, complete sequence	223319-223350	7	0.781
NZ_CP013263_1	1.7\|22446\|31\|NZ_CP013263\|CRT	22446-22476	31	NZ_CP019064	Rahnella sp. ERMR1:05 plasmid unnamed2, complete sequence	112232-112262	7	0.774
NZ_CP013263_1	1.7\|22446\|31\|NZ_CP013263\|CRT	22446-22476	31	NC_048639	Pseudomonas phage ZC08, complete genome	14894-14924	8	0.742
NZ_CP013263_1	1.7\|22446\|31\|NZ_CP013263\|CRT	22446-22476	31	NC_048638	Pseudomonas phage ZC03, complete genome	14836-14866	8	0.742
NZ_CP013263_1	1.4\|22445\|32\|NZ_CP013263\|CRISPRCasFinder	22445-22476	32	NC_048639	Pseudomonas phage ZC08, complete genome	14894-14925	9	0.719
NZ_CP013263_1	1.4\|22445\|32\|NZ_CP013263\|CRISPRCasFinder	22445-22476	32	NC_048638	Pseudomonas phage ZC03, complete genome	14836-14867	9	0.719
NZ_CP013263_1	1.6\|22385\|31\|NZ_CP013263\|CRT	22385-22415	31	KU160495	Exiguobacterium phage vB_EauS-123, complete genome	10947-10977	9	0.71
NZ_CP013263_1	1.7\|22446\|31\|NZ_CP013263\|CRT	22446-22476	31	GQ866233	Aggregatibacter phage S1249, complete sequence	27861-27891	9	0.71
NZ_CP013263_1	1.3\|22384\|32\|NZ_CP013263\|CRISPRCasFinder	22384-22415	32	KU160495	Exiguobacterium phage vB_EauS-123, complete genome	10946-10977	10	0.688
NZ_CP013263_1	1.4\|22445\|32\|NZ_CP013263\|CRISPRCasFinder	22445-22476	32	GQ866233	Aggregatibacter phage S1249, complete sequence	27860-27891	10	0.688

1. spacer 1.2|22448|28|NZ_CP013263|PILER-CR matches to NZ_CP019064 (Rahnella sp. ERMR1:05 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

tggtgttccaataatgcttttgctgcca	CRISPR spacer
ttatgttccaataatgcctttgctgaag	Protospacer
* .**************.*******  .

2. spacer 1.8|22507|31|NZ_CP013263|CRT matches to NZ_CP027853 (Plesiomonas shigelloides strain MS-17-188 plasmid pPS-MS-17-188-1, complete sequence) position: , mismatch: 6, identity: 0.806

gcctgattcactgtcagcccgtaaagctcac	CRISPR spacer
ggctgatttactggcagcccgtaaagcactg	Protospacer
* ******.**** ************* *

3. spacer 1.1|22387|28|NZ_CP013263|PILER-CR matches to KU160495 (Exiguobacterium phage vB_EauS-123, complete genome) position: , mismatch: 7, identity: 0.75

cagcaacggtgagaatctttttttcgcg	CRISPR spacer
aagcaaccgtgagaatatttttttgaaa	Protospacer
 ****** ******** ******* . .

4. spacer 1.2|22448|28|NZ_CP013263|PILER-CR matches to NZ_AP019800 (Vibrio rotiferianus strain AM7 plasmid pAM7, complete sequence) position: , mismatch: 7, identity: 0.75

tggtgttccaataatgcttttgctgcca	CRISPR spacer
tctgattccaataatgctttttctgcat	Protospacer
*   .**************** ****

5. spacer 1.2|22448|28|NZ_CP013263|PILER-CR matches to GQ866233 (Aggregatibacter phage S1249, complete sequence) position: , mismatch: 7, identity: 0.75

tggtgttccaataatgcttttgctgcca	CRISPR spacer
cggtgtctcaataatgcttttgctaatt	Protospacer
.*****..****************. .

6. spacer 1.5|22506|32|NZ_CP013263|CRISPRCasFinder matches to NZ_CP027853 (Plesiomonas shigelloides strain MS-17-188 plasmid pPS-MS-17-188-1, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgattcactgtcagcccgtaaagctcac	CRISPR spacer
aggctgatttactggcagcccgtaaagcactg	Protospacer
 * ******.**** ************* *

7. spacer 1.7|22446|31|NZ_CP013263|CRT matches to NZ_CP019064 (Rahnella sp. ERMR1:05 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

tggtgttccaataatgcttttgctgccaact	CRISPR spacer
ttatgttccaataatgcctttgctgaagatt	Protospacer
* .**************.*******  .*.*

8. spacer 1.7|22446|31|NZ_CP013263|CRT matches to NC_048639 (Pseudomonas phage ZC08, complete genome) position: , mismatch: 8, identity: 0.742

tggtgttccaataatgcttttgctgccaact	CRISPR spacer
aagaactccaataatgactttgctgccaacc	Protospacer
 .* ..********** .************.

9. spacer 1.7|22446|31|NZ_CP013263|CRT matches to NC_048638 (Pseudomonas phage ZC03, complete genome) position: , mismatch: 8, identity: 0.742

tggtgttccaataatgcttttgctgccaact	CRISPR spacer
aagaactccaataatgactttgctgccaacc	Protospacer
 .* ..********** .************.

10. spacer 1.4|22445|32|NZ_CP013263|CRISPRCasFinder matches to NC_048639 (Pseudomonas phage ZC08, complete genome) position: , mismatch: 9, identity: 0.719

ttggtgttccaataatgcttttgctgccaact	CRISPR spacer
gaagaactccaataatgactttgctgccaacc	Protospacer
  .* ..********** .************.

11. spacer 1.4|22445|32|NZ_CP013263|CRISPRCasFinder matches to NC_048638 (Pseudomonas phage ZC03, complete genome) position: , mismatch: 9, identity: 0.719

ttggtgttccaataatgcttttgctgccaact	CRISPR spacer
gaagaactccaataatgactttgctgccaacc	Protospacer
  .* ..********** .************.

12. spacer 1.6|22385|31|NZ_CP013263|CRT matches to KU160495 (Exiguobacterium phage vB_EauS-123, complete genome) position: , mismatch: 9, identity: 0.71

cagcaacggtgagaatctttttttcgcgacg	CRISPR spacer
aagcaaccgtgagaatatttttttgaaaatc	Protospacer
 ****** ******** ******* . .*.

13. spacer 1.7|22446|31|NZ_CP013263|CRT matches to GQ866233 (Aggregatibacter phage S1249, complete sequence) position: , mismatch: 9, identity: 0.71

tggtgttccaataatgcttttgctgccaact	CRISPR spacer
cggtgtctcaataatgcttttgctaattccg	Protospacer
.*****..****************. .  *

14. spacer 1.3|22384|32|NZ_CP013263|CRISPRCasFinder matches to KU160495 (Exiguobacterium phage vB_EauS-123, complete genome) position: , mismatch: 10, identity: 0.688

tcagcaacggtgagaatctttttttcgcgacg	CRISPR spacer
aaagcaaccgtgagaatatttttttgaaaatc	Protospacer
  ****** ******** ******* . .*.

15. spacer 1.4|22445|32|NZ_CP013263|CRISPRCasFinder matches to GQ866233 (Aggregatibacter phage S1249, complete sequence) position: , mismatch: 10, identity: 0.688

ttggtgttccaataatgcttttgctgccaact	CRISPR spacer
acggtgtctcaataatgcttttgctaattccg	Protospacer
 .*****..****************. .  *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

690885 : 765266

Tupanvirus(18.18%)

protease,bacteriocin,integrase

attL 716792:716819|attR 722704:722731

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032802571.1\|690885_691185_+\|protease	ATP-dependent Clp protease adapter ClpS	NA	NA	NA	NA
WP_013242516.1\|691279_691816_+	DUF2017 domain-containing protein	NA	NA	NA	NA
WP_014367517.1\|691902_692721_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_014367516.1\|692794_693688_+	glutamate racemase	NA	NA	NA	NA
WP_014523555.1\|693760_694528_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_032802570.1\|694566_695301_+	ribonuclease PH	NA	NA	NA	NA
WP_014367514.1\|695297_695921_+	RdgB/HAM1 family non-canonical purine NTP pyrophosphatase	NA	NA	NA	NA
WP_014367513.1\|695989_696349_-	DUF3817 domain-containing protein	NA	NA	NA	NA
WP_014367512.1\|696436_696883_-	hypothetical protein	NA	NA	NA	NA
WP_014524035.1\|698640_699399_+	hypothetical protein	NA	NA	NA	NA
WP_014367509.1\|699581_700613_-	DUF418 domain-containing protein	NA	NA	NA	NA
WP_014367508.1\|700656_701283_-	response regulator transcription factor	NA	NA	NA	NA
WP_014655722.1\|701279_702395_-	two-component sensor histidine kinase	NA	NA	NA	NA
WP_014523551.1\|702555_702861_+	hypothetical protein	NA	NA	NA	NA
WP_014367505.1\|703085_712184_+	type I polyketide synthase	NA	NA	NA	NA
WP_013242501.1\|712314_712704_+	holo-ACP synthase	NA	NA	NA	NA
WP_013242500.1\|712716_713370_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_013242499.1\|713407_713887_-	thioredoxin-dependent thiol peroxidase	NA	NA	NA	NA
WP_013242498.1\|713975_714251_+	DUF3618 domain-containing protein	NA	NA	NA	NA
WP_014655718.1\|714726_715281_-	isochorismatase family protein	A0A2K9L2K0	Tupanvirus	5.2e-17	32.6
WP_014367502.1\|715480_716479_-	NADP-dependent oxidoreductase	NA	NA	NA	NA
716792:716819	attL	NA	NA	NA	NA
WP_014367498.1\|717522_718080_-	recombinase family protein	M9Q1K0	Clostridium_phage	4.0e-33	46.2
WP_050494101.1\|719161_719971_+	hypothetical protein	NA	NA	NA	NA
WP_032802512.1\|719967_720972_+	AAA family ATPase	NA	NA	NA	NA
WP_080713377.1\|721423_721936_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_050494099.1\|721878_722556_-	hypothetical protein	A0A1X9SFC1	Mycobacterium_phage	5.1e-22	34.0
WP_014523549.1\|723174_724365_+	L,D-transpeptidase	NA	NA	NA	NA
722704:722731	attR	NA	NA	NA	NA
WP_014367495.1\|724418_725246_-	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
WP_014523548.1\|725425_726085_-	oligoribonuclease	M4M9I5	Vibrio_phage	8.4e-22	35.0
WP_014523547.1\|726150_726954_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_014733040.1\|727080_728076_-	oxidoreductase	NA	NA	NA	NA
WP_014367490.1\|728351_730178_+	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	6.8e-29	31.8
WP_014367489.1\|730518_730719_-	YbdD/YjiX family protein	NA	NA	NA	NA
WP_014367486.1\|733615_735661_+	bifunctional copper resistance protein CopD/cytochrome c oxidase assembly protein	NA	NA	NA	NA
WP_014367485.1\|735751_736675_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	4.2e-19	26.1
WP_014367484.1\|736671_737430_+	permease	NA	NA	NA	NA
WP_014733038.1\|737451_738903_-	YcaO-like family protein	NA	NA	NA	NA
WP_014367482.1\|738976_739147_-\|bacteriocin	thiazolylpeptide-type bacteriocin	NA	NA	NA	NA
WP_014367481.1\|739185_740166_-	hypothetical protein	NA	NA	NA	NA
WP_014367480.1\|740162_741176_-	hypothetical protein	NA	NA	NA	NA
WP_014523541.1\|743774_745253_-	nitroreductase	NA	NA	NA	NA
WP_014367477.1\|745279_746818_-	YcaO-like family protein	NA	NA	NA	NA
WP_014367476.1\|746814_748569_-	hypothetical protein	NA	NA	NA	NA
WP_014367473.1\|749097_749658_+	single-stranded DNA-binding protein	NA	NA	NA	NA
WP_014522869.1\|749847_751518_+	energy-dependent translational throttle protein EttA	A0A2K9L0W2	Tupanvirus	1.3e-47	27.9
WP_013242474.1\|751725_752154_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_013242473.1\|752159_752768_+	hypothetical protein	NA	NA	NA	NA
WP_014367472.1\|753678_754071_-	globin	NA	NA	NA	NA
WP_014523536.1\|754189_754768_-	mechanosensitive ion channel	NA	NA	NA	NA
WP_014367469.1\|755189_757805_-	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	5.9e-42	29.7
WP_014367467.1\|758138_758759_+	DSBA oxidoreductase	NA	NA	NA	NA
WP_013242465.1\|758825_759299_+	ribose-5-phosphate isomerase	NA	NA	NA	NA
WP_014367466.1\|759416_760427_+	pirin family protein	NA	NA	NA	NA
WP_014523535.1\|760513_761290_-	hypothetical protein	NA	NA	NA	NA
WP_014300878.1\|761426_761669_-	hypothetical protein	A0A1W6JRB8	Corynebacterium_phage	3.9e-09	48.4
WP_014524025.1\|762458_763811_+	trigger factor	NA	NA	NA	NA
WP_013242460.1\|764021_764621_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	1.3e-42	48.3
WP_013242459.1\|764636_765266_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	1.4e-37	43.5

DBSCAN-SWA_2

1384680 : 1448601

Bacillus_phage(17.65%)

protease,transposase,holin,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014366814.1\|1384680_1385421_+\|protease	trypsin-like serine protease	NA	NA	NA	NA
WP_013241618.1\|1385522_1387199_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-17	29.4
WP_014366812.1\|1387204_1388164_-	ABC transporter permease	NA	NA	NA	NA
WP_013241616.1\|1388156_1389083_-	ABC transporter permease	NA	NA	NA	NA
WP_014366811.1\|1389174_1390755_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_014366810.1\|1391007_1391394_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_014523872.1\|1391855_1392611_-	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_014523871.1\|1392607_1394008_-	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	1.7e-11	30.9
WP_014366806.1\|1394249_1394864_-	membrane protein	NA	NA	NA	NA
WP_014366805.1\|1395016_1395901_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_014366804.1\|1396030_1396957_+	DUF808 domain-containing protein	NA	NA	NA	NA
WP_043014386.1\|1397144_1399469_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	3.5e-123	33.8
WP_014366802.1\|1399544_1401221_+	ATP-binding cassette domain-containing protein	A0A1V0SE00	Indivirus	2.5e-22	33.3
WP_014523870.1\|1401217_1402858_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	5.0e-23	24.6
WP_014366800.1\|1402923_1403310_-	alkylphosphonate utilization protein	NA	NA	NA	NA
WP_014366799.1\|1403486_1404026_+	DUF488 domain-containing protein	NA	NA	NA	NA
WP_014366797.1\|1404551_1405637_-	redox-regulated ATPase YchF	NA	NA	NA	NA
WP_014523868.1\|1405770_1407345_+	AI-2E family transporter	NA	NA	NA	NA
WP_080713369.1\|1408411_1409755_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	3.5e-59	42.4
WP_080713369.1\|1409854_1411198_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	3.5e-59	42.4
WP_014367640.1\|1411741_1411891_+	hypothetical protein	NA	NA	NA	NA
WP_014367639.1\|1411943_1412129_+	hypothetical protein	NA	NA	NA	NA
WP_032802653.1\|1412288_1413185_+	polyphosphate kinase 2	NA	NA	NA	NA
WP_014367635.1\|1417693_1418134_-	winged helix DNA-binding protein	NA	NA	NA	NA
WP_014367634.1\|1418155_1419403_-	lipase	NA	NA	NA	NA
WP_014367633.1\|1419417_1419609_-	hypothetical protein	NA	NA	NA	NA
WP_013242652.1\|1419673_1421116_+	C4-dicarboxylate transporter DctA	NA	NA	NA	NA
WP_014367631.1\|1421150_1421435_-	rhodanese-like domain-containing protein	A0A2H4PQR9	Staphylococcus_phage	5.6e-07	39.2
WP_013242650.1\|1421436_1421913_-	inorganic diphosphatase	NA	NA	NA	NA
WP_014300957.1\|1421962_1423147_+	D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase	NA	NA	NA	NA
WP_014367630.1\|1423177_1424020_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_014300955.1\|1424023_1424605_+	hypoxanthine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	3.0e-15	31.4
WP_088428658.1\|1424649_1426605_+	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	E5EQU5	Bathycoccus_sp._RCC1105_virus	7.6e-111	50.3
WP_014367628.1\|1426597_1427161_+	GTP cyclohydrolase I FolE	A0A1W7AF02	Streptococcus_virus	2.6e-48	57.8
WP_014523608.1\|1427162_1427945_+	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	6.5e-21	32.2
WP_014655799.1\|1427931_1428273_+	dihydroneopterin aldolase	NA	NA	NA	NA
WP_014367625.1\|1428274_1428730_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	S4W084	Pandoravirus	1.1e-09	33.8
WP_013242641.1\|1428726_1429173_+	DUF3180 domain-containing protein	NA	NA	NA	NA
WP_014367624.1\|1429183_1429699_+	hypothetical protein	NA	NA	NA	NA
WP_014367623.1\|1429695_1430082_+	hypothetical protein	NA	NA	NA	NA
WP_014367622.1\|1430089_1430758_+	hypothetical protein	NA	NA	NA	NA
WP_014367621.1\|1430735_1432484_-\|holin	choline dehydrogenase	A0A1V0SI18	Klosneuvirus	4.9e-61	31.5
WP_014367620.1\|1432689_1434837_+	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	7.0e-17	26.7
WP_014367619.1\|1434846_1436352_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_014367618.1\|1436348_1437638_-	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_014523607.1\|1437792_1437993_-	hypothetical protein	NA	NA	NA	NA
WP_014524074.1\|1437992_1438937_-	SPFH domain-containing protein	NA	NA	NA	NA
WP_014523605.1\|1439047_1440604_+\|tRNA	lysine--tRNA ligase	A0A1V0SIS0	Klosneuvirus	8.0e-71	34.2
WP_014523604.1\|1440852_1441515_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_014367613.1\|1441581_1442478_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_014367612.1\|1442561_1443554_+	nucleoside hydrolase	NA	NA	NA	NA
WP_014367611.1\|1443591_1444995_+	MFS transporter	NA	NA	NA	NA
WP_013242626.1\|1445070_1445757_-	hypothetical protein	NA	NA	NA	NA
WP_014367610.1\|1445943_1448601_+\|protease	ATP-dependent Clp protease ATP-binding subunit	K4FB40	Cronobacter_phage	1.1e-131	40.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP013263

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection