CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP010951	Ramlibacter tataouinensis strain 5-10 chromosome, complete genome	5 crisprs	csa3,Cas9_archaeal,cas3,DEDDh,DinG	2	3	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP010951_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010951_1

894885-895008

Orphan

Consensus_repeat	Method
GAAAGCGCACCACGTGCGCTGGATTCCGGCCTCCGGCACCAGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP010951_1

>merge|NZ_CP010951|1|894885-895008|CRISPRCasFinder
GAAAGCGCACCACGTGCGCTGGATTCCGGCCTCCGGCACCAGCGTGCCTTCGACCGGCCTCGAACCGGCAGGGCCCGAAATGAAAGCGCACCACGTGCGCTGGATTCCGGCCTCCGACACCAGC

>NZ_CP010951|1|1|894885-895008|CRISPRCasFinder
GAAAGCGCACCACGTGCGCTGGATTCCGGCCTCCGGCACCAGC	GTGCCTTCGACCGGCCTCGAACCGGCAGGGCCCGAAAT
GAAAGCGCACCACGTGCGCTGGATTCCGGCCTCCGACACCAGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010951.1\|WP_061496549.1\|887556_888111_+\|dTDP-4-dehydrorhamnose-3,5-epimerase	unknown	unknown	gnl\|CDD\|376414
NZ_CP010951.1\|WP_061496569.1\|897336_898308_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_CP010951.1\|WP_145979326.1\|886579_887560_+\|glucose-1-phosphate-thymidylyltransferase-RfbA	unknown	unknown	gnl\|CDD\|130274
NZ_CP010951.1\|WP_061496577.1\|901760_902690_-\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223633
NZ_CP010951.1\|WP_061503672.1\|900643_901750_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|236896
NZ_CP010951.1\|WP_061496580.1\|904238_904613_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010951.1\|WP_061496556.1\|892142_893039_+\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	unknown	unknown	gnl\|CDD\|224131
NZ_CP010951.1\|WP_061496566.1\|896064_897147_+\|CDP-6-deoxy-delta-3,4-glucoseen-reductase	unknown	unknown	gnl\|CDD\|181058
NZ_CP010951.1\|WP_061496579.1\|902871_904197_-\|replication-associated-recombination-protein-A	unknown	unknown	gnl\|CDD\|237355
NZ_CP010951.1\|WP_061496543.1\|884653_885718_+\|dTDP-glucose-4,6-dehydratase	unknown	unknown	gnl\|CDD\|224013
NZ_CP010951.1\|WP_061496545.1\|885717_886635_+\|dTDP-4-dehydrorhamnose-reductase	unknown	unknown	gnl\|CDD\|367904
NZ_CP010951.1\|WP_061496560.1\|893276_893804_-\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|225373
NZ_CP010951.1\|WP_061496575.1\|899816_900632_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223488
NZ_CP010951.1\|WP_061496571.1\|898408_899014_+\|outer-membrane-beta-barrel-protein	unknown	unknown	gnl\|CDD\|366609
NZ_CP010951.1\|WP_145979327.1\|893803_894715_-\|cysteine-synthase-CysM	unknown	unknown	gnl\|CDD\|236972
NZ_CP010951.1\|WP_061496573.1\|899041_899758_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223487
NZ_CP010951.1\|WP_061496563.1\|895092_896025_-\|NAD-dependent-epimerase/dehydratase-family-protein	unknown	unknown	gnl\|CDD\|187576
NZ_CP010951.1\|WP_061496558.1\|893052_893280_-\|sulfurtransferase-TusA-family-protein	unknown	unknown	gnl\|CDD\|238180
NZ_CP010951.1\|WP_061496552.1\|888178_891013_+\|valine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235582
NZ_CP010951.1\|WP_061496554.1\|891037_892033_-\|hydroxyacid-dehydrogenase	unknown	unknown	gnl\|CDD\|240650

Protein	Function_ID	Function_description	E-value
NZ_CP010951.1\|WP_061496549.1\|887556_888111_+\|dTDP-4-dehydrorhamnose-3,5-epimerase	gnl\|CDD\|376414	pfam00908, dTDP_sugar_isom, dTDP-4-dehydrorhamnose 3,5-epimerase. This family catalyze the isomerisation of dTDP-4-dehydro-6-deoxy -D-glucose with dTDP-4-dehydro-6-deoxy-L-mannose. The EC number of this enzyme is 5.1.3.13.	1.33163e-103
NZ_CP010951.1\|WP_061496569.1\|897336_898308_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	5.54711e-135
NZ_CP010951.1\|WP_145979326.1\|886579_887560_+\|glucose-1-phosphate-thymidylyltransferase-RfbA	gnl\|CDD\|130274	TIGR01207, Glucose-1-phosphate_thymidylyltransferase_1, glucose-1-phosphate thymidylyltransferase, short form. Alternate name: dTDP-D-glucose synthase homotetramer This model describes a tightly conserved but broadly distributed subfamily (here designated as short form) of known and putative bacterial glucose-1-phosphate thymidylyltransferases. It is well characterized in several species as the first of four enzymes involved in the biosynthesis of dTDP-L-rhamnose, a cell wall constituent and a feedback inhibitor of the enzyme. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	0
NZ_CP010951.1\|WP_061496577.1\|901760_902690_-\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|223633	COG0559, LivH, Branched-chain amino acid ABC-type transport system, permease components [Amino acid transport and metabolism].	5.05982e-76
NZ_CP010951.1\|WP_061503672.1\|900643_901750_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|236896	PRK11301, livM, leucine/isoleucine/valine transporter permease subunit; Provisional.	4.83504e-94
NZ_CP010951.1\|WP_061496556.1\|892142_893039_+\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	gnl\|CDD\|224131	COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane].	1.88431e-166
NZ_CP010951.1\|WP_061496566.1\|896064_897147_+\|CDP-6-deoxy-delta-3,4-glucoseen-reductase	gnl\|CDD\|181058	PRK07609, PRK07609, CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated.	0
NZ_CP010951.1\|WP_061496579.1\|902871_904197_-\|replication-associated-recombination-protein-A	gnl\|CDD\|237355	PRK13342, PRK13342, recombination factor protein RarA; Reviewed.	0
NZ_CP010951.1\|WP_061496543.1\|884653_885718_+\|dTDP-glucose-4,6-dehydratase	gnl\|CDD\|224013	COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane].	0
NZ_CP010951.1\|WP_061496545.1\|885717_886635_+\|dTDP-4-dehydrorhamnose-reductase	gnl\|CDD\|367904	pfam04321, RmlD_sub_bind, RmlD substrate binding domain. L-rhamnose is a saccharide required for the virulence of some bacteria. Its precursor, dTDP-L-rhamnose, is synthesized by four different enzymes the final one of which is RmlD. The RmlD substrate binding domain is responsible for binding a sugar nucleotide.	4.98304e-110
NZ_CP010951.1\|WP_061496560.1\|893276_893804_-\|NUDIX-domain-containing-protein	gnl\|CDD\|225373	COG2816, NPY1, NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair].	3.67644e-19
NZ_CP010951.1\|WP_061496575.1\|899816_900632_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223488	COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism].	1.08256e-124
NZ_CP010951.1\|WP_061496571.1\|898408_899014_+\|outer-membrane-beta-barrel-protein	gnl\|CDD\|366609	pfam01389, OmpA_membrane, OmpA-like transmembrane domain. The structure of OmpA transmembrane domain shows that it consists of an eight stranded beta barrel. This family includes some other distantly related outer membrane proteins with low scores.	9.57858e-09
NZ_CP010951.1\|WP_145979327.1\|893803_894715_-\|cysteine-synthase-CysM	gnl\|CDD\|236972	PRK11761, cysM, cysteine synthase CysM.	0
NZ_CP010951.1\|WP_061496573.1\|899041_899758_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223487	COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism].	3.01272e-121
NZ_CP010951.1\|WP_061496563.1\|895092_896025_-\|NAD-dependent-epimerase/dehydratase-family-protein	gnl\|CDD\|187576	cd05266, SDR_a4, atypical (a) SDRs, subgroup 4. Atypical SDRs in this subgroup are poorly defined, one member is identified as a putative NAD-dependent epimerase/dehydratase. Atypical SDRs are distinct from classical SDRs. Members of this subgroup have a glycine-rich NAD(P)-binding motif that is related to, but is different from, the archetypical SDRs, GXGXXG. This subgroup also lacks most of the characteristic active site residues of the SDRs; however, the upstream Ser is present at the usual place, and some potential catalytic residues are present in place of the usual YXXXK active site motif. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	4.19472e-57
NZ_CP010951.1\|WP_061496558.1\|893052_893280_-\|sulfurtransferase-TusA-family-protein	gnl\|CDD\|238180	cd00291, SirA_YedF_YeeD, SirA, YedF, and YeeD. Two-layered alpha/beta sandwich domain. SirA (also known as UvrY, and YhhP) belongs to a family of bacterial two-component response regulators that controls secondary metabolism and virulence. The other member of this two-component system is a sensor kinase called BarA which phosphorylates SirA. A variety of microorganisms have similar proteins, all of which contain a common CPxP sequence motif in the N-terminal region. YhhP is suggested to be important for normal cell division and growth in rich nutrient medium. Moreover, despite a low primary sequence similarity, the YccP structure closely resembles the non-homologous C-terminal RNA-binding domain of E. coli translation initiation factor IF3. The signature CPxP motif serves to stabilize the N-terminal helix as part of the N-capping box and might be important in mRNA-binding.	1.42813e-26
NZ_CP010951.1\|WP_061496552.1\|888178_891013_+\|valine--tRNA-ligase	gnl\|CDD\|235582	PRK05729, valS, valyl-tRNA synthetase; Reviewed.	0
NZ_CP010951.1\|WP_061496554.1\|891037_892033_-\|hydroxyacid-dehydrogenase	gnl\|CDD\|240650	cd12173, PGDH_4, Phosphoglycerate dehydrogenases, NAD-binding and catalytic domains. Phosphoglycerate dehydrogenases (PGDHs) catalyze the initial step in the biosynthesis of L-serine from D-3-phosphoglycerate. PGDHs come in 3 distinct structural forms, with this first group being related to 2-hydroxy acid dehydrogenases, sharing structural similarity to formate and glycerate dehydrogenases. PGDH in E. coli and Mycobacterium tuberculosis form tetramers, with subunits containing a Rossmann-fold NAD binding domain. Formate/glycerate and related dehydrogenases of the D-specific 2-hydroxyacid dehydrogenase superfamily include groups such as formate dehydrogenase, glycerate dehydrogenase, L-alanine dehydrogenase, and S-adenosylhomocysteine hydrolase. Despite often low sequence identity, these proteins typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann fold NAD+ binding form. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomain but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence.	2.6487e-54

>NZ_CP010951.1|WP_145979327.1|893803_894715_-|cysteine-synthase-CysM
MNPPSYPSIEDAVGKTPLVALQRIGAAANRERGNIVLGKLEGNNPAGSVKDRPALAMIRGAEKRGEIKPGDTLIEATSGNTGIALAMAAAIKGYRMLLIMPEDLSVERAQTMKAFGAELLLTPKSGGMEYARDLAENMQREGKGRVLDQFGNADNPRVHYETTGPELWDQTKGRITHFVSAMGTTGTITGVSRYLKEKNPAIRIIGAQPSEGSRIPGIRKWPQEYLPKIYDPSTVDELVYVSQDDAEEMCRRLAREEGIFGGISAAGACWVAQQIAHDAHDATIVFVVCDRGDRYLSTGVFPA
>NZ_CP010951.1|WP_061496560.1|893276_893804_-|NUDIX-domain-containing-protein
MQQAFRFCPQCAAPLQPIAQLEDGGEKVRLRCAACAWTHWNNPTPVLAAVIQYQDRILLARNAAWPGRRFALITGFMEAGESPQDGIAREIREETSLETSELNLIGAYEFTRMNQVIIAYHAVAHGEVKLSPELAEYKLFEYDDVLCWPAGTGYALADWLRSRGYEPRFMETSLR
>NZ_CP010951.1|WP_061496558.1|893052_893280_-|sulfurtransferase-TusA-family-protein
MNIDKEIDTRGLNCPLPILKAKKALADMQSGQLLKVVATDAGSVRDFQAFAKQTGNELVDQQTVGAEFIHVLRRR
>NZ_CP010951.1|WP_061496556.1|892142_893039_+|UTP--glucose-1-phosphate-uridylyltransferase-GalU
MYKFTQIRKAVFPVAGLGTRFLPATKAQPKEMLPIVDKPLIQYAVEEAYAAGIRHMIFVTGRNKRAIEDHFDTAYELENELTANHKLDLLSLVRSVPEDMDCSYVRQPRSLGLGHAVLCAAPLVGNEPFAVLLADDLMIGDNGGPGVLTQMVEVFREKPTSLLAVQEVPREHVKRYGIVAGQPAGERLIKVDRMVEKPSPEDAPSRMGVAGRYILTPAVFDEIRKNPRGAGGEIQLTDGIAKLMGTEGVHAYQYRGKRYDCGSKHGFLEASVEFALKHPEVQAGFREYLQGLCRTELL
>NZ_CP010951.1|WP_061496554.1|891037_892033_-|hydroxyacid-dehydrogenase
MNILLLERLVPEALAWLDERHAVDCRPELAADLTAIRKVVYKAEAVVLPRKVQVTREFLDFAPRLKAIARMHVGTDNTDLEACRGRNVRVIQATTANVRSNAEYLLAALLLLMRRGIGSSLIGDRHAEIRLGRELNGSVVGIFGLAPTAHTLALMLQPLGARLIGYDPAVHHTAPIWRRLQIQPMSLPDMLAQADAVSVQVMYASRYEGFINDKVLAHCKPGQLWVGTSRSHLFDSQALAAALTDGRIEACMIDGAEAGFASRGTPLHELQNLFLTPRIGSHTRESRLRASWYVAHRIHEALSPRATEPLVSATMGLEPEGAPRRSEFIIR
>NZ_CP010951.1|WP_061496552.1|888178_891013_+|valine--tRNA-ligase
MNDTTAQPGLNSLSKSFEPAPIEARWGSVWEERGYARAGWRGTGQAREGEPAFAIQLPPPNVTGTLHMGHAFNQTIMDSLTRYHRMRGFNTLWVPGTDHAGIATQIVVERQLQDQQLSRHDLGRKNFVAKVWEWKEKSGNIITSQMRRLGASVDWSHEYFTMDDKLSNVVTETFVRLYEQGLIYRGKRLVNWDPELKSAVSDLEVESEEEDGFLWHIRYPLADGSGALTVATTRPETMLGDVAVMVHPDDERYRQLIGQKVKLPLCDRDIPVIADEYVDREFGTGVVKVTPAHDPNDYAVGQRHGLPMIGVLTLDARINDNAPAKYRGLDRFAARKAVVADLEAQGLLAETKKHRLMVPRCARTGQVVEPMLTDQWFVAVSKVSDKDPTGKSIAQKAIDAVESGAVSFVPENWVNTYNQWMNNIQDWCISRQLWWGHQIPAWYDEDGNIYVARNEQEAQAQAPGKQLRRDEDVLDTWYSSALVPFSTLGWPAKTQELDLYLPSSVLVTGYEIIFFWVARMIMMSTHFTGQVPFRSVYIHGMVRDSEGKKMSKSEGNVVDPVDLIQGADLDTLLHKSTVGLRRPETAPKVMARVRKEFPQGMPAYGADALRFTMASYASLGRNINFDTKRCEGYRNFCNKLWNASRFVLMNCEGQDLAEAGATQTQADRWIVSLLQRAEAEVAKSFAEYRLDNVAAAVYQFVWDEFCDWYLEIAKVQIQTGDANRQRGTRRTLIRVLEAILRLAHPVLPFITEELWQVVAPVAGKDGESISLAPYPASNSAAIDPAAEAYVARLKSVVDACRNLRGEMNVSPATRLPAYVVTESAEDAAFMRETAPVLQALARLADLKLFDDAGAWAAAAKAAPVAVVGATRLCLYMEIDVAAEKARLAKEAERLRTELGKANGKLANESFVAKAPPAVIEQERKRIADFTATLEKIQDQLARLG
>NZ_CP010951.1|WP_061496549.1|887556_888111_+|dTDP-4-dehydrorhamnose-3,5-epimerase
MIIERTHLPEVLVLQPRVFGDERGFFTESWNKARFDEAAGAAVEFVQDNHSRSSRGVLRGLHYQIQQPQGKLVRVVSGRVFDVAVDLRRSSPRLGQWVGVELSAENHRQLWVPPGFAHGYLTLSETADFLYKATDYYAPQHERALLWNDPHLAIEWPLSAIDGAPTLSAKDLQAAAWRHCPLYD
>NZ_CP010951.1|WP_145979326.1|886579_887560_+|glucose-1-phosphate-thymidylyltransferase-RfbA
MGSRQSSPNWPGRRLPLPDTLRTERTRMSQQHGKRKGIILAGGAGTRLHPATLAISKQLLPVFDKPMVYYPLATLMLAGIRDVLVISTPEDTPRFEQLLGDGSQWGLNLQFAVQPRPEGLAQAFLIGRAFLDGGPSALVLGDNIFYGHDLVKLLQDANAQADGATVFAYHVKDPHRYGVVAFDERGRATSIEEKPLHPRSNFAVTGLYFYDGDVCDVAAQVRPSARGELEITSVNQHYLEHGKLSVRTMGRGFAWLDTGTHESLLEASQFIHTLEQRQGLKVACPEEIAWRNRWISDDQLLALAQALGKSAYGQYLTSLLKAGGAW
>NZ_CP010951.1|WP_061496545.1|885717_886635_+|dTDP-4-dehydrorhamnose-reductase
MKVLLFGGRGQVGWQLRRSLSLLGEVVVAERQGTPCCGDLLQPAAIRDAILALRPQAVVNAAAYTAVDRAEDEPELAFAINARACEAMAEACTQAGCWLVHYSSDYVYRGDGAGPWRETDPCEPLGVYGKSKLQGDLAVATTPRHLILRTSWVFETWGGNFLKSILKAARDRDELSVVSDQWGAPTRAALIADVTALALRQLRQDPDAMARAGVYHLAGAGETNWHAYACFAIEQAAAAGLPLRARSSQVRAISTADYAARAPRPANSRLDTTRLRSGFGIHLPPWQDGVSAVVAELARQALAAS
>NZ_CP010951.1|WP_061496543.1|884653_885718_+|dTDP-glucose-4,6-dehydratase
MIFVTGGCGFIGSCFVLDWLRDQQEPLLNIDALTYAGHPGNLEAAAGNPNYHFVHGDIRDKSLMRDLFQQWKPRAIVHFAAESHVDRSIAAPSAFVDTNVTGTVNLLQAAQELVQTLPPEEAHAFRFLNVSTDEVFGSLEPTDAAFSEAHRYQPNSPYSASKASADHFVRAWWHTYQLPTITTNCSNNYGPRQFPEKLIPLVIHNALRGQPLPVYGDGMQVRDWLHVSDHCSALRAVLAQGRPGETYNIGGRSVMTNLDVVRGICAMLDELRPRATPHAGLITHVTDRRGHDRRYAIDDSRLAAELGWQPKMRFADGIRQTVQWYLDNSAWVESVTSGSYRQWVEQQYHSRAAR
>NZ_CP010951.1|WP_061496563.1|895092_896025_-|NAD-dependent-epimerase/dehydratase-family-protein
MPSIQSPYGALPSRFRRERVLIVGCGDVGMRVARELGGRVTLRALSSSPSRVAELRAAGITPLIGNLDEPRSLARLAGLATRLVHLAPPATEHSGAWWLDWRTLSLMRVIARRGRPASCVYASTSGVYGDCGGERVQEFRPLQPRTPRAQRRLDAERLMRHFGRRAARVSLLRVPGIYAADRPGGPRERLLRAHPVLEAADDVYTSHIHADDLARALLAALWRGAPQRIYNICDDTQLKLGDYYDLAADVYGLPRPRRVSRVAAADELPLSVLSFMNESRRLDNSRLKRELRVRLRFPTVGEGLRSAPCR
>NZ_CP010951.1|WP_061496566.1|896064_897147_+|CDP-6-deoxy-delta-3,4-glucoseen-reductase
MANASHQAAGTFQVSVQPSGRSFSVDAGEAILPAAIRQGIGMPYGCKDGACGSCKCKMLDGTVVHGTHQTKALNAEEEAAGYILTCCAVPQTDVVIESRQVTDESGFPVRKMPSRVMSLEKRSHDVMVVRLQLPANDTMRYHAGQYVEFILRDGARRSYSMANAPHTMLPRDGVPPTPAIELHVRHMPGGKFTDHVFTAMKEKEILRVEGPYGHFYLREDSDKPIVFLASGTGFAPIKAVIEHMKFKDIRRPSVLYWGGRRPADLYLDDWVRERMVEMPHLTYVPVISNALPEDNWTGRTGFVHKAVMEDFPDLSGHQVYACGAPIVVDSARAEYSAQAKLPPDEFYADAFTTEADKHGA
>NZ_CP010951.1|WP_061496569.1|897336_898308_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKRRHLLLSGLAASATLSAPAAWAQAKPIRLIVPYAAGGPIDVTARLLAERVKDTLGTVIIENRPGGGGNIGADAVAKAAPDGYTIGISAVATHAINPWLFAKMPYDAAKDFAPITQMVRVPNVLVVNAETAARLKVNTVADLISYAKANPGKLNYGSGGNGSAGHLAGEMFKQGAGIFAVHIPYNGGNPAQLALLSGQVDFNFDNLATAAPNIRAGKLKALAVTTLARSPALPEAPPVADTIKGFAIDTWWGLVAPAGTPREVVSRLNAAFVAALQSPEARTRFAALMAEPVWNTPDEFGSFMKAELAKYEKVVKLSGAKVD
>NZ_CP010951.1|WP_061496571.1|898408_899014_+|outer-membrane-beta-barrel-protein
MAAVRRTASSLTLAVCASLAPAYAQDSGGFKDPYSLRTATQRSYLGLNMGRSYYESSCSSTALVCDQGNPTARLYAGTTFGRTWGAEFGYVDLGRVLRPTGESRAEGLNLSLVGRTRLASSWSLFGRVGTTYGRTDTTAMAASSTPGGSEQGFGMSMGGGVSYDFTPRLSGTLEWETHDLRFAGGTRDPVRSTNLGLQYRY
>NZ_CP010951.1|WP_061496573.1|899041_899758_-|ABC-transporter-ATP-binding-protein
MSQTLLKVKGLKVAYGGIQAVKGVDFEVREGELVSLIGSNGAGKTTTMKAITGGLPMNEGDIEYLGHSIRGRGAWDLVKQGLAMVPEGRGVFARMTITENLQMGAHIRSDKDGIATDMEKIFAIFPRLKERKDQLAGTLSGGEQQMLAMGRALMSRPKVLLLDEPSMGLSPIMVDKIFEVVREVYAQGVTILLVEQNASRALEIADRGYVMESGVITMSGDAKAMLSDPKVRAAYLGE
>NZ_CP010951.1|WP_061496575.1|899816_900632_-|ABC-transporter-ATP-binding-protein
MAEIVLRVAGISKRFGGLQALSDVGITIERGQIYGLIGPNGAGKTTFFNVITGLYAPDSGTFELGGKPYSPTAVHEVARAGIARTFQNIRLFSEMTAIENVMVGRHIRTQSGLIGAIFRTGSFKAEERAIANRARELLDYVGIGKYADYRARTLSYGDQRRLEIARALATDPQLIALDEPAAGMNATEKVQLRELIDRIRRDNRTILLIEHDVKLVMGLCNRVTVLDYGKQIAEGTPAEVQHNEKVIEAYLGHGHGTAATKAAVAASGEAQ
>NZ_CP010951.1|WP_061503672.1|900643_901750_-|ABC-transporter-ATP-binding-protein
MNGFIERQNKYVVYVLAALALAILPLLLQAAGNFWVRIADIALLYVLLALGLNIVVGYAGLLDLGYVAFFAIGAYMYALMASPHLSDTFQWFQQTFPNGLHTSIWLVVPLGAALAGFFGILLGAPTLKLRGDYLAIVTLGFGEIIRVFLNNLDHPVNITNGPKGMGQIDSIRIFGLNLGKRLDIGDYSINAVTFYYYLFLILVVLSVVICHRLELSRIGRAWMAIREDEIAAKAMGINTRNMKLLAFGMGATFGGVSGAMFAAFQGFVSPESFSLNESVMIVAMVVLGGIGHLPGVILGAVLLASLPEVLRWVSGYFDLQAMTGGRLDASILRQMLIALAMIVVMLMRPRGLWPTPEHGKSLRQNGGK
>NZ_CP010951.1|WP_061496577.1|901760_902690_-|branched-chain-amino-acid-ABC-transporter-permease
MDILLQQLINGLVLGSMYALVALGYTMVYGIINLINFAHGEVLMVGALTSWAIIVGMQEAMPGMPGWLMLVVSLVISCVVASALNFAIEKIAYRPLRNSPKLAPLITAIGMSILLQTLAMIIFKPNYKPYPTLLPPAPILIGGAVITSTQIMILGLTAVSLAVLMYLVNYTKLGRAMRATAENPRVAALMGVKPDTVISATFVIGAVLATIAGVMYASNYGSVQHTMGFLPGLKAFTAAVFGGIGNLAGAVVGGILLGLIESFGSGYIGALTGGVLGSHYSDIFAFIVLIIILTLRPSGLLGERVADRA
>NZ_CP010951.1|WP_061496579.1|902871_904197_-|replication-associated-recombination-protein-A
MPPPPVAPALQPLAERLRPRNLGEVTGQQHLLGEGMPLRIAFESGQPHSCILWGPPGTGKTTIARLMADAFDAQFIQISAVLGGVKDIREAVEQAQLAQGTALEAAAGAGGRRTIVFVDEVHRFNKSQQDAFLPHVESGLFTFIGATTENPSFEVNSALLSRSAVYVLQPLSEDDLRQIAGKAQAIAAVPPMEQAALDRLVAYADGDARRLLNTLETLMVAAQKEQIAEITDGWLLKVLGERLRRYDKGGEQFYDTISALHKSVRGSDPDASLYWFMRMLDGGADPRYIARRLIRMAAEDIGLADPRALRLALDAAEVYERLGSPEGELALAQCVIYLAVAPKSNAVYAAFNEAKALVQRDGTRPVPLHLRNAPTQLMKDLEFGKGYRYAHDEEGGFAAGENYLPDGMAPPGFYRPVDRGLEIRISEKLRELRKRNDKAGR
>NZ_CP010951.1|WP_061496580.1|904238_904613_+|hypothetical-protein
MDAASLWSSLSALLGAAVGGGISYLLNRQQFANQLRLTREQHRTEFMAEETARAFLSHKGFTDRSFETLRRHLGGFEEDELRKILVRAGAMRIYRDDGSEWWRLVSRMDEYIERKDLQKIVREI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP010951_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010951_2

1780876-1780971

Orphan

Consensus_repeat	Method
CGGGCTGCGGTGCTACGAGCCTTCGGAGCGGCCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP010951_2

>merge|NZ_CP010951|2|1780876-1780971|CRISPRCasFinder
CGGGCTGCGGTGCTACGAGCCTTCGGAGCGGCCGGGCGGCTCATTGGATAACCTCCGCCCTGCGGGCTGCGGTGCTATGAGCCTTCGGAGCGGCCG

>NZ_CP010951|2|2|1780876-1780971|CRISPRCasFinder
CGGGCTGCGGTGCTACGAGCCTTCGGAGCGGCCG	GGCGGCTCATTGGATAACCTCCGCCCTG
CGGGCTGCGGTGCTATGAGCCTTCGGAGCGGCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010951.1\|WP_061498049.1\|1787618_1788302_+\|orotate-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|234771
NZ_CP010951.1\|WP_061498039.1\|1779999_1780425_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010951.1\|WP_061503746.1\|1778647_1779988_-\|tRNA-(N6-isopentenyl-adenosine(37)-C2)-methylthiotransferase-MiaB	unknown	unknown	gnl\|CDD\|237673
NZ_CP010951.1\|WP_061498042.1\|1783245_1784211_-\|AEC-family-transporter	unknown	unknown	gnl\|CDD\|223751
NZ_CP010951.1\|WP_061498026.1\|1771659_1773069_-\|sigma-54-dependent-Fis-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225114
NZ_CP010951.1\|WP_061498031.1\|1774780_1775029_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010951.1\|WP_158513876.1\|1789100_1790264_+\|AraC-family-transcriptional-regulator-ligand-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|378890
NZ_CP010951.1\|WP_061503747.1\|1780570_1780834_+\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
NZ_CP010951.1\|WP_061498051.1\|1788312_1788972_+\|DUF4124-domain-containing-protein	unknown	unknown	unknown
NZ_CP010951.1\|WP_082792957.1\|1782499_1783222_-\|SOS-response-associated-peptidase-family-protein	unknown	unknown	gnl\|CDD\|376837
NZ_CP010951.1\|WP_061503748.1\|1780977_1781982_-\|asparaginase	unknown	unknown	gnl\|CDD\|377601
NZ_CP010951.1\|WP_082792953.1\|1773068_1774883_-\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|236901
NZ_CP010951.1\|WP_061498040.1\|1781990_1782482_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376668
NZ_CP010951.1\|WP_061498047.1\|1786366_1786771_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010951.1\|WP_061503749.1\|1786816_1787608_-\|exodeoxyribonuclease-III	unknown	unknown	gnl\|CDD\|197336
NZ_CP010951.1\|WP_061498024.1\|1771094_1771667_-\|1,6-anhydro-N-acetylmuramyl-L-alanine-amidase-AmpD	unknown	unknown	gnl\|CDD\|236984
NZ_CP010951.1\|WP_061498035.1\|1775909_1777292_+\|signal-recognition-particle-protein	unknown	unknown	gnl\|CDD\|236780
NZ_CP010951.1\|WP_158513875.1\|1777359_1778637_+\|trypsin-like-peptidase-domain-containing-protein	unknown	unknown	gnl\|CDD\|273938
NZ_CP010951.1\|WP_061498033.1\|1775028_1775826_-\|cytochrome-c-biogenesis-protein-CcsA	unknown	unknown	gnl\|CDD\|226621
NZ_CP010951.1\|WP_061498045.1\|1784297_1786370_+\|UvrD-helicase-domain-containing-protein	unknown	unknown	gnl\|CDD\|130146

Protein	Function_ID	Function_description	E-value
NZ_CP010951.1\|WP_061498049.1\|1787618_1788302_+\|orotate-phosphoribosyltransferase	gnl\|CDD\|234771	PRK00455, pyrE, orotate phosphoribosyltransferase; Validated.	2.38286e-70
NZ_CP010951.1\|WP_061503746.1\|1778647_1779988_-\|tRNA-(N6-isopentenyl-adenosine(37)-C2)-methylthiotransferase-MiaB	gnl\|CDD\|237673	PRK14325, PRK14325, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional.	0
NZ_CP010951.1\|WP_061498026.1\|1771659_1773069_-\|sigma-54-dependent-Fis-family-transcriptional-regulator	gnl\|CDD\|225114	COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms].	2.24875e-164
NZ_CP010951.1\|WP_061498042.1\|1783245_1784211_-\|AEC-family-transporter	gnl\|CDD\|223751	COG0679, COG0679, Predicted permeases [General function prediction only].	1.6898e-37
NZ_CP010951.1\|WP_158513876.1\|1789100_1790264_+\|AraC-family-transcriptional-regulator-ligand-binding-domain-containing-protein	gnl\|CDD\|378890	pfam12625, Arabinose_bd, Arabinose-binding domain of AraC transcription regulator, N-term. AraC is a bacterial transcriptional regulatory protein with a DNA-binding domain at the C-terminus, HTH_AraC, pfam00165, and this dimerization domain which harbours the arabinose-binding pocket at the N-terminus. AraC positively and negatively regulates expression of the proteins required for the uptake and catabolism of the sugar L-arabinose 1,2,3].	1.93497e-16
NZ_CP010951.1\|WP_061503747.1\|1780570_1780834_+\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	4.33768e-14
NZ_CP010951.1\|WP_082792957.1\|1782499_1783222_-\|SOS-response-associated-peptidase-family-protein	gnl\|CDD\|376837	pfam02586, SRAP, SOS response associated peptidase (SRAP). The SRAP family functions as a DNA-associated autoproteolytic switch that recruits diverse repair enzymes onto DNA damage. We propose that the human protein Q96FZ2:UniProtKB, the eukaryotic member of the SRAP family, which has been recently shown to bind specifically to DNA with 5-hydroxymethylcytosine, 5-formylcytosine and 5-carboxycytosine, is a sensor for these oxidized bases generated by the TET (tetrahedral aminopeptidase of the M42 family) enzymes from methylcytosine. Hence, its autoproteolytic activity might help it act as a switch that recruits DNA repair enzymes to remove these oxidized methylcytosine species as part of the DNA demethylation pathway downstream of the TET enzymes.	2.49308e-30
NZ_CP010951.1\|WP_061503748.1\|1780977_1781982_-\|asparaginase	gnl\|CDD\|377601	pfam06089, Asparaginase_II, L-asparaginase II. This family consists of several bacterial L-asparaginase II proteins. L-asparaginase (EC:3.5.1.1) catalyzes the hydrolysis of L-asparagine to L-aspartate and ammonium. Rhizobium etli possesses two asparaginases: asparaginase I, which is thermostable and constitutive, and asparaginase II, which is thermolabile, induced by asparagine and repressed by the carbon source.	9.07409e-134
NZ_CP010951.1\|WP_082792953.1\|1773068_1774883_-\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|236901	PRK11360, PRK11360, two-component system sensor histidine kinase AtoS.	9.40645e-35
NZ_CP010951.1\|WP_061498040.1\|1781990_1782482_-\|hypothetical-protein	gnl\|CDD\|376668	pfam01927, Mut7-C, Mut7-C RNAse domain. RNAse domain of the PIN fold with an inserted Zinc Ribbon at the C-terminus.	2.14751e-42
NZ_CP010951.1\|WP_061503749.1\|1786816_1787608_-\|exodeoxyribonuclease-III	gnl\|CDD\|197336	cd10281, Nape_like_AP-endo, Neisseria meningitides Nape-like subfamily of the ExoIII family purinic/apyrimidinic (AP) endonucleases. This subfamily includes Neisseria meningitides Nape and related proteins. These are Escherichia coli exonuclease III (ExoIII)-like AP endonucleases and belong to the large EEP (exonuclease/endonuclease/phosphatase) superfamily that contains functionally diverse enzymes that share a common catalytic mechanism of cleaving phosphodiester bonds. AP endonucleases participate in the DNA base excision repair (BER) pathway. AP sites are one of the most common lesions in cellular DNA. During BER the damaged DNA is first recognized by DNA glycosylase. AP endonucleases then catalyze the hydrolytic cleavage of the phosphodiester bond 5' to the AP site, and this is followed by the coordinated actions of DNA polymerase, deoxyribose phosphatase, and DNA ligase. If left unrepaired, AP sites block DNA replication, and have both mutagenic and cytotoxic effects. AP endonucleases can carry out a variety of excision and incision reactions on DNA, including 3'-5' exonuclease, 3'-deoxyribose phosphodiesterase, 3'-phosphatase, and occasionally, nonspecific DNase activities. Different AP endonuclease enzymes catalyze the different reactions with different efficiences. Many organisms have two AP endonucleases, usually one is the dominant AP endonuclease, the other has weak AP endonuclease activity; for example, Neisseria meningitides Nape and NExo. Nape, found in this subfamily, is the dominant AP endonuclease. It exhibits strong AP endonuclease activity, and also exhibits 3'-5'exonuclease and 3'-deoxyribose phosphodiesterase activities.	3.04322e-131
NZ_CP010951.1\|WP_061498024.1\|1771094_1771667_-\|1,6-anhydro-N-acetylmuramyl-L-alanine-amidase-AmpD	gnl\|CDD\|236984	PRK11789, PRK11789, 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD.	2.98866e-114
NZ_CP010951.1\|WP_061498035.1\|1775909_1777292_+\|signal-recognition-particle-protein	gnl\|CDD\|236780	PRK10867, PRK10867, signal recognition particle protein; Provisional.	0
NZ_CP010951.1\|WP_158513875.1\|1777359_1778637_+\|trypsin-like-peptidase-domain-containing-protein	gnl\|CDD\|273938	TIGR02037, Probable_periplasmic_serine_protease_do/HhoA-like, periplasmic serine protease, Do/DeqQ family. This family consists of a set proteins various designated DegP, heat shock protein HtrA, and protease DO. The ortholog in Pseudomonas aeruginosa is designated MucD and is found in an operon that controls mucoid phenotype. This family also includes the DegQ (HhoA) paralog in E. coli which can rescue a DegP mutant, but not the smaller DegS paralog, which cannot. Members of this family are located in the periplasm and have separable functions as both protease and chaperone. Members have a trypsin domain and two copies of a PDZ domain. This protein protects bacteria from thermal and other stresses and may be important for the survival of bacterial pathogens.// The chaperone function is dominant at low temperatures, whereas the proteolytic activity is turned on at elevated temperatures. [Protein fate, Protein folding and stabilization, Protein fate, Degradation of proteins, peptides, and glycopeptides].	2.54036e-27
NZ_CP010951.1\|WP_061498033.1\|1775028_1775826_-\|cytochrome-c-biogenesis-protein-CcsA	gnl\|CDD\|226621	COG4137, COG4137, ABC-type uncharacterized transport system, permease component [General function prediction only].	2.18481e-33
NZ_CP010951.1\|WP_061498045.1\|1784297_1786370_+\|UvrD-helicase-domain-containing-protein	gnl\|CDD\|130146	TIGR01074, ATP-dependent_DNA_helicase_Rep, ATP-dependent DNA helicase Rep. Designed to identify rep members of the uvrD/rep subfamily. [DNA metabolism, DNA replication, recombination, and repair].	0

>NZ_CP010951.1|WP_061503747.1|1780570_1780834_+|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MMSIIGTIVVGFIVGLIARALKPGDDRMGLIMTTLLGVAGAFIARYVGVAMGWYQQEEAAGWIASVIGAVVLLFIYGMLRGRSRDRP
>NZ_CP010951.1|WP_061498039.1|1779999_1780425_-|hypothetical-protein
MNRCLSLRARIALAAFASLAALTPILLPAPAAAQGIQREAPKDVVLGQMAVGAPPEIQIDGKADRLSPGYRIRDLNNMLVLSASLAGQTVPVVYRRDAAGLVHEAWLLTAEEYRRLGGVGGGADGYRKFAELLSVIFGARR
>NZ_CP010951.1|WP_061503746.1|1778647_1779988_-|tRNA-(N6-isopentenyl-adenosine(37)-C2)-methylthiotransferase-MiaB
MTRKVFIKTFGCQMNEYDSDKMADVMNAAQGYEPTDNVDEADLILFNTCSVREKAQEKVFSDLGRVKHLKSKGVLIGVGGCVASQEGAAIIERAPYVDVVFGPQTLHRLPQLLAQRERQQRPQVDISFPEIEKFDSLPPARVEGATAFVSIMEGCSKYCSYCVVPYTRGEEVSRPFEDVLAEVAGLADQGVKEVTLLGQNVNAYRGKMGDTAEIADFALLLEYVADIPGIERIRYTTSHPNEFTQRLIEAYARVPKLVSHLHLPVQHGSDRILMAMKRGYTVLEYKSTVRKLRAVRPQLSLSSDFIVGFPGETDEDFARLMKLIEDVGYDASFSFIFSPRPGTPAANLHDDTPHAVKLARLQQVQAAIEANAQRISRSLVGTVQRILVEGPSRKDPAELMGRTECNRIVNFSGQPHLVGQMADVTITQALPHSLRAEVLEREEAAA
>NZ_CP010951.1|WP_158513875.1|1777359_1778637_+|trypsin-like-peptidase-domain-containing-protein
MQAAWAALAACTMIAAAAHAEVPRVKEVEARTPLALPAGSGGRPLMLRTIKTRFETPPARIGVLQDGLFCSTRGTATWNDKLYQAFNTQLSRTFRAELETAGYPVPVQSDAIFDTPADRERQRSSAQLHVGVLIKDVGANFCVRSGETSGGVYMQLFWQVLQVDTQKVIFETTTEGSYQPGTPEKTPLTTFFVRAFAAASRNLLADERFQAAVLAVPAAAAPQGAATGMEVLKLAGARPGGEALNKNVTLLRAGVATVSNGSGTGTAFFVSDGYLLSNAHVTGDAKIVKVTLTTGRELVGEVVRSDRLRDVVLIKTEASGVPPLPLRTGEANVGDDVYALGSPLGDRFNATLTRGILSGYRTMEDKRYIQSDVAILPGNSGGPLLDAKGTVIGITVMGLGAKGLAGMNFFIPISDALAKLGVEVN
>NZ_CP010951.1|WP_061498035.1|1775909_1777292_+|signal-recognition-particle-protein
MATSALTEKLSRLAKELRGQARITEANVQDMLREVRLALLEADVALPVVRDFIARVKDKAMGQEVLGSLSPGQALVGIVNRELAATMGEGVSDINLAAQPPAVILMAGLQGAGKTTTTAKLAKYLIEKRKKKVLTVSGDVYRPAAIEQLKTVTGQAGAEWFPSSPEQKPVDIARAAVDFARRQYFDVLLVDTAGRLAVDEAMMREIRELHAALNPVETLFVVDAMQGQDAINTAKAFKEALPLTGIILTKMDGDSRGGAALSVRQVTGAPIKFAGVSEKIDGLEVFDAERHAGRILGMGDIVALVEQVTAGVDVQAAQRLAAKVKTGEFDLNDFLAQIQQMKQMGGLSSLMEKLPAQMTAKAGNVDMAKAERDIRRKEGIINSMTPLERRKPELIKATRKRRIATGAGVQVQEVNRLLNEFEQMQGMMKKMKGGGLMKMMKRMGGMGGKGGKGGMPKLPF
>NZ_CP010951.1|WP_061498033.1|1775028_1775826_-|cytochrome-c-biogenesis-protein-CcsA
MILSSASPANVVLSLAAALAYAVPAAAAARLSERGARLALLAAWLLHVLAIAAGLLGDPPRFGFAPALSVTAWLVLTVYAVERQMFPRLQARWALAGLGSAAVLLALVFPGSTLHATASPWLPLHWALGIASYGLIAAAVVHAWLMTRAERDIRQATDPHAGIPLLTLERLTFRFATAGFALLSATLLAGVVFSEYLYGQPARWDHKTIFSLLAWAVFAFLLLGRLRFGWRGRKAVRVLYTGSVLLLLAYAGSRFVLEVILRRAA
>NZ_CP010951.1|WP_061498031.1|1774780_1775029_-|hypothetical-protein
MKFLLLLAVVLVVIWFLRGGARRPDEAGREQAARRAAPPAPSAPQDMVECPVCHVHLPRADALPGPGGQLYCCAEHRLRGEG
>NZ_CP010951.1|WP_082792953.1|1773068_1774883_-|HAMP-domain-containing-histidine-kinase
MPGVPCAPAARRRIARTGRAALLLRRTPAAGRRLNTLAPLTEAPRDGAEERARGSAFDRLWRGFMTARTTIALVLTVLLGALHTLAPALGVTRWLIGLCAGYLLVALAGRVFFVPAPPGRTFDRQWLPTAGADLLAISTLQFLQVASINYSPLFALPVLMSAVLGSSVAALATAAGVALLLLVDVWIQIPHLAPESTELPSRFLQAGLTGVGYFALAFLVNQLAARLAREEQAALRGRRAARTHAQVNELVIEALSEGVLVVDASGRVHAANPAARMLLGLADVASQSSFALAAQAGWEPLRELARQTFELRGPQLRELALDEPAAGRRRMHVRTRLTEESYGEGLCVMFLHDLREMEARLRTEKLAAMGRMSAAVAHEIRNPLAAIAQANALLEEDLREPGLRQLSALVRKNAQRLAQIVEEILDVSRARAAAGGSPPLALDASVAAACKDWAAQTGSGPRLQLSLGAPGVRVRFEPDHLRRVLVNLLDNALRYCGERPDSIRVLTRESADQVNLHVWSDGEPMEASVQRHLFEPFFTSESRSSGLGLFICRELCERHGATMAYQRRIGGTVGTQREGNDFVVTFGPLNARATGNTTFDKINA
>NZ_CP010951.1|WP_061498026.1|1771659_1773069_-|sigma-54-dependent-Fis-family-transcriptional-regulator
MSATSTAQVLVVDDEPDLRTLYELTLLREGYRVDAAGSVAEAWQQLEAKRFDAVITDMRLPDGQGLELLQRMSQQQRPERCIVMTAYGSAENAVEALKAGAFDYLTKPVDLRQFRNVVASAIQEVTPARGRVAARTAAPAERPTGGDAALQRLVGESQAVRAVKERVAKVARSMAPVLVRGESGTGKELVARAIHACSHRADAPFVAVNCSAIPEALLEAEFFGAKKGSYTGSAADREGYFQAARGGTLFLDEIGDLPLPMQSKLLRAIQERQVRPLGSTQEDAVDVRIVSATHKDLVADVQAARFRQDLYYRLNVIEIVVPPLRERREDLPRLCEALLARIAQDTGVPAPVLTPEVMAQLWAHPLGGNVRELENLLHRAVALSDGHEMHLDLEPAAAPALAPEPEMPNDLQAWLDQKERDVLVKALQDSGFNRTAAAQRLGLTLRQIRYRIARLQIPVPGGADEGDDA
>NZ_CP010951.1|WP_061498024.1|1771094_1771667_-|1,6-anhydro-N-acetylmuramyl-L-alanine-amidase-AmpD
MPESGALWDAGWYRFARRLDSANFGPRPAGAQVDLIVLHSISLPPGEYGGDAVQQLFTNTLDWDAHPYFKSIEGLEVSSHFYIRRDGQLWQFVDCDHRAWHAGASSWRGRANCNDDSIGIELEGLEGASFEPPQYETLAQLCAALAQRYPIAHVAGHEHIAPGRKCDPGPGFDWAELRRSLGWPGEQFAA
>NZ_CP010951.1|WP_061503748.1|1780977_1781982_-|asparaginase
MASLVPLFESHRGGTLESVNFGAVAVCDSQGRVLGAAGDPHWLTFTRSTLKPLQALPFLQSGGAQALGFTASNIALLCASHSGEPMHVEQVQQMLDKAGVGLRRLQCGCHVPYYVEQGVGAAPAAFDERHHNCSGKHTGFLAHCVHRGWPLDSYLEPAHPLQQEVRRDVARAVGLSEGELRMGIDGCSAPNYAMPLAHLARGYARLARGAADGEFGASFAALAGAMGEFPELGSGTGRNDLAFMRAGGGDWLSKAGADGVQVVASKSRGQAVAVKIADGGKLAAAAVTVAALDQLGWLDGHQREELRPWRAQEILSVRGAPVGERKTAFRLAPA
>NZ_CP010951.1|WP_061498040.1|1781990_1782482_-|hypothetical-protein
MAFRGRFTADAQLGRLARWLRALGFDCAYDESLPGRQQLQQSRQQGRILLTRNRVLLREQKPASAFEVRGDDPLEQLRQVVTAMALPPPVQLYTRCMLDNAELGPPLPPAQADALVPAGVRGIPGPVRQCPVCGRVYWQGSHVRRMRAALERVLPGWLPEGIG
>NZ_CP010951.1|WP_082792957.1|1782499_1783222_-|SOS-response-associated-peptidase-family-protein
MCNRYRPASVTYVRDVFGFTLIKEREGESYNTEGIGPWQNGPFVHSRGLDIGQWGLIPWFSRTRRPTGKLGQPISTNNCRIETVATAPSFKEPWARGQRCLIPAADYDEPYWGTGRNIWWRFRRRDGQAWALAGLWNEWTDPASGELVVSYTMLTQNCDSHPLLALMHKPDPTLPPDAQDKRSVIPVERQHWDTWLNGSVDEAMALVRLPEAGLFEHGAADPAQQVPLGDASEQGQQNLI
>NZ_CP010951.1|WP_061498042.1|1783245_1784211_-|AEC-family-transporter
MLAILQVTFPFFALVLCGYIAARQRLLPFDAIPGLNTFVLYFALPCMLYRFGANTPIAQLLDVVAGAVYLACALLLVAGVVWTSRGPRIGWNDAAFGALVAAFPNTGFMGVPLLVALLGAQAAGPAILTILIDLVITSSLCIALSRLDAAGAHGAEVAAKNALKGVALNPMPWAIALGGAASALQLEPVKPVGQTIGLLADAASPVALFTIGAVLARSQHVAAMMQHEPHPWRDFLPVALVKLLLHPLLVWGAGHAAIAAGAPLRPESLTVMALVAALPSASNVALLAERFHADTGRIAKIILLTTAAAFLTFSGAVALLR
>NZ_CP010951.1|WP_061498045.1|1784297_1786370_+|UvrD-helicase-domain-containing-protein
MSAGLNLAQQEAVNHLHGPCLVLAGAGSGKTRVITHKIARLIQTGLEAKRIAAITFTNKAAAEMRERAKGLVGKGAKEVVICTFHALGVRMLRQDGAALGLKPQFSILDSDDVTAILKDAGGTTDAATARQWQWAISLWKNMGLTAAQAEAQAADDNERITARIMARYEERLAAYQSVDFDDLIGLPLKLLQNHAEVREKWQALLGHVLVDEYQDTNATQYELLKLLVGGHGRFTAVGDDDQSIYGWRGATLDNLKKLPQDFPKLKVIKLEQNYRSTSAILRAANNVIGPNPKLFPKTLFSELGEGEPVRIVDCDNEEHEAERAVARIQSIRANGLGKDWKDFALLYRANHQAKVFEQALRKAQIPYKVSGGQSFFDRAEIKDLCAWLRLIVNNDDDPAFLRAVTAPKRGIGHQTLQNLGVFAGKYKLSLFEALFSSSLGSALSTRAVGGLHEFGRYVNDLEYRARHTSGAEDARAFLTDWLRDIGYEKHLYESEDSEKLAASRWTNVLDFCDWMAQRCGGQIDDTAGVTTSSEKKTLMEVAQTISLLSTISEREQDQNLVTLSTLHAAKGLEWPHVLLIGVNEGLLPFKLDDDDGAKGQANEGILQRLQEERRLMYVGITRAQRSLAVSWTRRRKKGREMVAAQPSRFIAEMALEKATTREDPREKLKALRAEFAKKAQDSAASTAANG
>NZ_CP010951.1|WP_061498047.1|1786366_1786771_+|hypothetical-protein
MRRWLACACIAAAGPALAQAPAACPSAPEVAQQHLLGTWKAEIEGERAPLTLVLVKHPEYAETVRGTLKRAGRIIQLAGDVLEGELTLEESVNGLNISATWLGDVVEGSCGREVRGEWKAEGNPRALAFVLRKQ
>NZ_CP010951.1|WP_061503749.1|1786816_1787608_-|exodeoxyribonuclease-III
MFKLTSLNLNGIRSAAGKGVEDWVARTRPDCICVQEVKAQAPDIEGRFEQLAGLTGHFHFAQKKGYSGVAVYSKHAPSDVIVGFGSPEFDAEGRYVELRFDTPQRKFSVISCYFPSGSSGEERQQAKFRFLDEFDPHLVRLKAQREFVLCGDVNIAHKEQDLKNWKGNRKNSGFLPEERAWMGKILSETGLVDVYRQLQPETTEACYTWWSNRGQAYAKNVGWRLDYHLATPTVAALARSESIYKTERFSDHAPITVDYEFKL
>NZ_CP010951.1|WP_061498049.1|1787618_1788302_+|orotate-phosphoribosyltransferase
MGASSTGRDELAQEFVQFSVEAGVLRFGEFKTKAGRLSPYFFNAGLFDDGAKLGRLAQFYARRILASGIEFDMLFGPAYKGIALAAAVAIELARLGRNVPYAYNRKEAKDHGEGGMLVGAPLAGKVMIIDDVISAGTAVRESIALIAQAGARPHAVAIALDRQEKATEGGHDVDHSAVQYVQRHLGLEICAIARLADLLQYLENHSGDALGDYHRQVLAYRQRYGVD
>NZ_CP010951.1|WP_061498051.1|1788312_1788972_+|DUF4124-domain-containing-protein
MDVRRCLIRFTIAGTAAVVAQAATAQGSIFSCVDAKGRRLTSDRPIAECNDREQQELSPGGRVVRKLGPSLSADERAAEDEKARKAAEERNRQAEEKKRARALLARYPDPAAHDRERSAQLATVDTVIATANRRVADLGVERRKLDTELEFFKGDVSRAPPKFKRQVEDLEQQLAAQKRFIVNQEGEKQRINARFDEERGRLKEPWAQHKADAAASAAR
>NZ_CP010951.1|WP_158513876.1|1789100_1790264_+|AraC-family-transcriptional-regulator-ligand-binding-domain-containing-protein
MINSPRIAGPATHERAGKILRHPAPAIDLPLVPPVYLRVLVASARAEGFDLAARLAALGLDAAALRERDEGVPLSTWRQLLRDLQRQARRSSVTIRAGYRVPLPAHGPLGYLMACARDQRQALEALVRFAPLRLAVLDLKLHEHPDGVELHAEPRVALGDVERFTLDFLWAMVCRMLEDLCRGAAGAMTLRLPPSRTEATPVWAELGVGVGPGSSSNMALQLPHALVDAALPTASASEYQRAWRACEEAEREQGWTKSLAAQIEQLFRTGSAASYSLEWVAARLGMSRRTVMRRLAGEGTQFSALVDASRQQRLLRRLSERHLTLGEIAVDLGYADGSAFSRAVQRWFGIGPRALQRAVVEGRRVSVAARDRYTDASPKIKLLAPND

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP010951_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010951_3

3085653-3085751

Orphan

Consensus_repeat	Method
CGCCCTGCGGGCTGCGGTGCTATGAGCCTTCGGAGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP010951_3

>merge|NZ_CP010951|3|3085653-3085751|CRISPRCasFinder
CGCCCTGCGGGCTGCGGTGCTATGAGCCTTCGGAGCGGCCGGGCGGCTCATTGGATAACCTCCGCCCTGCGGGCTGCGGTGCTATGAGGCTTCGGAGCG

>NZ_CP010951|3|3|3085653-3085751|CRISPRCasFinder
CGCCCTGCGGGCTGCGGTGCTATGAGCCTTCGGAGCG	GCCGGGCGGCTCATTGGATAACCTC
CGCCCTGCGGGCTGCGGTGCTATGAGGCTTCGGAGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010951.1\|WP_061500894.1\|3084888_3085641_-\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270916
NZ_CP010951.1\|WP_061500877.1\|3075971_3077036_-\|chemotaxis-response-regulator-protein-glutamate-methylesterase	unknown	unknown	gnl\|CDD\|234828
NZ_CP010951.1\|WP_061500909.1\|3094108_3094855_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187626
NZ_CP010951.1\|WP_061503846.1\|3092187_3092898_-\|FadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225097
NZ_CP010951.1\|WP_061500881.1\|3077647_3078475_-\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|236725
NZ_CP010951.1\|WP_061500907.1\|3092984_3094106_+\|mandelate-racemase/muconate-lactonizing-enzyme-family-protein	unknown	unknown	gnl\|CDD\|239432
NZ_CP010951.1\|WP_061500885.1\|3079752_3081090_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|185001
NZ_CP010951.1\|WP_061500896.1\|3085761_3087360_-\|protein-kinase	unknown	unknown	gnl\|CDD\|270916
NZ_CP010951.1\|WP_061500883.1\|3078486_3079725_-\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|185001
NZ_CP010951.1\|WP_158513908.1\|3081620_3083543_-\|chemotaxis-protein-CheW	unknown	unknown	gnl\|CDD\|223716
NZ_CP010951.1\|WP_061503845.1\|3081101_3081596_-\|chemotaxis-protein-CheW	unknown	unknown	gnl\|CDD\|182587
NZ_CP010951.1\|WP_061500902.1\|3090593_3091169_-\|TRAP-transporter-small-permease	unknown	unknown	gnl\|CDD\|225632
NZ_CP010951.1\|WP_061500904.1\|3091173_3092157_-\|sialic-acid-TRAP-transporter-substrate-binding-protein-SiaP	unknown	unknown	gnl\|CDD\|270390
NZ_CP010951.1\|WP_061500911.1\|3094851_3095598_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235546
NZ_CP010951.1\|WP_061500900.1\|3089173_3090568_-\|TRAP-transporter-large-permease	unknown	unknown	gnl\|CDD\|224509
NZ_CP010951.1\|WP_061500913.1\|3095619_3096468_+\|fumarylacetoacetate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223257
NZ_CP010951.1\|WP_061500890.1\|3083623_3083986_-\|response-regulator	unknown	unknown	gnl\|CDD\|381110
NZ_CP010951.1\|WP_061500892.1\|3084001_3084892_-\|response-regulator	unknown	unknown	gnl\|CDD\|381099
NZ_CP010951.1\|WP_061500879.1\|3077032_3077635_-\|chemoreceptor-glutamine-deamidase-CheD	unknown	unknown	gnl\|CDD\|237396
NZ_CP010951.1\|WP_061500898.1\|3087642_3089157_-\|altronate-dehydratase	unknown	unknown	gnl\|CDD\|377287

Protein	Function_ID	Function_description	E-value
NZ_CP010951.1\|WP_061500894.1\|3084888_3085641_-\|serine/threonine-protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	2.5855e-68
NZ_CP010951.1\|WP_061500877.1\|3075971_3077036_-\|chemotaxis-response-regulator-protein-glutamate-methylesterase	gnl\|CDD\|234828	PRK00742, PRK00742, chemotaxis-specific protein-glutamate methyltransferase CheB.	6.36456e-166
NZ_CP010951.1\|WP_061500909.1\|3094108_3094855_+\|SDR-family-oxidoreductase	gnl\|CDD\|187626	cd05368, DHRS6_like_SDR_c, human DHRS6-like, classical (c) SDRs. Human DHRS6, and similar proteins. These proteins are classical SDRs, with a canonical active site tetrad and a close match to the typical Gly-rich NAD-binding motif. Human DHRS6 is a cytosolic type 2 (R)-hydroxybutyrate dehydrogenase, which catalyses the conversion of (R)-hydroxybutyrate to acetoacetate. Also included in this subgroup is Escherichia coli UcpA (upstream cys P). Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction. Note: removed : needed to make this chiodl smaller when drew final trees: rmeoved text form description: Other proteins in this subgroup include Thermoplasma acidophilum aldohexose dehydrogenase, which has high dehydrogenase activity against D-mannose, Bacillus subtilis BacC involved in the biosynthesis of the dipeptide bacilysin and its antibiotic moiety anticapsin, Sphingomonas paucimobilis strain B90 LinC, involved in the degradation of hexachlorocyclohexane isomers...... P).	1.82462e-115
NZ_CP010951.1\|WP_061503846.1\|3092187_3092898_-\|FadR-family-transcriptional-regulator	gnl\|CDD\|225097	COG2186, FadR, Transcriptional regulators [Transcription].	6.67637e-53
NZ_CP010951.1\|WP_061500881.1\|3077647_3078475_-\|methyltransferase-domain-containing-protein	gnl\|CDD\|236725	PRK10611, PRK10611, protein-glutamate O-methyltransferase CheR.	1.84597e-102
NZ_CP010951.1\|WP_061500907.1\|3092984_3094106_+\|mandelate-racemase/muconate-lactonizing-enzyme-family-protein	gnl\|CDD\|239432	cd03316, MR_like, Mandelate racemase (MR)-like subfamily of the enolase superfamily. Enzymes of this subgroup share three conserved carboxylate ligands for the essential divalent metal ion (usually Mg2+), two aspartates and a glutamate, and conserved catalytic residues, a Lys-X-Lys motif and a conserved histidine-aspartate dyad. Members of the MR subgroup are mandelate racemase, D-glucarate/L-idarate dehydratase (GlucD), D-altronate/D-mannonate dehydratase , D-galactonate dehydratase (GalD) , D-gluconate dehydratase (GlcD), and L-rhamnonate dehydratase (RhamD).	1.29923e-112
NZ_CP010951.1\|WP_061500885.1\|3079752_3081090_-\|hypothetical-protein	gnl\|CDD\|185001	PRK15041, PRK15041, methyl-accepting chemotaxis protein.	1.90928e-107
NZ_CP010951.1\|WP_061500896.1\|3085761_3087360_-\|protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	3.21822e-88
NZ_CP010951.1\|WP_061500883.1\|3078486_3079725_-\|HAMP-domain-containing-protein	gnl\|CDD\|185001	PRK15041, PRK15041, methyl-accepting chemotaxis protein.	6.7561e-102
NZ_CP010951.1\|WP_158513908.1\|3081620_3083543_-\|chemotaxis-protein-CheW	gnl\|CDD\|223716	COG0643, CheA, Chemotaxis protein histidine kinase and related kinases [Cell motility and secretion / Signal transduction mechanisms].	0
NZ_CP010951.1\|WP_061503845.1\|3081101_3081596_-\|chemotaxis-protein-CheW	gnl\|CDD\|182587	PRK10612, PRK10612, chemotaxis protein CheW.	9.06278e-65
NZ_CP010951.1\|WP_061500902.1\|3090593_3091169_-\|TRAP-transporter-small-permease	gnl\|CDD\|225632	COG3090, DctM, TRAP-type C4-dicarboxylate transport system, small permease component [Carbohydrate transport and metabolism].	2.44688e-30
NZ_CP010951.1\|WP_061500904.1\|3091173_3092157_-\|sialic-acid-TRAP-transporter-substrate-binding-protein-SiaP	gnl\|CDD\|270390	cd13672, PBP2_TRAP_Siap, Substrate-binding domain of a sialic acid binding Tripartite ATP-independent Periplasmic transport system (SiaP); the type 2 periplasmic-binding protein fold. This subfamily represents the periplasmic-binding component of TRAP transport system SiaP, a sialic acid binding virulence factor. TRAP transporters are a large family of solute transporters ubiquitously found in bacteria and archaea. They are comprised of a periplasmic substrate-binding protein (SBP) and two unequally sized integral membrane components: a large transmembrane subunit involved in the translocation process and a smaller membrane of unknown function. The driving force of TRAP transporters is provided by electrochemical ion gradients (either protons or sodium ions) across the cytoplasmic membrane, rather than ATP hydrolysis. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.15044e-132
NZ_CP010951.1\|WP_061500911.1\|3094851_3095598_+\|SDR-family-oxidoreductase	gnl\|CDD\|235546	PRK05653, fabG, 3-oxoacyl-ACP reductase FabG.	4.59428e-91
NZ_CP010951.1\|WP_061500900.1\|3089173_3090568_-\|TRAP-transporter-large-permease	gnl\|CDD\|224509	COG1593, DctQ, TRAP-type C4-dicarboxylate transport system, large permease component [Carbohydrate transport and metabolism].	1.73731e-134
NZ_CP010951.1\|WP_061500913.1\|3095619_3096468_+\|fumarylacetoacetate-hydrolase-family-protein	gnl\|CDD\|223257	COG0179, MhpD, 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Secondary metabolites biosynthesis, transport, and catabolism].	7.24704e-101
NZ_CP010951.1\|WP_061500890.1\|3083623_3083986_-\|response-regulator	gnl\|CDD\|381110	cd17562, REC_CheY4-like, phosphoacceptor receiver (REC) domain of chemotaxis response regulator CheY4 and similar CheY family proteins. CheY family chemotaxis response regulators (RRs) comprise about 17% of bacterial RRs and almost half of all RRs in archaea. This subfamily contains Vibrio cholerae CheY4 and similar CheY family RRs. CheY proteins control bacterial motility and participate in signaling phosphorelays and in protein-protein interactions. CheY RRs contain only the REC domain with no output/effector domain. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	1.56753e-53
NZ_CP010951.1\|WP_061500892.1\|3084001_3084892_-\|response-regulator	gnl\|CDD\|381099	cd17546, REC_hyHK_CKI1_RcsC-like, phosphoacceptor receiver (REC) domain of hybrid sensor histidine kinases/response regulators similar to Arabidopsis thaliana CKI1 and Escherichia coli RcsC. This family is composed of hybrid sensor histidine kinases/response regulators that are sensor histidine kinases (HKs) fused with a REC domain, similar to the sensor histidine kinase CKI1 from Arabidopsis thaliana, which is involved in multi-step phosphorelay (MSP) signaling that mediates responses to a variety of important stimuli in plants. MSP involves a signal being transferred from HKs via histidine phosphotransfer proteins (AHP1-AHP5) to nuclear response regulators. The CKI1 REC domain specifically interacts with the downstream signaling protein AHP2, AHP3 and AHP5. The plant MSP system has evolved from the prokaryotic two-component system (TCS), which allows organisms to sense and respond to changes in environmental conditions. This family also includes bacterial hybrid sensor HKs such as Escherichia coli RcsC, which is a component of the Rcs signalling pathway that controls a variety of physiological functions like capsule synthesis, cell division, and motility. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	2.20242e-29
NZ_CP010951.1\|WP_061500879.1\|3077032_3077635_-\|chemoreceptor-glutamine-deamidase-CheD	gnl\|CDD\|237396	PRK13487, PRK13487, chemoreceptor glutamine deamidase CheD; Provisional.	3.44836e-92
NZ_CP010951.1\|WP_061500898.1\|3087642_3089157_-\|altronate-dehydratase	gnl\|CDD\|377287	pfam04295, GD_AH_C, D-galactarate dehydratase / Altronate hydrolase, C-terminus. Family members include the C termini of D-galactarate dehydratase (EC:4.2.1.42) which is thought to catalyze the reaction D-galactarate = 5-keto-4-deoxy-D-glucarate + H2O, and altronate hydrolase (altronic acid hydratase, EC:4.2.1.7), which catalyzes D-altronate = 2-keto-2-deoxygluconate + H2O. As purified, both enzymes are catalytically inactive in the absence of added Fe2+, Mn2+, and beta-mercaptoethanol. Synergistic activation of altronate hydrolase activity is seen in the presence of both iron and manganese ions, suggesting that the enzyme may have two ion binding sites. Mn2+ appears to be part of the enzyme active centre, but the function of the single bound Fe2+ ion is unknown. The hydratase has no Fe-S core.	0

>NZ_CP010951.1|WP_061500894.1|3084888_3085641_-|serine/threonine-protein-kinase
MSAARYRIEKLLGQGRHASLWRAMDVDRRERVALKVASRGCLRREFDTLQENQDGHAVKAHDCGVLPDGRPYLAMEYVDHGDLAHAPLPEGGAARALNDAALALAGVHRRGWVHRDIKPAHLLLRANGQVVLCDFGSACRAGAREDRAAPSLVGTPRYAAPEQMEGAAASTAADVYSLGICAFELLAGKPPFRGETLTELFSQHLRAPVPRLPPGAAHWQSLVDAMLAKHPASRPADGDAVLAVLRENHS
>NZ_CP010951.1|WP_061500892.1|3084001_3084892_-|response-regulator
MSLDDQYLVDVIGFNEVERSMLSSIFALAARRDPGFGQYEPGAAGRTPDLYLVDADDPGAVSEFRALHKRAPLPAVLVGTSTHGTSHTLLPRPLQWARLLQALEDALPAGGQASPDELALSRPGSGPDPRRTLSSTDSLSRSIPRPNAPRAAPPAPAQAKRLVTDSVLVVDDNATVRAFMQAKLEPYGFDVDFAESGEEAIGLSGNSEYTCVFLDVVLPGIDGYQVCKLIKSNKQAIKKTAVVMLTSRSSPFDKLRGSIAGCDEYLTKPLDEDRLLEVIAKFLPGSRKRAERAEGR
>NZ_CP010951.1|WP_061500890.1|3083623_3083986_-|response-regulator
MSKSILVVDDTRSMRKMVAAVLAGAGYEVAEAADGVDALELARGRRFDLVVTDHNMPRMDGVTLVRELRAIADYDPVALIVLSTEVDPAVKQRGREAGATGWMAKPFDPQRMLDIVAKFI
>NZ_CP010951.1|WP_158513908.1|3081620_3083543_-|chemotaxis-protein-CheW
MADVEAILLRLEPQAPCLPELNAIFRAIHSIKGSASMLDCVDIAQMAHLQENLLDLLRKQERLLEAGDIQAMLKSGDVMRAQALRHRGDIEHAPDSGSAQALLREQLDRPRADAVDGAAGPVRRRFSVRLGPLEQAIDAADLDMTLAGLGEMGQLATPAIENCEGGSIAFEVELEGTADDLRSVLALIVAPELVWVEKIEASPALAPRHSYRDGEHDEFFVDPDEFRRKRAELLQDEGEDDAAGPSVMAADLMQAFFDEVDVPIASRETGHIRVATEKIDQLVNLVGELVITEAMLARSVTESGLADLARHTRNLQEAVLAIRMLPISHAFSRFPRLVHELSGRLGKEVDLKFEGESTELDRGLIEKISDPLTHLVRNAVDHGLEAPDIRTAEGKSATGTLLLAARQRGGNIVIEVSDDGRGLDRERILQQARRCGIAIAPDAPDQEVWELVFAPGFSTAESVTELSGRGVGMDVVRRNIKALGGTIDLRSQAGEGTAVTVSVPLTLAIIEAMIVAIGGAVYVLPIAAVIETLSVEPGDIHTLPGQGDTLRVRESYLPVIHLARIFPPPHPRSQAGGIAIIVDADGRQAALVVDDVVGQQQVVVKSLEANFRKVPGLSGATVMGDGSVALILDVAHIVRM
>NZ_CP010951.1|WP_061503845.1|3081101_3081596_-|chemotaxis-protein-CheW
MPSLSARHAREVVVPKKEFLTFRLGTESYGIDILKVQEIRGFEQPTIIANAPPFIKGVINLRGVIVPILDLRVKFGLPAVKYDEFTVVIILNVASRVVGVVVDSVSDVLLLTPESIRPTPEFASATFDTKYITGLTDVEDGLLIMLDIEKLMTSADMALVDAAV
>NZ_CP010951.1|WP_061500885.1|3079752_3081090_-|hypothetical-protein
MLKRTSAEIVLRLIFVTFLAGSLLMAWMGFGAMQEAHEAALAALRAGPPDLTQQYAAAAEAREFRLLWLLGAMLAIGVGMVFFFRWWITTVNSAPLRTALRLVRRVADGDLTASTEGEDFRHVQRFAEALDQMTAGLRKLAIEVAHSANTVANTSTQIAHGNLDLSQRTEEQASTLEETASSMEELTSTVAQNAENARQASDLAVEASEVARRGGHAVSQVVSTMNGIADSSRKIGDIIGVIDSIAFQTNILALNAAVEAARAGEQGRGFAVVASEVRTLAQRSATAAKEIKSLIGDSVGRVEAGTRQVDAAGKTMDEIVSSVNKVSILIAEIAAASREQSAGIGQVNSAVAQMEQVVQQNASLVEEASAATESMKEQAAVLLQAVGRFRVGDEAPGRRAEPTPITPIAPVKVKPAGGATLQPAPPASLNGARPALASSGQWEEF
>NZ_CP010951.1|WP_061500883.1|3078486_3079725_-|HAMP-domain-containing-protein
MARISVITKLNAWLALLVGMVASMAGIALYVQDPSGDRQMLAITLGALVLFTVVAGVGLRLSVREGILRSIRDAAQVVTRVANGDLTARVTVSAHGETQRLLEGLEKMTRDLQALVGGVTHAAGTVAATSAQIAQGNLDLSQRTEEQASTLEETASSMEELTSTVAHNAENAAQASQLAVEASDVARRGGQVVGQVVSTMNGISDSSRRIGDIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVASEVRSLAQRSAAAAKEIKALIGDSVARVEAGTRQVDAAGKTMDEIVSSVNKVSILIAEIAAASREQSAGIGQINSAVAQMEQVVQQNASLVEEASAATESMKDQAAVLLQTVARFHVGDEAPAGRAPPTPITPITPAPARTGSRSGAGGQRPALGSPGQWEEF
>NZ_CP010951.1|WP_061500881.1|3077647_3078475_-|methyltransferase-domain-containing-protein
MATPEVEAPAQLNPSEFDLACSLIAQYAGIKLGPHKRYMVYNRLVRRLRAHAMRDFGQYLQLVQTDVMGEREAFVNALTTNLTAFFREPHHFDLLAERAKLHQHNQRRPMRIWSCACSTGEEPWSIAMTLREAGCDAQVVASDIDTDALEKAASGVYAADRIADLPASRLRGHFLRGTGANDGRVMVRPELRSMVKFGQLNLQSPRWPAMEAFDAVFCRNVTIYFDREAQKKLLERLAQVLRPGGVLVVGHAESFPATHRSFRGCGRTAYEYLPA
>NZ_CP010951.1|WP_061500879.1|3077032_3077635_-|chemoreceptor-glutamine-deamidase-CheD
MEHLHPTRYFDRELRVHSVKILPGQYYAAAGDGSISTLLGSCVSTCLWDPLLKIGGMNHFMLPGESSPAASPWAVSARFGVYAMEVLINEMIHLGADRRRLVAKVFGGAQVLQGFDKLDVGAMNVRFVLDFLREEAIPIAGQDLLGSSPRKLHFFPANGKAQVKRLHLQPTDAALQQEREYFDGLSHAGGGEVELFEAPR
>NZ_CP010951.1|WP_061500877.1|3075971_3077036_-|chemotaxis-response-regulator-protein-glutamate-methylesterase
MIRVLVVDDSAVMRAFLASVIEAQPDMEVAGVVSDPVLAVDRIRRHAPDVITLDVEMPRMNGLDFLRNLMAVRPLPVVMISSLTRDGAETTMRALELGAVDFVAKPASPSEFESVGPIIAEKIRTAAQAQVARRHRPAAQPHAPRAKTFGAVAGTLGTIIGIGASTGGVEALRGILPQLPADIAPVLIAQHMLPGFTPAFARRLDSLCEIAVKEAEEGEVPLAGVAYIAPGGRHLMLARRASTYVLRLSDEPPVNRHRPSVDTLFRSMAAAAGDDAIGVLLTGMGEDGAQGLLALRRARAATIAQDETTCVVFGMPRQAIELGGAGEVLRLPDIAPRLRLLARATTRNSRFSEI
>NZ_CP010951.1|WP_061500896.1|3085761_3087360_-|protein-kinase
MPLESFQPADEPFPPTDVAPLEPLRPSQEPAPVVAVRAEPEAQLATFMYARVRNFGVTCDSMAGAELTAWVNDVRRVLQRAAVELDGVIAQRKPDSILCVFSHRPDEAVPSHAKRALHAAILTVHACTVLADRIAARPQSQGLPPLSVAIGVHLGVAEVSPRPSNPGMVHAVGEAVEIARLLEVVAADLHWSIAASFGTRQAAGARVDSGRSGTLGLPDETFLEVVEIAGLVPRLGSTTSEQHYALLRESLQKNQQLSRTNGNAGGGGGHMLIEGYRLLRKIGQGGVATVYLAQPIHGGPAQVLKVLRLGSGAADMDLQRFITEFALLAQIEHPNVARIFKQDFSAGCAYIAMEYFPLGDLRSHMRKAIDPAIALYYVRQIAAGLESIHRIGIVHRDLKPHNVMLRQDGILAIADFGIAKQVSMKLTDTGAGEIIGTPYYISPEQALGHPVDARADLYSLGVMAYEMLTGQRPYQAPSAQELLDLHLHAPLPALPAHLRHLQPVLDRMMAKDPQQRYASATELLEVLMGIGA
>NZ_CP010951.1|WP_061500898.1|3087642_3089157_-|altronate-dehydratase
MTPFIRLHPQDDVLIARAQLVSGARAGDVVVKGLIPPGHKVAVRDIAAGQPVRRYNQIIGFASRPIAAGEHVHTHNLAMGDFERDYAFGADLKPEPATREASFLGFKRADGRVATRNYIGILSSVNCSATAARAIADHFSRQANPGALEAFPNVDGVVALTHGTGCGMDTEGLGMRVLERTLAGYATHANFWGVLVVGLGCEANQINAWLAHSSLREGEQLRVFNIQDTGGTRKTVERGIAMVREMLPGANACRREPCSAAHITIGLQCGGSDGYSGISANPALGAAVDLLVAHGGTAILSETPEIYGAEHLLTRRAVTQEVGDKLISRIRWWEHYTKVNEGEMNNNPSPGNKAGGLTTILEKSLGAVAKGGTTNLRAVYEYAEPVTQHGFVYMDTPGYDPVSATGQVAGGANMICFTTGRGSAYGCAPSPSLKLATNTALWQRQEEDMDINCGEIIDGKASIQEMGQRIFELVLATASGAATKSELHGYGQNEFVPWQLGAVM
>NZ_CP010951.1|WP_061500900.1|3089173_3090568_-|TRAP-transporter-large-permease
MLKVLFLLLMGGGIPVAIAMAGSALLFILWSGNLPPFVVIHRMVSGIDSFPLLAVPFFILAGNLMNNAGITNRIYNFALALVGWLKGGLGHVNVLGSVIFAGMSGTAIADAAGLGTIEIKAMKDHGYSTEFAVGVTAASATLGPIIPPSLPFVIYGMMANVSVGALFLAGILPGALMAVLMMLTVAYYAHKNGWGADIKFDWTRLTKALAETAVVIGWPLVLWLLVDKAGAPAQATVLTGLVLLFVADKMFKFQAVLPIMTPVLLIGGMTTGLFTPTEGAIAACVWSMVLGLFWYRTLTWKMFVKVCLDTVETTSTVLFIVAAASIFGWMLTATGVTSAISSWVLSFTQEAWVFLLLANLLMLFVGCFLEPTAAITILVPILMPICQQLGIDPVHFGLVMVLNLMIGLLHPPMGLVLFVLARVAKLSVERTTVAILPWLAPLLGSLVIITYFPKLVLWLPKQFF
>NZ_CP010951.1|WP_061500902.1|3090593_3091169_-|TRAP-transporter-small-permease
MSTSSIDELPRVMGADGEFHAQDEAVDLSGTAPEAWVALGFFWLLGAVVFHQFFTRYVLNNSAAWTEEVARYLLIATVFTGATIGVVKNNHIQVDFFYRYMPRWMARAAATVVDVLRIGFFAAAVVLTVLMMLKLGSSSRMTMVDLPMNWIYGVCLAGFAAMTVRSVLVMRTHLKRGYSVLERPESNIDDR
>NZ_CP010951.1|WP_061500904.1|3091173_3092157_-|sialic-acid-TRAP-transporter-substrate-binding-protein-SiaP
MKKRLTLKLAATCALLAAAMPFAAQAQTKLKFAHVYETSEPYHKWAVWAADELKKRTAARYEMQVFPASTLGKETEINQGLTLGTVDVIYTGQAFAARTYPPIAIGGAPFMFRDFSHWKAYAASPVLQGLMDEYAKKGGNRPIAVTYYGVRHTTANKAINKPEDMAGLKLRVPDAPLYVLYPKVVGANATPIAFAEVYLALQNKTVDAQENPLPTIEAKKFYEVQSHINLTGHITEMLLTIVSGPVWNKMSDADKKTFEAVFKEAAAKCTDDIAQAETKLVETFATQYKKTVVKSDRAAFSAAFQKFHLGPDASWDKALYDKVQALK
>NZ_CP010951.1|WP_061503846.1|3092187_3092898_-|FadR-family-transcriptional-regulator
MELRAAEPQRLYRQIAEQLRTLIAGGEFTPGTRLPAERELAAQLGVSRPSAREALIALEVEGWVEVRPGSGVYVVDRRGARTTAKVPPNEWGPLELLRARRVVEGEVAALAAAHAKRKHLQAIRDAIRAMKDEADRNVQPVMGDRAFHTAVAAACDNVVLLETVQTYWDARHGPLFERLGGHFETVPSWRTAIAEHELVLEAIASRDPQAAREAMHHHLEKAHARFSASWRRANTS
>NZ_CP010951.1|WP_061500907.1|3092984_3094106_+|mandelate-racemase/muconate-lactonizing-enzyme-family-protein
MLSPLPVIERVTIRQLDLPPKVVRTDAIQSFVTQETLLLTLHVSDGIDATGYAYTIGTGGSSVVALLRDHLAPRLLGRAPLDVEAIWKDLFFHTHATAVGAITSLALACVDTALWDWRARSQALPLWRLLGGAQPRVPLYTTEGGWLHLSAGELVEQTLAAREQGFLGAKIKIGRPHPSEDRARLEAVRDAVGPGFELMTDANQGLTRPAAARRAKLFEGLDLAWIEEPLPAEDVAGHRQLREHTTIPVAVGESIYHLAQFREYLEQGACSIVQPDVARIGGITPWLKVAHLAEAFVVPVCPHFLMELHVSLCAGVPNAAWVEYIPQLDDITTSRLVIEDGHARPPDTPGLGIEWDWEAIARRAHVNLSIDGR
>NZ_CP010951.1|WP_061500909.1|3094108_3094855_+|SDR-family-oxidoreductase
MRLEGKTALVTAAGQGMGHAAALAFAAEGAQVWATDVDPKLLERFEGVAGIRAVPLDVLDKAAIQRVVASMPAIDVLFNCAGFVHNGTVLQATDEEWNFALDLNVRSQFWAVQAALPRMLANDGGKGAGSIINMASVCSSIKGLPNRFIYGVSKAAVLGLTKSVAADYVTQGIRCNAICPGTVDTPSLQDRINANPDPVAARQAFIARQPMGRLAQAEEIVPLIVYLASDESRFATGQSFAVDGGITI
>NZ_CP010951.1|WP_061500911.1|3094851_3095598_+|SDR-family-oxidoreductase
MNQLDFQGRHAVVTGGAAGLGLAIAARLVRSGGSVTLWDRDGAAAQQAATHLGGNTSWVGVDVADPADVERAVQSTLQAAGRIDALVNSAGITGPNTRLWEYPVADWRQVMDVNLNGLFLCCRQVVPVMRAANYGRIVNIASVAGKDGNPNASAYSASKAAVIALTKSLGKELADTGIRVNCVTPAAVKTAIFDQMTPEHIQFMLSKIPMGRFGTPEEVASLVGWLCTEECSFSTGAVFDLSGGRSTY
>NZ_CP010951.1|WP_061500913.1|3095619_3096468_+|fumarylacetoacetate-hydrolase-family-protein
MKLVRYGNPGKEKPGLIDADGRLRDLSAVVPDIGPAQLGATALAKLRKLNPAKLPAVRGKPRFGCPVTGIGKFVAIGLNYADHAAESGVPIPKEPVVFMKSTSCIQGPDDPVMLPKGSVKTDWEVELGVVIGTRARYVTKKDALSHVAGFCVINDVSEREFQLERGPQWDKGKGCDTFGPIGPWLVTSDEITNVQRLDMWLDVNGKRMQTGNTRTMIFDCAKLVSYVSEFMTLMPGDVITTGTPPGVGLGMKPPTYLKKGDVVTLGIEGLGEQRQLVVPFKR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP010951_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010951_4

3131341-3131466

Orphan

Consensus_repeat	Method
GGGGGGCAGCGAGTACACAAAGTGACGAGCGTGGGGGTGCAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP010951_4

>merge|NZ_CP010951|4|3131341-3131466|CRISPRCasFinder
GGGGGGCAGCGAGTACACAAAGTGACGAGCGTGGGGGTGCATTCAGCCTCCGCCGAGCCGCCTCAAGGAGGCTGAGGCCCCCTTGGGGGGCAGCGAGTACACGAAGTGACGAGCGTGGGGGTGCAT

>NZ_CP010951|4|4|3131341-3131466|CRISPRCasFinder
GGGGGGCAGCGAGTACACAAAGTGACGAGCGTGGGGGTGCAT	TCAGCCTCCGCCGAGCCGCCTCAAGGAGGCTGAGGCCCCCTT
GGGGGGCAGCGAGTACACGAAGTGACGAGCGTGGGGGTGCAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010951.1\|WP_061500974.1\|3138282_3138732_+\|CopD-family-protein	unknown	unknown	gnl\|CDD\|227902
NZ_CP010951.1\|WP_061500958.1\|3131480_3132356_-\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119324
NZ_CP010951.1\|WP_061500970.1\|3137138_3137627_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379326
NZ_CP010951.1\|WP_061500955.1\|3130220_3131297_-\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119323
NZ_CP010951.1\|WP_061503853.1\|3133346_3133760_-\|acyl-CoA-thioesterase	unknown	unknown	gnl\|CDD\|224523
NZ_CP010951.1\|WP_082793225.1\|3120554_3121523_+\|DUF2950-domain-containing-protein	unknown	unknown	gnl\|CDD\|371539
NZ_CP010951.1\|WP_061500962.1\|3133795_3135673_+\|ABC-transporter-ATP-binding-protein/permease	unknown	unknown	gnl\|CDD\|227590
NZ_CP010951.1\|WP_145979465.1\|3135692_3136073_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010951.1\|WP_082793580.1\|3123151_3124093_+\|DUF2950-domain-containing-protein	unknown	unknown	gnl\|CDD\|371539
NZ_CP010951.1\|WP_061500972.1\|3137685_3138129_+\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176904
NZ_CP010951.1\|WP_061500941.1\|3119409_3120552_+\|DUF3300-domain-containing-protein	unknown	unknown	gnl\|CDD\|378701
NZ_CP010951.1\|WP_061500944.1\|3124040_3125204_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NZ_CP010951.1\|WP_061500960.1\|3132481_3133276_+\|crotonase/enoyl-CoA-hydratase-family-protein	unknown	unknown	gnl\|CDD\|236205
NZ_CP010951.1\|WP_082793229.1\|3136047_3136560_+\|DUF1801-domain-containing-protein	unknown	unknown	gnl\|CDD\|227936
NZ_CP010951.1\|WP_082793227.1\|3121656_3123099_+\|DUF3300-domain-containing-protein	unknown	unknown	gnl\|CDD\|378701
NZ_CP010951.1\|WP_061500949.1\|3126631_3128488_-\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|223953
NZ_CP010951.1\|WP_061500951.1\|3128597_3129395_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223487
NZ_CP010951.1\|WP_061500968.1\|3136611_3137127_+\|DUF1697-domain-containing-protein	unknown	unknown	gnl\|CDD\|377954
NZ_CP010951.1\|WP_061500946.1\|3125328_3126501_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380566
NZ_CP010951.1\|WP_061500953.1\|3129414_3130218_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213186

Protein	Function_ID	Function_description	E-value
NZ_CP010951.1\|WP_061500974.1\|3138282_3138732_+\|CopD-family-protein	gnl\|CDD\|227902	COG5615, COG5615, Predicted integral membrane protein [Function unknown].	1.71024e-14
NZ_CP010951.1\|WP_061500958.1\|3131480_3132356_-\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119324	cd06582, TM_PBP1_LivH_like, Transmembrane subunit (TM) of Escherichia coli LivH and related proteins. LivH is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivH forms a heterodimer with another TM, LivM, to generate the transmembrane pore. LivM is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	2.04951e-71
NZ_CP010951.1\|WP_061500970.1\|3137138_3137627_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379326	pfam13673, Acetyltransf_10, Acetyltransferase (GNAT) domain. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	5.27868e-21
NZ_CP010951.1\|WP_061500955.1\|3130220_3131297_-\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119323	cd06581, TM_PBP1_LivM_like, Transmembrane subunit (TM) of Escherichia coli LivM and related proteins. LivM is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivM forms a heterodimer with another TM, LivH, to generate the transmembrane pore. LivH is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	2.52865e-84
NZ_CP010951.1\|WP_061503853.1\|3133346_3133760_-\|acyl-CoA-thioesterase	gnl\|CDD\|224523	COG1607, COG1607, Acyl-CoA hydrolase [Lipid metabolism].	1.54411e-50
NZ_CP010951.1\|WP_082793225.1\|3120554_3121523_+\|DUF2950-domain-containing-protein	gnl\|CDD\|371539	pfam11453, DUF2950, Protein of unknown function (DUF2950). This is a bacterial family of uncharacterized proteins.	9.93466e-136
NZ_CP010951.1\|WP_061500962.1\|3133795_3135673_+\|ABC-transporter-ATP-binding-protein/permease	gnl\|CDD\|227590	COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones].	0
NZ_CP010951.1\|WP_082793580.1\|3123151_3124093_+\|DUF2950-domain-containing-protein	gnl\|CDD\|371539	pfam11453, DUF2950, Protein of unknown function (DUF2950). This is a bacterial family of uncharacterized proteins.	2.90651e-135
NZ_CP010951.1\|WP_061500972.1\|3137685_3138129_+\|SRPBCC-family-protein	gnl\|CDD\|176904	cd08895, SRPBCC_CalC_Aha1-like_2, Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins. SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of a functionally uncharacterized subgroup of CalC- and Aha1-like proteins. This group shows similarity to the SRPBCC domains of Micromonospora echinospora CalC (a protein which confers resistance to enediynes) and human Aha1 (one of several co-chaperones which regulate the dimeric chaperone Hsp90), and belongs to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands.	4.31726e-84
NZ_CP010951.1\|WP_061500941.1\|3119409_3120552_+\|DUF3300-domain-containing-protein	gnl\|CDD\|378701	pfam11737, DUF3300, Protein of unknown function (DUF3300). This hypothetical bacterial gene product has a long hydrophobic segment and is thus likely to be a membrane protein.	4.56021e-124
NZ_CP010951.1\|WP_061500944.1\|3124040_3125204_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	8.36464e-49
NZ_CP010951.1\|WP_061500960.1\|3132481_3133276_+\|crotonase/enoyl-CoA-hydratase-family-protein	gnl\|CDD\|236205	PRK08259, PRK08259, crotonase/enoyl-CoA hydratase family protein.	7.71831e-138
NZ_CP010951.1\|WP_082793229.1\|3136047_3136560_+\|DUF1801-domain-containing-protein	gnl\|CDD\|227936	COG5649, COG5649, Uncharacterized conserved protein [Function unknown].	6.2279e-54
NZ_CP010951.1\|WP_082793227.1\|3121656_3123099_+\|DUF3300-domain-containing-protein	gnl\|CDD\|378701	pfam11737, DUF3300, Protein of unknown function (DUF3300). This hypothetical bacterial gene product has a long hydrophobic segment and is thus likely to be a membrane protein.	2.83419e-124
NZ_CP010951.1\|WP_061500949.1\|3126631_3128488_-\|AMP-binding-protein	gnl\|CDD\|223953	COG1022, FAA1, Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism].	0
NZ_CP010951.1\|WP_061500951.1\|3128597_3129395_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223487	COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism].	2.12226e-120
NZ_CP010951.1\|WP_061500968.1\|3136611_3137127_+\|DUF1697-domain-containing-protein	gnl\|CDD\|377954	pfam08002, DUF1697, Protein of unknown function (DUF1697). This family contains many hypothetical bacterial proteins.	6.34365e-25
NZ_CP010951.1\|WP_061500946.1\|3125328_3126501_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|380566	cd06343, PBP1_ABC_ligand_binding-like, type 1 periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup includes the type 1 periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine-isoleucine-valine binding protein (LIVBP); however its ligand specificity has not been determined experimentally.	1.34059e-131
NZ_CP010951.1\|WP_061500953.1\|3129414_3130218_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213186	cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system. The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).	1.85658e-111

>NZ_CP010951.1|WP_061500955.1|3130220_3131297_-|branched-chain-amino-acid-ABC-transporter-permease
MRFIFKTDYGQDIQLAKHGGQVFWYGLLLVLLAAAPWLFAEYWLAQLTFVLIYAIVGLGLMLLAGFTGLFSIGHAAFLGVGAYTEAVLVNAGWPFPVSLLMAAGLSAAVGVIVGLPALRVKGIYLGIATLAFGFIVEEVLARWESVTGGNAGISVKKPGMFGWTIDSGTGFYFLCLVLAIAATLIILNLLRSPTGRAFVAIRDSEISAQSMGIHLARYKTLSFALSAAFAGVGGALYAHKLSFISPDQFNILQSIDLLLMVVIGGLGSVHGAFLGAIFLISMPQLISMSKDWLPAAIGQAPGLQGLVYGLVLIGFVLFEPLGLYGRWLKVRTYLQLFPFYRSGLFRRQKSFQKSDRLR
>NZ_CP010951.1|WP_061500953.1|3129414_3130218_-|ABC-transporter-ATP-binding-protein
MNGDILLSAKDLSVRFGGVLAVNKVSFDVRRGEVFTLIGPNGAGKTTVFNLISRIYTPTAGTLEYEGRELTHQPPHRIAKLGIARTFQNIELFEHATVLHNLLIGRHTHRQTGLWSEMFFTPSARRAEIEAREKVERVIDLLDLQHHRDAMVAGLPYGVRKVVELARALCTEPKLLLLDEPSSGLNVEETEDMAFWIQDIKHELGVTVLMVEHDMTLVSKVSDRVLAMNQGEVLAMGAPREVQTHPGVIEAYLGTTDEPTELRRAVA
>NZ_CP010951.1|WP_061500951.1|3128597_3129395_-|ABC-transporter-ATP-binding-protein
MSLNPPAVSDTPVLRLLNVESAYGPIKAIRGVSLQVRRGEIATVLGSNGAGKTTILKTISGIIDPRKGSVEFKGEEITARDPAYIVQQGLMHVPEGREVFPLLSVHDNLLMGAYTRKDRDGVARDMEAVFGYFPILKERARQDAGLLSGGQQQMLAISRALMASPDLILLDEPSLGLSPKLTKEIFEIVVRINRERGATILLVEQNANMALNVSDYGYVLENGRIVMEDTCARLREKEDIKEFYLGMKEAGVRGERRWKKKKTWR
>NZ_CP010951.1|WP_061500949.1|3126631_3128488_-|AMP-binding-protein
MSNLWDLSHIQPETRVVLEGETIPQMFWNGVRERGPRVWMRQKDLGIWRAWTWQQTGDAVAEIAGGLMSLGLAAGETASILSNTVIEWVLADLAVLSCGGVSNGIYPTDAASQVHYLCEDSRTRVLFVEDDEQLDKALEVRAQLPLLTKIVVFDMEGLRELQDPGVISLDELRALGREYNAQHPQELTARVQARQPEDLAILVYTSGTTGKPKGAMHSHRGLVFIVRGYNILVQQDERDERMAFLPLCHIAERVGGEYFGMYTGAILNFVENPETVPENVREIAPTVCTAVPRIWEKFYSAVMIALKESTPLQQAAYRWGIGVGTQIADRVLAGQPVGSLLKAKFMLARWLALDNVRKLIGIHRARFLVTGAAPISPELVKWYLALGVPMLEVWGMTESCGASTGITPTKIKPGSIGPAAPYNEVKIDPATGEILVRGTNVFMGYLNQPEKTRETIDAEGWLHTGDVGSMDADGYFHITDRMKDIIITAGGKNITPSELENELKFSPYITDAVVVGDRRPYLTAIVMIDQDNVEKFAQDHDVPFSNYASLTRTTQVQELIQGEIDRVNARFARVEQIKRFFLLDTQLSAEDEELTPTMKLKRKLVQQKYAERIEAMYA
>NZ_CP010951.1|WP_061500946.1|3125328_3126501_-|ABC-transporter-substrate-binding-protein
MKNKAKLAALASLALASTLAVAQQQGVSKDEIVVGTIQDLSGPIAGYGKQARNGMLLRIQELNEQQGNVNGRKIRLIAEDNGYDPKKAVLAAQKLVNQDKVFIIVGHIGTAQNMAAMPVQFEKNIVNFMPITAAREMYEPLHKLKYSFAATYYDQMRMTLPKLVKEKNAKKVCTLYQDDDFGLEVQRGAEAGLKTINMEVTEKTTYKRGATDFSSQVAKMKASGCDLVVLGTIIRETIGTIAESRKTGFSPVFLGSSAAYTDLIHKLGGKAMDGLYATHTVQHPYLDEAAQPIRFWAAKYQTRFNEDPTVFSVYGYLIMDQFIQAARKAGPNLTTDSFVKAMDSMTFEPDMFGGPRSTYTATKRLGNDQSRLSQIQDGKWKVVSDYIKQP
>NZ_CP010951.1|WP_061500944.1|3124040_3125204_-|AI-2E-family-transporter
MPGPLHPSTLQDKALLLLVALVTVLFGVVLWPLIGAVLWAVFIAIVFSSLQDRSVQVCRGRRGWAAFGTLLVIVVIVLIPMALLASAVAQEATAFYERIKSGQYAIGDHFQQVMNALPEWARALLDRVGLEDLGAVQRKLVSALAASSQQITVRAFTIGQNTLEFLLNFFVMLYLLFFLLRDGKRIAALAIRALPLEPYHTRRVIDHFATVVRATVKGNVLVALVQGALGWVAFSVLGITGALLWGAVMALLSLLPAVGAGLVWGPVAIYLLATGSITAGLGLVAWGVLVIGLVDNVLRPVLVGKETRMPDYLVLIATLGGLAVFGINGFVIGPVIAALFLVCWDMLTEEREQQHASPAGVSPLAVPPPAATSTPPASAPASTPRPD
>NZ_CP010951.1|WP_082793580.1|3123151_3124093_+|DUF2950-domain-containing-protein
MLAVALALAPGWALAQQSAEGQKAASAPKAQAPKPAPPPKSYPSAEAAAAAFTDALRKNDRVALGVVLGQNWRRYVPAEGGPDREDVDAYLADWDKAHKIVNESDSKAVISVGEGGWTLPVPIVKVKSGWRFDPAAGADEMRVRAIGRNELNAMQAALAYVDAQRDYASKDRDKTGVRYYAQKFASTPGKHDGLYWDDPTGKDESPLGPVFAGNKPTGGGYHGYHFRILTGQGKQVPGGAYSYISGGRLRNGFGLIAWPVKYGETGVMSFMLNHEGKLLEKDLGPNTATVAGQMKTFNPDAGWKPAPTQAASK
>NZ_CP010951.1|WP_082793227.1|3121656_3123099_+|DUF3300-domain-containing-protein
MAAFISRVLVHTSIAGLALPGPAYPVAVPVQGPPTAITVAQGTAPQSAPAQSAPAQGSGFSQEQLDQMLAPIALYPDSLLSQVLMAATYPSDVAEAAKWSKAHKDMKGDEATKAVQDQPWDPAVQAIVAFPQVVQMMGDKPDWTQNLGDAFLASPKDVLDSAQRLRAQAQKAGNLKSSEQQKVVVEQAPQTQQTVIKIEPSNPETVYVPAYNPTTVYGTWPYPAYPPYYYPPSPYYYPGYVPGAALASGIAFGIGVAAVGSLWGNCNWGGGDVNVNVNKYNNINSNRQIDRSQTNFKHNAENRRGTPYRDQRSQQQFGRQSGDAAQRTNYRGRDAAGGSRDAQRQQAQSAMQQRGISQGDRAGGAGAGGRAQGAGAGAGAGGRAQGAGAGAGAGAGAGGRTQAGGGSNAFQGARDPGASRQQIDRGNASRQSASQHGGGGGGARASSGFSGGGGARAGGGGGGGRGGGGGGGRGGGGGRR
>NZ_CP010951.1|WP_082793225.1|3120554_3121523_+|DUF2950-domain-containing-protein
MKKFILLNSVVAAALALAPGWALAQQSAEGQKAASAPKAQAPKPAPPPKSYPSAEAAAAAFTDALRKNDRTALGVVLGQNWRRYVPAEGGPDREDVDAYLADWDKAHKIVNESDSKAVISVGEGGWTLPVPIVKVKSGWRFDPAAGADEMRVRAIGRNELNAMQAALAYVDAQRDYASKDRDKTGVRYYAQKFASSPGKHDGLYWDDPIGKDESPLGPVFAGNKPTGGGYHGYHFRILTGQGKEVPGGAYSYISGGRLRNGFGLIAWPVKYGETGVMSFMLNHEGKLLEKDLGPNTATVAGQMKTFNPDAGWKPAPTQAASK
>NZ_CP010951.1|WP_061500941.1|3119409_3120552_+|DUF3300-domain-containing-protein
MEQLDQMVAPIALYPDSLLAQILMAATYPSDVADAAKWSKANPNMKGDEATKAVQNQPWDPAVQAMVAFPQVIQMMGAKPDWTQNLGDAFLASPKDVLDAAQRLRAKAQQQGNLKSSEQQKVVVEQAPETQQTVIKIEPANPETIYVPAYNPVTVYGAWPYPAYPPYYWPPDPFYYPGYYPGAAFASGIMWGIGFAAAGAIWGNCNWGGGDINIDVDRFNNINRNRQIDRGQNKFKHNAENRRGTPYRDQRSQQQFGRQSADAAQRSGYRGRDAAGGREAQRQQAQSALQQRGFSQGDGRGGGGFGGGNNAFQGARDPGASRQQMDRGNASRQSFSQHGGGGGARASGFSGGGGARAGGGGFSGGGRAGGGGGRGGGGRR
>NZ_CP010951.1|WP_061500958.1|3131480_3132356_-|branched-chain-amino-acid-ABC-transporter-permease
MQVLQLVISGVAQGCIYGLIALGFVLIYKATETVSFAQGELMMLGAFCALAAMAFLGFPFWLAVISAIAAMGVFGVLLERIVIRPILGQPAFSIVMLTIGIGYVARGLITMIPNIGTETHTLPVPYKDRVLNLGTLVINVEQMAVIGSTAALCLLLYTVFRYSKVGIAMQAASQNQLAAYYMGIPVKTLNGLVWGLAAGAAAIAGLLLAPITFVHANMGFIGLKAFPAAVVGGFGSLPGAIVGGLVIGIVESLAGFYLPEGFKDTAAYIVVLLMLMIKPNGLFGEKLRKKV
>NZ_CP010951.1|WP_061500960.1|3132481_3133276_+|crotonase/enoyl-CoA-hydratase-family-protein
MGDSVRVEMFESVTVVTLDRREVRNAVDSDTAVALHQAFLAFDADPQARVAVFHGAHGHFCAGWDLQAGARMAQQAGDPLAALDFQASDQAALGPMGPSRLLLTKPVIAAVSGAAVAGGMELALWCDMRVMEEDAYFGVYCRRFGVPLIDGGTVRLPRLVGMGHAMDLILTGRKVEAAEALQMGLANRVVPKGSVREAAIELALQLAKFPQQTMLADRMNAYEQWGKPLGEALHAEWERSRQRIGDALEGAARFASGEGRHGKF
>NZ_CP010951.1|WP_061503853.1|3133346_3133760_-|acyl-CoA-thioesterase
MSDDSSDLACELPADKELVLKVIPMPADTNSNGDIFGGWVMAQVDLAGAVLPARYTMGRMATVAVNEFIFKQPVRVGDILSFYSEVTRVGRTSVTVKVEVFAERFRTQRRYIKVTEATVTYVAIDDSGRPRPLPERS
>NZ_CP010951.1|WP_061500962.1|3133795_3135673_+|ABC-transporter-ATP-binding-protein/permease
MRRYGELASSSLPAAASATGRARVHTDWTTIQRLFPYLWEYKGRVLAALLFMVGAKLANVGVPVLLKNLVDAMSIQPGQAVALLVVPVGLLLAYGLLRLSTTLFTELRELVFAKATQGAARRIALETFRHLHSLSLRFHLERQTGGMTRDIERGVRGIESLISYSLFSIVPTLIEVLLVLTILGVRFDMVFAWITLSALVLYIVYTVTITEWRTKFRREANEFDSAAHTKAVDSLLNYETVKYFNNENFEARRYDESLERLRRARLKSQTTLSMLNAGQQLIIAVGLVAMLWRATQGVVEGRMTLGDLVMVNAFMIQLYIPLNFLGVLYREIKQSLTDLDKMFVLMEREREVEDRPDALPLPLAGEGGGEGAWTVKFEHVDFSYEAARPILHDVSFEIPAGKTVAVVGPSGSGKSTLARLLYRFYDVRAGHITIAGRDIRDVTQASVRHSIGIVPQDTVLFNDTVEYNIAYGRPGATHAEVEEAARAARIHDFIQSTPKGYQTMVGERGLKLSGGEKQRVAIARTLLKNPPIMIFDEATSALDSANERAIQAELKGVARNKTALVIAHRLSTIVDAHEILVMEAGRIVERGTHAQLLAQSGRYAAMWALQQQSSEPEKFVDVIGL
>NZ_CP010951.1|WP_145979465.1|3135692_3136073_+|hypothetical-protein
MNPRSAAFVMAFALPLALLGKDAVAEYSFPAGASLALVMSSGSGAPRALVLGPEDTRSVRLRAWLTRNPTGWSSYWATPPGHGIRVSAGELRLHFVETSVIACHSRKGCVYKQIKSEEYAFLRDEP
>NZ_CP010951.1|WP_082793229.1|3136047_3136560_+|DUF1801-domain-containing-protein
MPSCAMSHKKTAAKDLPAERAAPKASASKSKRPTAAQQPTLLAGGNPQIAKADGDAPVQAYIAAMPGWKSEVGNHLDALIVRTVPGVRKAVKWNSPFYGVEGQGWFLNFHCFTKYVKVAFFRGASLRPVPPGESRHKEVRYLDIHEDDPLDEAQLASWIRQAAALPGWSP
>NZ_CP010951.1|WP_061500968.1|3136611_3137127_+|DUF1697-domain-containing-protein
MTRYVAFLRGVSPMNCKMPELKRCFEAAGFTDVKTILSSGNVAFSAQPAIVPVLEQKAEAAMQQHLHRVFQTIVRPSDFLQSLLESDPFAEFALPAGAKRIVTFLRRPHEGSVQLPIERDQASILKLQGTEVFSAYVPSDKGPVFMTLLERTFGAEVTTRTLDTVRKCSAA
>NZ_CP010951.1|WP_061500970.1|3137138_3137627_+|GNAT-family-N-acetyltransferase
MVDITLPPALPSDATVIEVAPADAAEIEQLMRHVIHASVSAEADVLAETVANTRANLDWSIANPDKCCHLKCVAGDRIVGVVLVKDFWNLCSLFVEPGYQGRGVGRALVLAAVEKCRGRHERNALWLNAAANAVSFYARLGFLPRQTVQALPPGFQAMQLPL
>NZ_CP010951.1|WP_061500972.1|3137685_3138129_+|SRPBCC-family-protein
MSRTVRLHRVLRTKPEKVYRAFLEADALAKWLPPYGFTCKVLHMEARAGGTFRMSFHNFSTGNGHSFGGEYLELVPNELIRYTDKFDDPNLPGVMQVTVNLKPVICGTELSVAQEGIPEAIPLEMCYLGWQESLLQLAALVEPDVPG
>NZ_CP010951.1|WP_061500974.1|3138282_3138732_+|CopD-family-protein
MVRNGLLLLHLLSAIAWLGGMFFAHFCLRPAAVKLLAPPQRLPLMTAALGSFLRYMAVAVTVLVLTGLAMFMDSGWARAPLGWQVMLVVGLAMAAVFGYVYGVHYPRLRARCEAGAWAEAAQVLNRIRQLVVTNLVLGLVVVVAAASAR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP010951_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP010951_5

4316419-4316517

Orphan

Consensus_repeat	Method
GGGGCGCAAATAAAAAAGCCCCGATGCAAGCATCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP010951_5

>merge|NZ_CP010951|5|4316419-4316517|CRISPRCasFinder
GGGGCGCAAATAAAAAAGCCCCGATGCAAGCATCGAGGCGAGCGTCGCTACGCTCCCTCGCCCGTGGGGCGCAATAAAAAAGCCCCGATGCAAGCATCG

>NZ_CP010951|5|5|4316419-4316517|CRISPRCasFinder
GGGGCGCAAATAAAAAAGCCCCGATGCAAGCATCG	AGGCGAGCGTCGCTACGCTCCCTCGCCCG
TGGGGCGCAATAAAAAAGCCCCGATGCAAGCATCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP010951.1\|WP_061502822.1\|4305515_4306016_-\|DUF2231-domain-containing-protein	unknown	unknown	gnl\|CDD\|226695
NZ_CP010951.1\|WP_061502844.1\|4321965_4323300_+\|DNA-recombination-protein-RmuC	unknown	unknown	gnl\|CDD\|224241
NZ_CP010951.1\|WP_145979559.1\|4306103_4306397_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010951.1\|WP_061502820.1\|4304054_4305509_+\|aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143423
NZ_CP010951.1\|WP_061502841.1\|4318773_4319496_+\|nitroreductase	unknown	unknown	gnl\|CDD\|380313
NZ_CP010951.1\|WP_061502826.1\|4309178_4310957_-\|DNA-primase	unknown	unknown	gnl\|CDD\|235551
NZ_CP010951.1\|WP_061502846.1\|4323296_4324448_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340883
NZ_CP010951.1\|WP_061502828.1\|4311037_4312684_+\|acyl-CoA-synthetase	unknown	unknown	gnl\|CDD\|236169
NZ_CP010951.1\|WP_145979561.1\|4325436_4326066_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP010951.1\|WP_173861269.1\|4317404_4318334_+\|histone-deacetylase	unknown	unknown	gnl\|CDD\|212519
NZ_CP010951.1\|WP_061502839.1\|4318330_4318798_+\|acyl-CoA-thioesterase	unknown	unknown	gnl\|CDD\|223894
NZ_CP010951.1\|WP_061503957.1\|4324457_4325321_-\|TIGR00730-family-Rossman-fold-protein	unknown	unknown	gnl\|CDD\|224527
NZ_CP010951.1\|WP_061502843.1\|4320943_4321924_+\|D-glycerate-dehydrogenase	unknown	unknown	gnl\|CDD\|240626
NZ_CP010951.1\|WP_061502832.1\|4313603_4315460_-\|gamma-glutamyltransferase-family-protein	unknown	unknown	gnl\|CDD\|223482
NZ_CP010951.1\|WP_061502825.1\|4306540_4308922_-\|RNA-polymerase-sigma-factor-RpoD	unknown	unknown	gnl\|CDD\|235549
NZ_CP010951.1\|WP_061502835.1\|4315517_4316276_-\|3-hydroxyacyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|187629
NZ_CP010951.1\|WP_061502830.1\|4312703_4313597_+\|YihY/virulence-factor-BrkB-family-protein	unknown	unknown	gnl\|CDD\|377085
NZ_CP010951.1\|WP_145979560.1\|4319492_4320932_+\|sodium:proton-antiporter	unknown	unknown	gnl\|CDD\|379910
NZ_CP010951.1\|WP_082793408.1\|4303190_4304009_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213191
NZ_CP010951.1\|WP_061502837.1\|4316674_4317217_-\|phasin-family-protein	unknown	unknown	gnl\|CDD\|378164

Protein	Function_ID	Function_description	E-value
NZ_CP010951.1\|WP_061502822.1\|4305515_4306016_-\|DUF2231-domain-containing-protein	gnl\|CDD\|226695	COG4244, COG4244, Predicted membrane protein [Function unknown].	3.71799e-20
NZ_CP010951.1\|WP_061502844.1\|4321965_4323300_+\|DNA-recombination-protein-RmuC	gnl\|CDD\|224241	COG1322, COG1322, Predicted nuclease of restriction endonuclease-like fold, RmuC family [General function prediction only].	6.22894e-85
NZ_CP010951.1\|WP_145979560.1\|4319492_4320932_+\|sodium:proton-antiporter	gnl\|CDD\|379910	pfam16980, CitMHS_2, Putative citrate transport. CitMHS is a family of putative citrate transporters, belonging to the Na+/H+ antiporter NhaD-like permease superfamily.	0
NZ_CP010951.1\|WP_061502820.1\|4304054_4305509_+\|aldehyde-dehydrogenase	gnl\|CDD\|143423	cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogenase, DoxF-like. Salicylaldehyde dehydrogenase (DoxF, SaliADH, EC=1.2.1.65) involved in the upper naphthalene catabolic pathway of Pseudomonas strain C18 and other similar sequences are present in this CD.	0
NZ_CP010951.1\|WP_061502841.1\|4318773_4319496_+\|nitroreductase	gnl\|CDD\|380313	cd02136, PnbA_NfnB-like, nitroreductase similar to Mycobacterium smegmatis NfnB. Members of this family utilize FMN as a cofactor and catalyze reduction of a variety of nitroaromatic compounds, including nitrofurans, nitrobenzens, nitrophenol, nitrobenzoate and quinones by using either NADH or NADPH as a source of reducing equivalents in an obligatory two-election transfer mechanism. The enzyme is typically a homodimer. Mycobacterium smegmatis nitroreductase NfnB plays a role in resistance to benzothiazinone.	2.17151e-37
NZ_CP010951.1\|WP_061502826.1\|4309178_4310957_-\|DNA-primase	gnl\|CDD\|235551	PRK05667, dnaG, DNA primase; Validated.	0
NZ_CP010951.1\|WP_061502846.1\|4323296_4324448_+\|MFS-transporter	gnl\|CDD\|340883	cd17325, MFS_MdtG_SLC18_like, bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters. This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.23174e-25
NZ_CP010951.1\|WP_061502828.1\|4311037_4312684_+\|acyl-CoA-synthetase	gnl\|CDD\|236169	PRK08162, PRK08162, acyl-CoA synthetase; Validated.	0
NZ_CP010951.1\|WP_173861269.1\|4317404_4318334_+\|histone-deacetylase	gnl\|CDD\|212519	cd09993, HDAC_classIV, Histone deacetylase class IV also known as histone deacetylase 11. Class IV histone deacetylases (HDAC11; EC 3.5.1.98) are predicted Zn-dependent enzymes. This class includes animal HDAC11, plant HDA2 and related bacterial deacetylases. Enzymes in this subfamily participate in regulation of a number of different processes through protein modification (deacetylation). They catalyze hydrolysis of N(6)-acetyl-lysine of histones (or other proteins) to yield a deacetylated proteins. Histone deacetylases often act as members of large multi-protein complexes such as mSin3A or SMRT/N-CoR. Human HDAC11 does not associate with them but can interact with HDAC6 in vivo. It has been suggested that HDAC11 and HDAC6 may use non-histone proteins as their substrates and play a role other than to directly modulate chromatin structure. In normal tissues, expression of HDAC11 is limited to kidney, heart, brain, skeletal muscle and testis, suggesting that its function might be tissue-specific. In mammals, HDAC11 proteins are known to be involved in progression of various tumors. HDAC11 plays an essential role in regulating OX40 ligand (OX40L) expression in Hodgkin lymphoma (HL); selective inhibition of HDAC11 expression significantly up-regulates OX40L and induces apoptosis in HL cell lines. Thus, inhibition of HDAC11 could be a therapeutic drug option for antitumor immune response in HL patients.	4.50423e-138
NZ_CP010951.1\|WP_061502839.1\|4318330_4318798_+\|acyl-CoA-thioesterase	gnl\|CDD\|223894	COG0824, FcbC, Predicted thioesterase [General function prediction only].	2.52804e-30
NZ_CP010951.1\|WP_061503957.1\|4324457_4325321_-\|TIGR00730-family-Rossman-fold-protein	gnl\|CDD\|224527	COG1611, COG1611, Predicted Rossmann fold nucleotide-binding protein [General function prediction only].	2.3029e-51
NZ_CP010951.1\|WP_061502843.1\|4320943_4321924_+\|D-glycerate-dehydrogenase	gnl\|CDD\|240626	cd05301, GDH, D-glycerate dehydrogenase/hydroxypyruvate reductase (GDH). D-glycerate dehydrogenase (GDH, also known as hydroxypyruvate reductase, HPR) catalyzes the reversible reaction of (R)-glycerate + NAD+ to hydroxypyruvate + NADH + H+. In humans, HPR deficiency causes primary hyperoxaluria type 2, characterized by over-excretion of L-glycerate and oxalate in the urine, possibly due to an imbalance in competition with L-lactate dehydrogenase, another formate dehydrogenase (FDH)-like enzyme. GDH, like FDH and other members of the D-specific hydroxyacid dehydrogenase family that also includes L-alanine dehydrogenase and S-adenosylhomocysteine hydrolase, typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann-fold NAD+ binding form, despite often low sequence identity. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomain but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. While many members of this family are dimeric, alanine DH is hexameric and phosphoglycerate DH is tetrameric.	5.91146e-163
NZ_CP010951.1\|WP_061502832.1\|4313603_4315460_-\|gamma-glutamyltransferase-family-protein	gnl\|CDD\|223482	COG0405, Ggt, Gamma-glutamyltransferase [Amino acid transport and metabolism].	0
NZ_CP010951.1\|WP_061502825.1\|4306540_4308922_-\|RNA-polymerase-sigma-factor-RpoD	gnl\|CDD\|235549	PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated.	0
NZ_CP010951.1\|WP_061502835.1\|4315517_4316276_-\|3-hydroxyacyl-CoA-dehydrogenase	gnl\|CDD\|187629	cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydrogenase type 10 (HSD10)-like, classical (c) SDRs. HSD10, also known as amyloid-peptide-binding alcohol dehydrogenase (ABAD), was previously identified as a L-3-hydroxyacyl-CoA dehydrogenase, HADH2. In fatty acid metabolism, HADH2 catalyzes the third step of beta-oxidation, the conversion of a hydroxyl to a keto group in the NAD-dependent oxidation of L-3-hydroxyacyl CoA. In addition to alcohol dehydrogenase and HADH2 activites, HSD10 has steroid dehydrogenase activity. Although the mechanism is unclear, HSD10 is implicated in the formation of amyloid beta-petide in the brain (which is linked to the development of Alzheimer's disease). Although HSD10 is normally concentrated in the mitochondria, in the presence of amyloid beta-peptide it translocates into the plasma membrane, where it's action may generate cytotoxic aldehydes and may lower estrogen levels through its use of 17-beta-estradiol as a substrate. HSD10 is a member of the SRD family, but differs from other SDRs by the presence of two insertions of unknown function. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	6.02515e-133
NZ_CP010951.1\|WP_061502830.1\|4312703_4313597_+\|YihY/virulence-factor-BrkB-family-protein	gnl\|CDD\|377085	pfam03631, Virul_fac_BrkB, Virulence factor BrkB. This family acts as a virulence factor. In Bordetella pertussis, BrkB is essential for resistance to complement-dependent killing by serum. This family was originally predicted to be ribonuclease BN, but this prediction has since been shown to be incorrect.	3.26284e-27
NZ_CP010951.1\|WP_082793408.1\|4303190_4304009_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213191	cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter. LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids. The E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.	3.12084e-105
NZ_CP010951.1\|WP_061502837.1\|4316674_4317217_-\|phasin-family-protein	gnl\|CDD\|378164	pfam09361, Phasin_2, Phasin protein. This entry describes a group of small proteins found associated with inclusions in bacterial cells. Most associate with polyhydroxyalkanoate (PHA) inclusions, the most common of which consist of polyhydroxybutyrate (PHB). These are designated granule-associate proteins or phasins.	6.77518e-13

>NZ_CP010951.1|WP_061502835.1|4315517_4316276_-|3-hydroxyacyl-CoA-dehydrogenase
MEIKGKVFIVTGGASGLGEGTARMLAANGGKVVIADMQADKGEAIAKEIGGAFVKCDVSQEADGQAVVAKAVSMGKLMGLVNCAGIAPAEKTVGKNGAHNLGLYTKTIMVNLVGSFNMIRLAADAMSKNEPESTGERGCLISTASVAAYDGQIGQAAYSASKGGVVGMTLPIARDLARNGIRNMTIAPGIFGTPMMFGMPKEVQDSLAASVPFPSRLGTPEDYAKLAKHIFENDMLNGEVIRLDGAIRLAPR
>NZ_CP010951.1|WP_061502832.1|4313603_4315460_-|gamma-glutamyltransferase-family-protein
MKTRLSLLFAAWLLAACASAPSGSDLNYAIPDQPEGSSGFSAKPGWATSRFAVAAANPLATDAGYQILKAGGSAVDAAIAVQMVLSLVEPQSSGIGGGAFLLHFDGKEVEAFDGRETAPAAADDRLFIGADGKPLAFNEAVVGGRSVGVPGAVRMLEAAHRQHGRLPWATLFQPAITLADQGFKVSIRLNTLVKADAHLKKDPVAAAYFYRADGQALEVGQVLRNPELAAVLRKIAAEGSKGLLEGEVAQAIVNKVRSHPTNPGRLSLADLANYQPKKRAPICHDYAARGKDYRICGFPPPGSGAIAVGQILGILNHTPAAGMALTSGMGGTPGTTGPVPSADWLHLYTEAARLAFADRGQYVADPDFVQPPAGSWMSLLAPAYLEARAKLIDASPAGQSMKTARPGTPGTPGAARSAHAPMPEQVEHGTSHISIADAYGNALAMTTTIEDQFGVRQMVSVKGGPGGFMLNNELTDFSFAPADAQGQPIANRVQPGKRPRSSMAPTLVFDKATGQFVMSAGSPGGAIIIHYTAKALYGVLNWGLNAQQAIDLPNFGSLNGPTLLEEQRFPPALVDALRRRGAEVREQSMTSGLQAIQKTPTGLFGGADPRREGVVSGE
>NZ_CP010951.1|WP_061502830.1|4312703_4313597_+|YihY/virulence-factor-BrkB-family-protein
MVVVSPSAAYVLKSPGAFAWRVLKAFKKNQGLLLAGAVAYYALLSVVPLLILTVIALSHVIDRMELLSTLGRYLEWLIPGQSGAIIGELRNFLDHREVVGWLLLGTMLFFSSLAFTVLENAMAVIFLHRFAIRKRRYLVSAVLPYAYILCLGFGVLIVTLVAGSLQALGQESIDLLGHEWSLKGVSGVLLYLLGFAGEIFVLTSLYMVMPVGHLSWRHALIGGATAALLWEITRHVLVWYFSTLSQVNVVYGSLTTAIVVLFSLEIGASLLLLGAQVISEYERIGLPQPTDSQPLKP
>NZ_CP010951.1|WP_061502828.1|4311037_4312684_+|acyl-CoA-synthetase
MPSIFDQDLPRNEANFTPLSPLSFIARAAEIYPQQLAVVHGGLRRTWAQLYARCRQLAASLAAHGVGRGDTVAVMLPNTPPMVEAHFGIPMSGAVLNALNTRLDPETIAFMLDHGEARVVIVDPEFAPVMKKALALRKSGREMLVIDVADELFGGPGERIGALSYDEFVAAGDPEFAWRLPEDEWDAIALNYTSGTTGNPKGVVYHHRGAAVNAISNILEWDMPKHPVYLWTLPMFHANGWCFLWTLAARAGVNVCLRRVEAQAITDAIKAHGVTHYCGAPIVHGMLVNAPDEMKQGLPKGVKAMVAGAAPPASMIEGMERLGFDITHVYGLTEVYGPATVCPKHDEWNALDIGERARLNARQGVRYHLQEDARVLDPQTLQPVPLDGETMGEIMFRGNVTMKGYLKNAKATQEAFEGGWFHTGDLAVQYPDGYIKIKDRSKDIIISGGENISSIEVEDALYRHPAVLAAAVVAKPDPKWGETPCAFIELKAGASVTAEEIVAHCKKHLAGFKVPRAVVFGELPKTSTGKIQKFELRKQAGSAKAIDV
>NZ_CP010951.1|WP_061502826.1|4309178_4310957_-|DNA-primase
MSIPQAFIQDLLARADVVEIVGRSVQLKKSGANFSGLCPFHAEKSPSFTVSPSKQFYHCFGCGKNGDAIRFLMENGGLSFIEAVKDLAGEYGMEVPEDETSPAERERAAKHREKQATLSDVLEKAGEAYRKHLKNSPRAVAYLKGRGLSGQIAKRFGLGYAPEGWRSLASVFPDYGDALLEESGLVIANAEEDKRYDRFRDRIMFPIRSVKGECIGFGGRVLGDEKPKYLNSPETPVFSKGRELYGLFEARNELREQGFVLVTEGYMDVVALAQLGFANAVATLGTACTSEHVHKLFRFTESIVFSFDGDEAGRRAARKALDVALTFATDVRSIKFLFLPSEHDPDSYIREFGRDAFSRYVNEATPLSRFLVDAAREGCDLSQAEGRAHMAANARPLWSAMPEGALKRQLLSEIAGLVQLDVRELSSLWGVAGARPAPRPRADSPPAPARRAGRTLPPGRADRALQIAFMNPGAWGALSNDDHHLLCELGAPHGALFAWLDSHVHEHGPEPWETLRAALQGQEHEAYLLDQAAKVLPDIEHDLDELRQIMRKERERLLDEERRELSARAATDPAAYERLKQLWKEQKTPPSP
>NZ_CP010951.1|WP_061502825.1|4306540_4308922_-|RNA-polymerase-sigma-factor-RpoD
MPAQKSGKLAKPAAKPVAKKPIKAASPAKAKLKVVNTADKPIAKATGKPSKTASKVKPVPTKTAVKSTEKSSAKEELKTKATKVTAVDEPVKKKPGRPPKAATADGAAKPAAKRGRKPKNAAAAEPKARDDMDMSDIEDDLVGEEAPAETVEKVKPLRMKISKAKERALMKEFGLDETVLTEEEMLKRRQRLKTLIKLGKTRGYLTHAEISDHLPDKLVDAETLEVVVSMLNDMGVAVYEQTPDAETLLLTNTGPTAATEEEAEEEAEAALSTVDSEFGRTTDPVRMYMREMGTVELLTREGEIEIAKRIEGGLQAMMEAISASPATIHEILKMAGEIRDGKIVISTVVDGFSNPNEADDYVAEEDFDEFDADDDDDGNGGSKALTKKLEELKSQALERFDRIAGLFEKVHKVYEKEGWGTPTYTKSQHALSEELMTIRFTAKTIEKLCDMVRGQVDDVRKKERELRRIIVDKCGMPQETFIKEFPPNLLNLKWVEKQAAAGKPWSTVIARNIPPIQELQQKLSDLQSRVVVPLAELKDINKRMNEGEASSREAKKEMIEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKMNRISRQHLQEFGFEPDAGILAAKMEIPEDKIRKIMKIAKEPISMETPIGDDDDSHLGDFIEDQANTAPIEAAMQAGLRDVVKDILDSLTPREAKVLRMRFGIEMSTDHTLEEVGKQFDVTRERIRQIEAKALRKLKHPSRSDKLRSFIDTL
>NZ_CP010951.1|WP_145979559.1|4306103_4306397_-|hypothetical-protein
MNFKSSSTRPASLALAAFAASLVVFAGAAAAGANCPQGATCKCVTTVLTDCTAGPNGKLTCTRSNVLDCTVVSGPGSGKTSLVQPAFSPSFSPLQRR
>NZ_CP010951.1|WP_061502822.1|4305515_4306016_-|DUF2231-domain-containing-protein
MRSRARLLGHPIHPMLVVFPLGLLATAVIFDLIYLFSGRQIMAAVSFWMMGAGIVGALVAAPFGLIDWLGIPPGTRAKRIGALHGGGNVAVALLFIVSFFSRDVAYAPGLGSMACSLAGAILALFTAWLGGELVDRLGVGVEDDANLNAPSSLASRQTASHTPQHG
>NZ_CP010951.1|WP_061502820.1|4304054_4305509_+|aldehyde-dehydrogenase
MSDMSMLINGLKVTAEKGAVFERRNPLDGTVATRAPAASAADALMAAEAAAEAFRTWSETGPGERRSLLLKAAERLEAKLPQFVEAVAAETGATGMWAGFNVMLAAGMIREAAALTTQVSGEVIPSDVPGSLAMGVRQPAGVVLGIAPWNAPIILGVRAIATPLACGNTVILKGSENCPRTHQLIIEAFAEAGFPAGVVNYVTNAPSDAATVVEAMVSHPAVRRVNFTGSTRVGRLIAQTCAKYLKPAVLELGGKAPLVILDDADLDDAVNAAAFGCFANSGQICMSTERIIVDEKVADEFVRKFAAKAKALPLGDPRKPEPVVLGSVIGMGTVEHCNALLADAMAKGAKLVCGGKADSTLMPATVVDHVTPAMHIYHEESFGPVKGIVRVRGTEEAIACANDNEYGLSAAVFGRDLARAFNVARRIDSGICHVNAPTVHDEAQMPFGGVKGSGMGRFGGRAGIAEFTELRWITLQTTPRHYPF
>NZ_CP010951.1|WP_082793408.1|4303190_4304009_+|ABC-transporter-ATP-binding-protein
MWYRAHPFELGAAGRRAHLRARGLSAGYGAFLVLRDLAFEVQPGLTVILGPNGAGKTTLLRALAGLIPRRGEVLLDGEDLPEKAHEIVRGGMALVPEGRQLFPQMTVLENLELGGWLADKARRRERLEQVLQDFPKLRERASQLAGTMSGGEQQMVAVARAMMSAPRLLMLDEPSLGLAPRLVDELLAIARRIADAGTTVLMVEQNVKKALAVADRGYVLERGTLVASGPAKLLARSTVVREAYLGAAASDTTSAADAAGRTRIPVRQPLPA
>NZ_CP010951.1|WP_061502837.1|4316674_4317217_-|phasin-family-protein
MLTAEQVLASQKAGVETLFGLTNKAFEGVEKLVELNMTAARAAMAEAAGTSQAILSVKDAQELVALQASLFQPLAEKTVAYSRHLYEIASGTGSEFGKAIESQATEAQKKFMALVDNAAKNAPAGSETAVAVFKSAVAAGNNALESVQKAVKQAADVAEANIQAVSAQAVNATKTSSRKR
>NZ_CP010951.1|WP_173861269.1|4317404_4318334_+|histone-deacetylase
MRAFYATQFTLQLPPGHRFPMAKYQLLRERLAAELPQLELAQAPAATDGELALVHSPAYIQAISDGSVDPRILREIGLPWSPAMAERARRSVGATIAACRAAFREGMAANIAGGTHHAYADRGGGFCVFNDAAVAARLMQAEWLRSHPRGLRVAIVDLDVHQGNGTAHIFRGDDSVFTLSMHAQKNFPSRKEPSDLDVDLPDGCRDEEYLLALEQALAELDRRFDPGLVIYLAGADPHEGDRLGRLKLTWDGLEARDRRVFDWAWARGLPLAFAMAGGYGVRIEDTVQAQVTTFRVGTQYAARWQNRSR
>NZ_CP010951.1|WP_061502839.1|4318330_4318798_+|acyl-CoA-thioesterase
MSDPTPTAPQAEPRDGYRAFRTISTRWMDNDAYGHVNNVVYYSWFDTAVNAHLIEQGALDIHDSPVIGLVVETQCNYFASVEFPQAVEAGLRVARLGKSSVRYEVGLFVQGEPMTAAKGHFVHVYVDRETRRPVPLPAKLKSVLEALQCPMPSAR
>NZ_CP010951.1|WP_061502841.1|4318773_4319496_+|nitroreductase
MSHAVSTVIGDPASVDAAIESRFSTRAFLPKPVSRDTIAHILRVASRAPSGTNVQPWKVYVLQGHGRDSLVEKVCAAHDAVYLNPALAVEYPEEYDYYPQKWVPPFIDRRRENGWSLYGLLGIVKGEKDKMHAQHHRNFRFFDAPVGLMFTLDRILGRGSLVDYGMFLQSIMVAARAQGLHTCPQAAWLSFSKVVLPHIGAGPEEMLVCGMSLGYADESATVNTFHTPRMPVEEFTSWVE
>NZ_CP010951.1|WP_145979560.1|4319492_4320932_+|sodium:proton-antiporter
MSGSPMRGRFTRFAQFLSFAAVSGLPSAVFAAEFDGRALSPAWGLPFAGILLSIALMPLVVPRLWHHHYGKVTAAWALAFLAPFAWVFGPGLAGEQLVHVALGEYLPFVILLTALFTVSGGIYIRGNLRGSPGVNTAILAIGAVLASFMGTTGASMLLIRPLIRANDNRRHKTHVFVFFIFIVSNAGGSLTPLGDPPLFLGFLQGVEFFWTVGHILPETLFLVGALLAIFYAMDWHYYHRREERLPVDPTPDTTRLGFDGARNFWLLAAVVGLVLLSGFWKTSRGFEIAGTQVGLPALVRDLGLLAVTWLSLRITPARVHEDNQFSWAPMQEVAKLFAGIFVTIVPVIAMLRAGVGGPFGAIVAAVTRPDGSPDPAMYFWASGTLSSFLDNAPTYLVFFNTAGGDAQVLMGSMATALAAISAGSVFMGANTYIGNAPNLMVRAIVESRGERMPSFFGYMAWSGCILVPLFVVMTFIWFR
>NZ_CP010951.1|WP_061502843.1|4320943_4321924_+|D-glycerate-dehydrogenase
MDKPPILVARAIFPEIIDQLQQHFEVEHNQADELWSKQQLAAKLAGKAGAFTTGGERIDAETMANAPGLKIVANMAVGYNNFDLPAMTQRRVLGTNTPDVLTETTADFGFALLMATARRLTESEHFLRAGRWTRWSYDMFSGRDVHGATLGILGMGRIGQGIARRGAHGFGMKVIYHNRSRLAPQLEAECKARYVGKEELLKTADHLVLVLPYSAESHHVIGAAELALMKPTATLVNVARGGIVDDVALAAALREGRIAGAGLDVFEGEPQVHPDLLKVPNVVLSPHIASATVPTRMAMAQLAADNLIGFLVHGKPLTPLNPEVLN
>NZ_CP010951.1|WP_061502844.1|4321965_4323300_+|DNA-recombination-protein-RmuC
MEIWILAALAVANLLLVGLLLMRKPPSGDSARVELLAASERLERELRREISESARGSRTELMQQLATFQDAVVRQSAEATRTQNIQIDAFAQQLALLQKTLSDTLSAQLQSLGESNARRIAEVRATLDAQLAQLQQTNSAKLDEMRRTVDEKLQSTLEKRLGESFKQVAERLEQVHKGLGEMQTLAQGVGDLQRVLTNVKTRGMFGEVQLEALLEQVLTAEQYGRQVETKPRSNQRVDFAIRFPGRNGDGMPVWLPVDAKFPREDYERLLDAQERADTAAAEAAARALETRIRQEAKSISESYLCPPYTTDFAILFLPIESLYAEVLRRPGLMDSLQRQYRVTIAGPTTLLAMLNSLHMGFRTLALEQQASEVWKVLGAVKTEFERYGIWVEKVREQVRKASDTLDTAHTRTNQMRRALKVVEALPEAQAQALLPQAEGDEATA
>NZ_CP010951.1|WP_061502846.1|4323296_4324448_+|MFS-transporter
MTGGLQPALARLIAGQIFLHACMAGTRMAAPLLALRSGQSEAAVGVLLALFALTQVFLALPAGRFADRHGVKRPVGYAVIAASIGAGLAAAWPVFPVLCVAALLTGGATGAAVIALQRHVGRAAENPTQLKQVFSWLAIGPAVSNFIGPFAAGLMIDLADFWLAFLLMAALPLVAWLWVRNVKELPPVVRPASAGRSKAWDLLGEPGFRRLLIVNWLLASCWDVHTFVVPVLGHERGLSASVIGTILGAFAVAAALVRLALPLLAAQLRERVVVSTAMLATALLFAIYPLMRGAFGMGLCSVLLGVALGSVQPMIMSMLHQITPEHRHGEAVAMRLMAINASSVAMPMLFGAAGAFIGISGVFWIVGAAVGAGARTALRLGRH
>NZ_CP010951.1|WP_061503957.1|4324457_4325321_-|TIGR00730-family-Rossman-fold-protein
MPSTRNLHDRRLADAWATLQAHSREGLPLDPDASRLAFADPEFLLRRETRGIRFQLELLKPDLEQQGQGIENTIVVFGSARFRSEQEAAALLAAAERSGDEALLRRARLCERNAHYYEKARAFGRLVAEYSAGKKPVDKLFVCTGGGPGIMEAANRGAHEAGGISVGLSIALPMEEEPNRFVTPDLSFKFHYFALRKMHFMMRAKAMVAFPGGFGTLDELFEVITLVQTRKSKQVPIVLFGTDYWKRLIDFDVLIDEGVISPDDLELFQHADDVVSAWDIIKNFYRL
>NZ_CP010951.1|WP_145979561.1|4325436_4326066_+|hypothetical-protein
MQLEGRSVGPYDRRTIIGMRIRKALTSADVLIGRDGSRSTVADLIGRRGPAFSPTRTGSFSLVQATYTAALVRRAARGAGIPLFRGEMEARVQSDVLRLAGRFRRNFAWKEDRVKIPLKDFVHARVRGSLVDLCLRAVNGRRLHRVTLELFTPEAAGEFVDWLPEATPFPENAGRLGAAGLPVQPLMAAALGVVLTVGIVLMAVLRHSR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP010951_2	2.1\|1780910\|28\|NZ_CP010951\|CRISPRCasFinder	1780910-1780937	28	NZ_CP010951.1	1038521-1038548	0	1.0
NZ_CP010951_2	2.1\|1780910\|28\|NZ_CP010951\|CRISPRCasFinder	1780910-1780937	28	NZ_CP010951.1	1332949-1332976	0	1.0
NZ_CP010951_2	2.1\|1780910\|28\|NZ_CP010951\|CRISPRCasFinder	1780910-1780937	28	NZ_CP010951.1	1333011-1333038	0	1.0
NZ_CP010951_3	3.1\|3085690\|25\|NZ_CP010951\|CRISPRCasFinder	3085690-3085714	25	NZ_CP010951.1	1038517-1038541	0	1.0
NZ_CP010951_3	3.1\|3085690\|25\|NZ_CP010951\|CRISPRCasFinder	3085690-3085714	25	NZ_CP010951.1	1332945-1332969	0	1.0
NZ_CP010951_3	3.1\|3085690\|25\|NZ_CP010951\|CRISPRCasFinder	3085690-3085714	25	NZ_CP010951.1	1333007-1333031	0	1.0
NZ_CP010951_3	3.1\|3085690\|25\|NZ_CP010951\|CRISPRCasFinder	3085690-3085714	25	NZ_CP010951.1	115221-115245	1	0.96
NZ_CP010951_3	3.1\|3085690\|25\|NZ_CP010951\|CRISPRCasFinder	3085690-3085714	25	NZ_CP010951.1	744679-744703	2	0.92
NZ_CP010951_3	3.1\|3085690\|25\|NZ_CP010951\|CRISPRCasFinder	3085690-3085714	25	NZ_CP010951.1	1959355-1959379	2	0.92

1. spacer 2.1|1780910|28|NZ_CP010951|CRISPRCasFinder matches to position: 1038521-1038548, mismatch: 0, identity: 1.0

ggcggctcattggataacctccgccctg	CRISPR spacer
ggcggctcattggataacctccgccctg	Protospacer
****************************

2. spacer 2.1|1780910|28|NZ_CP010951|CRISPRCasFinder matches to position: 1332949-1332976, mismatch: 0, identity: 1.0

ggcggctcattggataacctccgccctg	CRISPR spacer
ggcggctcattggataacctccgccctg	Protospacer
****************************

3. spacer 2.1|1780910|28|NZ_CP010951|CRISPRCasFinder matches to position: 1333011-1333038, mismatch: 0, identity: 1.0

ggcggctcattggataacctccgccctg	CRISPR spacer
ggcggctcattggataacctccgccctg	Protospacer
****************************

4. spacer 3.1|3085690|25|NZ_CP010951|CRISPRCasFinder matches to position: 1038517-1038541, mismatch: 0, identity: 1.0

gccgggcggctcattggataacctc	CRISPR spacer
gccgggcggctcattggataacctc	Protospacer
*************************

5. spacer 3.1|3085690|25|NZ_CP010951|CRISPRCasFinder matches to position: 1332945-1332969, mismatch: 0, identity: 1.0

gccgggcggctcattggataacctc	CRISPR spacer
gccgggcggctcattggataacctc	Protospacer
*************************

6. spacer 3.1|3085690|25|NZ_CP010951|CRISPRCasFinder matches to position: 1333007-1333031, mismatch: 0, identity: 1.0

gccgggcggctcattggataacctc	CRISPR spacer
gccgggcggctcattggataacctc	Protospacer
*************************

7. spacer 3.1|3085690|25|NZ_CP010951|CRISPRCasFinder matches to position: 115221-115245, mismatch: 1, identity: 0.96

gccgggcggctcattggataacctc	CRISPR spacer
gccgtgcggctcattggataacctc	Protospacer
**** ********************

8. spacer 3.1|3085690|25|NZ_CP010951|CRISPRCasFinder matches to position: 744679-744703, mismatch: 2, identity: 0.92

gccgggcggctcattggataacctc	CRISPR spacer
gctgtgcggctcattggataacctc	Protospacer
**.* ********************

9. spacer 3.1|3085690|25|NZ_CP010951|CRISPRCasFinder matches to position: 1959355-1959379, mismatch: 2, identity: 0.92

gccgggcggctcattggataacctc	CRISPR spacer
gccgtgcggctcattggctaacctc	Protospacer
**** ************ *******

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP010951_3	3.1\|3085690\|25\|NZ_CP010951\|CRISPRCasFinder	3085690-3085714	25	MN602278	Escherichia coli plasmid pUZ8002, complete sequence	55048-55072	2	0.92
NZ_CP010951_3	3.1\|3085690\|25\|NZ_CP010951\|CRISPRCasFinder	3085690-3085714	25	JX469830	Uncultured bacterium plasmid pG527, complete sequence	18591-18615	2	0.92
NZ_CP010951_3	3.1\|3085690\|25\|NZ_CP010951\|CRISPRCasFinder	3085690-3085714	25	JX469833	Uncultured bacterium plasmid pWEC911, complete sequence	31201-31225	2	0.92
NZ_CP010951_3	3.1\|3085690\|25\|NZ_CP010951\|CRISPRCasFinder	3085690-3085714	25	NC_008357	Pseudomonas aeruginosa plasmid pBS228, complete sequence	50093-50117	2	0.92
NZ_CP010951_3	3.1\|3085690\|25\|NZ_CP010951\|CRISPRCasFinder	3085690-3085714	25	CP002151	Uncultured bacterium plasmid PB5, complete sequence	24554-24578	2	0.92
NZ_CP010951_3	3.1\|3085690\|25\|NZ_CP010951\|CRISPRCasFinder	3085690-3085714	25	CP002152	Uncultured bacterium plasmid PB11, complete sequence	27037-27061	2	0.92
NZ_CP010951_3	3.1\|3085690\|25\|NZ_CP010951\|CRISPRCasFinder	3085690-3085714	25	CP002153	Uncultured bacterium plasmid PSP21, complete sequence	28725-28749	2	0.92
NZ_CP010951_2	2.1\|1780910\|28\|NZ_CP010951\|CRISPRCasFinder	1780910-1780937	28	MN602278	Escherichia coli plasmid pUZ8002, complete sequence	55041-55068	6	0.786
NZ_CP010951_2	2.1\|1780910\|28\|NZ_CP010951\|CRISPRCasFinder	1780910-1780937	28	JX469830	Uncultured bacterium plasmid pG527, complete sequence	18584-18611	6	0.786
NZ_CP010951_2	2.1\|1780910\|28\|NZ_CP010951\|CRISPRCasFinder	1780910-1780937	28	JX469833	Uncultured bacterium plasmid pWEC911, complete sequence	31194-31221	6	0.786
NZ_CP010951_2	2.1\|1780910\|28\|NZ_CP010951\|CRISPRCasFinder	1780910-1780937	28	NC_008357	Pseudomonas aeruginosa plasmid pBS228, complete sequence	50086-50113	6	0.786
NZ_CP010951_2	2.1\|1780910\|28\|NZ_CP010951\|CRISPRCasFinder	1780910-1780937	28	CP002151	Uncultured bacterium plasmid PB5, complete sequence	24547-24574	6	0.786
NZ_CP010951_2	2.1\|1780910\|28\|NZ_CP010951\|CRISPRCasFinder	1780910-1780937	28	CP002152	Uncultured bacterium plasmid PB11, complete sequence	27030-27057	6	0.786
NZ_CP010951_2	2.1\|1780910\|28\|NZ_CP010951\|CRISPRCasFinder	1780910-1780937	28	CP002153	Uncultured bacterium plasmid PSP21, complete sequence	28718-28745	6	0.786
NZ_CP010951_5	5.1\|4316454\|29\|NZ_CP010951\|CRISPRCasFinder	4316454-4316482	29	NZ_CP045736	Aeromicrobium sp. MF47 plasmid p001, complete sequence	22299-22327	6	0.793
NZ_CP010951_5	5.1\|4316454\|29\|NZ_CP010951\|CRISPRCasFinder	4316454-4316482	29	MN586020	Microbacterium phage Megan, complete genome	52832-52860	6	0.793
NZ_CP010951_5	5.1\|4316454\|29\|NZ_CP010951\|CRISPRCasFinder	4316454-4316482	29	MK496728	Capybara microvirus Cap1_SP_147, complete genome	4258-4286	8	0.724

1. spacer 3.1|3085690|25|NZ_CP010951|CRISPRCasFinder matches to MN602278 (Escherichia coli plasmid pUZ8002, complete sequence) position: , mismatch: 2, identity: 0.92

gccgggcggctcattggataacctc	CRISPR spacer
gtcaggcggctcattggataacctc	Protospacer
*.*.*********************

2. spacer 3.1|3085690|25|NZ_CP010951|CRISPRCasFinder matches to JX469830 (Uncultured bacterium plasmid pG527, complete sequence) position: , mismatch: 2, identity: 0.92

gccgggcggctcattggataacctc	CRISPR spacer
gtcaggcggctcattggataacctc	Protospacer
*.*.*********************

3. spacer 3.1|3085690|25|NZ_CP010951|CRISPRCasFinder matches to JX469833 (Uncultured bacterium plasmid pWEC911, complete sequence) position: , mismatch: 2, identity: 0.92

gccgggcggctcattggataacctc	CRISPR spacer
gtcaggcggctcattggataacctc	Protospacer
*.*.*********************

4. spacer 3.1|3085690|25|NZ_CP010951|CRISPRCasFinder matches to NC_008357 (Pseudomonas aeruginosa plasmid pBS228, complete sequence) position: , mismatch: 2, identity: 0.92

gccgggcggctcattggataacctc	CRISPR spacer
gtcaggcggctcattggataacctc	Protospacer
*.*.*********************

5. spacer 3.1|3085690|25|NZ_CP010951|CRISPRCasFinder matches to CP002151 (Uncultured bacterium plasmid PB5, complete sequence) position: , mismatch: 2, identity: 0.92

gccgggcggctcattggataacctc	CRISPR spacer
gtcaggcggctcattggataacctc	Protospacer
*.*.*********************

6. spacer 3.1|3085690|25|NZ_CP010951|CRISPRCasFinder matches to CP002152 (Uncultured bacterium plasmid PB11, complete sequence) position: , mismatch: 2, identity: 0.92

gccgggcggctcattggataacctc	CRISPR spacer
gtcaggcggctcattggataacctc	Protospacer
*.*.*********************

7. spacer 3.1|3085690|25|NZ_CP010951|CRISPRCasFinder matches to CP002153 (Uncultured bacterium plasmid PSP21, complete sequence) position: , mismatch: 2, identity: 0.92

gccgggcggctcattggataacctc	CRISPR spacer
gtcaggcggctcattggataacctc	Protospacer
*.*.*********************

8. spacer 2.1|1780910|28|NZ_CP010951|CRISPRCasFinder matches to MN602278 (Escherichia coli plasmid pUZ8002, complete sequence) position: , mismatch: 6, identity: 0.786

ggcggctcattggataacctccgccctg	CRISPR spacer
ggcggctcattggataacctccataaaa	Protospacer
**********************..   .

9. spacer 2.1|1780910|28|NZ_CP010951|CRISPRCasFinder matches to JX469830 (Uncultured bacterium plasmid pG527, complete sequence) position: , mismatch: 6, identity: 0.786

ggcggctcattggataacctccgccctg	CRISPR spacer
ggcggctcattggataacctccataaaa	Protospacer
**********************..   .

10. spacer 2.1|1780910|28|NZ_CP010951|CRISPRCasFinder matches to JX469833 (Uncultured bacterium plasmid pWEC911, complete sequence) position: , mismatch: 6, identity: 0.786

ggcggctcattggataacctccgccctg	CRISPR spacer
ggcggctcattggataacctccataaaa	Protospacer
**********************..   .

11. spacer 2.1|1780910|28|NZ_CP010951|CRISPRCasFinder matches to NC_008357 (Pseudomonas aeruginosa plasmid pBS228, complete sequence) position: , mismatch: 6, identity: 0.786

ggcggctcattggataacctccgccctg	CRISPR spacer
ggcggctcattggataacctccataaaa	Protospacer
**********************..   .

12. spacer 2.1|1780910|28|NZ_CP010951|CRISPRCasFinder matches to CP002151 (Uncultured bacterium plasmid PB5, complete sequence) position: , mismatch: 6, identity: 0.786

ggcggctcattggataacctccgccctg	CRISPR spacer
ggcggctcattggataacctccataaaa	Protospacer
**********************..   .

13. spacer 2.1|1780910|28|NZ_CP010951|CRISPRCasFinder matches to CP002152 (Uncultured bacterium plasmid PB11, complete sequence) position: , mismatch: 6, identity: 0.786

ggcggctcattggataacctccgccctg	CRISPR spacer
ggcggctcattggataacctccataaaa	Protospacer
**********************..   .

14. spacer 2.1|1780910|28|NZ_CP010951|CRISPRCasFinder matches to CP002153 (Uncultured bacterium plasmid PSP21, complete sequence) position: , mismatch: 6, identity: 0.786

ggcggctcattggataacctccgccctg	CRISPR spacer
ggcggctcattggataacctccataaaa	Protospacer
**********************..   .

15. spacer 5.1|4316454|29|NZ_CP010951|CRISPRCasFinder matches to NZ_CP045736 (Aeromicrobium sp. MF47 plasmid p001, complete sequence) position: , mismatch: 6, identity: 0.793

aggcgagcgtcgctacgctccctcgcccg	CRISPR spacer
aggcgagcgtcgctgcgctccgtacaacg	Protospacer
**************.****** *    **

16. spacer 5.1|4316454|29|NZ_CP010951|CRISPRCasFinder matches to MN586020 (Microbacterium phage Megan, complete genome) position: , mismatch: 6, identity: 0.793

aggcgagcgtcgctacgctccctcgcccg	CRISPR spacer
gcgagcgcgtcgctccgctccctcgcgcg	Protospacer
. * * ******** *********** **

17. spacer 5.1|4316454|29|NZ_CP010951|CRISPRCasFinder matches to MK496728 (Capybara microvirus Cap1_SP_147, complete genome) position: , mismatch: 8, identity: 0.724

aggcgagcgtcgctacgctccctcgcccg	CRISPR spacer
attaaagcgtcgctacgctccttcgcgtt	Protospacer
*   .****************.**** .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

884653 : 894715

Enterobacteria_phage(28.57%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061496543.1\|884653_885718_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	7.3e-84	46.2
WP_061496545.1\|885717_886635_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	2.4e-22	32.0
WP_145979326.1\|886579_887560_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	7.7e-96	56.8
WP_061496549.1\|887556_888111_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	1.9e-51	55.4
WP_061496552.1\|888178_891013_+\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	9.5e-147	39.4
WP_061496554.1\|891037_892033_-	hydroxyacid dehydrogenase	NA	NA	NA	NA
WP_061496556.1\|892142_893039_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	5.1e-70	50.3
WP_061496558.1\|893052_893280_-	sulfurtransferase TusA family protein	NA	NA	NA	NA
WP_061496560.1\|893276_893804_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_145979327.1\|893803_894715_-	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	2.3e-54	42.2

DBSCAN-SWA_2

2373258 : 2381295

Acinetobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061499565.1\|2373258_2374758_+	anthranilate synthase component I	A0A0B5J984	Pandoravirus	3.8e-38	29.3
WP_173861285.1\|2374766_2375339_+	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	4.8e-66	60.2
WP_061499569.1\|2375335_2376373_+	low-specificity L-threonine aldolase	NA	NA	NA	NA
WP_061499572.1\|2376377_2377028_+	LysE family translocator	NA	NA	NA	NA
WP_061499575.1\|2377037_2378069_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	9.9e-78	45.2
WP_061499578.1\|2378070_2378865_+	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	1.2e-62	52.1
WP_145979615.1\|2378894_2379620_+	uracil-DNA glycosylase	A0A0B4Q626	Equid_gammaherpesvirus	2.3e-44	50.8
WP_061498189.1\|2380104_2381295_+	elongation factor Tu	A0A1V0SLW6	Klosneuvirus	2.6e-13	29.2

DBSCAN-SWA_3

4520381 : 4527038

uncultured_virus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061503187.1\|4520381_4520768_+	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	2.5e-50	76.8
WP_061503189.1\|4520784_4521108_+	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	1.5e-27	56.1
WP_061503979.1\|4521178_4521697_+	Fe-S protein assembly co-chaperone HscB	NA	NA	NA	NA
WP_061503191.1\|4521710_4523570_+	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	8.8e-101	41.2
WP_061503193.1\|4523572_4523911_+	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_061503980.1\|4523940_4524693_-	glucose 1-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	1.0e-15	31.5
WP_061503196.1\|4524746_4525460_+	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	7.4e-40	40.2
WP_061503981.1\|4525816_4526056_+	hypothetical protein	NA	NA	NA	NA
WP_061503198.1\|4526255_4527038_-	slipin family protein	J3IZE5	Acanthamoeba_polyphaga_lentillevirus	1.3e-21	29.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP010951

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection