CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP013235	Collimonas arenae strain Ter282, complete genome	4 crisprs	cas3,WYL,DinG,PrimPol,csa3,DEDDh	9	14	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013235_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013235_1

472990-473060

Orphan

Consensus_repeat	Method
TAAATTGACTCTGTCCCCATTTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013235_1

>merge|NZ_CP013235|1|472990-473060|CRISPRCasFinder
TAAATTGACTCTGTCCCCATTTAATTTTGGTGCAAAAATGGATGCAATTAAATTGACTCTGACCCCATTTA

>NZ_CP013235|1|1|472990-473060|CRISPRCasFinder
TAAATTGACTCTGTCCCCATTTA	ATTTTGGTGCAAAAATGGATGCAAT
TAAATTGACTCTGACCCCATTTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013235.1\|WP_061532114.1\|480445_481234_+\|lipid-asymmetry-maintenance-ABC-transporter-permease-subunit-MlaE	unknown	unknown	gnl\|CDD\|223838
NZ_CP013235.1\|WP_061532108.1\|468532_468763_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013235.1\|WP_061535131.1\|484065_485019_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP013235.1\|WP_061536926.1\|469997_471089_-\|nitronate-monooxygenase	unknown	unknown	gnl\|CDD\|240081
NZ_CP013235.1\|WP_061532119.1\|485846_486083_+\|BolA-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|227340
NZ_CP013235.1\|WP_061532115.1\|481417_481891_+\|outer-membrane-lipid-asymmetry-maintenance-protein-MlaD	unknown	unknown	gnl\|CDD\|275223
NZ_CP013235.1\|WP_061535130.1\|485018_485774_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|237896
NZ_CP013235.1\|WP_061532113.1\|477944_479408_+\|glutamate-synthase-subunit-beta	unknown	unknown	gnl\|CDD\|237213
NZ_CP013235.1\|WP_156477187.1\|461730_464385_+\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|238657
NZ_CP013235.1\|WP_061532117.1\|482838_483471_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|377516
NZ_CP013235.1\|WP_061535128.1\|468764_469946_-\|YbfB/YjiJ-family-MFS-transporter	unknown	unknown	gnl\|CDD\|340869
NZ_CP013235.1\|WP_061532116.1\|481887_482622_+\|VacJ-family-lipoprotein	unknown	unknown	gnl\|CDD\|377309
NZ_CP013235.1\|WP_061532106.1\|466183_466855_+\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|198298
NZ_CP013235.1\|WP_061532105.1\|460262_461219_+\|FecR-family-protein	unknown	unknown	gnl\|CDD\|226235
NZ_CP013235.1\|WP_061532107.1\|467033_468527_+\|AMP-nucleosidase	unknown	unknown	gnl\|CDD\|236222
NZ_CP013235.1\|WP_061532111.1\|472228_472960_+\|transposase	unknown	unknown	gnl\|CDD\|224854
NZ_CP013235.1\|WP_061532110.1\|471235_472117_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176133
NZ_CP013235.1\|WP_061535127.1\|464476_466048_+\|thioredoxin-family-protein	unknown	unknown	gnl\|CDD\|379034
NZ_CP013235.1\|WP_061535129.1\|479642_480446_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224052
NZ_CP013235.1\|WP_061532118.1\|483559_483865_+\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|379202

Protein	Function_ID	Function_description	E-value
NZ_CP013235.1\|WP_061532114.1\|480445_481234_+\|lipid-asymmetry-maintenance-ABC-transporter-permease-subunit-MlaE	gnl\|CDD\|223838	COG0767, Ttg2B, ABC-type transport system involved in resistance to organic solvents, permease component [Secondary metabolites biosynthesis, transport, and catabolism].	5.66026e-87
NZ_CP013235.1\|WP_061535130.1\|485018_485774_+\|ABC-transporter-permease	gnl\|CDD\|237896	PRK15066, PRK15066, inner membrane transport permease; Provisional.	3.63123e-73
NZ_CP013235.1\|WP_061535131.1\|484065_485019_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	3.00545e-98
NZ_CP013235.1\|WP_061536926.1\|469997_471089_-\|nitronate-monooxygenase	gnl\|CDD\|240081	cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites. NDP is a member of the NAD(P)H-dependent flavin oxidoreductase family that reduce a range of alternative electron acceptors. Most use FAD/FMN as a cofactor and NAD(P)H as electron donor. Some contain 4Fe-4S cluster to transfer electron from FAD to FMN.	1.44759e-85
NZ_CP013235.1\|WP_061532119.1\|485846_486083_+\|BolA-family-transcriptional-regulator	gnl\|CDD\|227340	COG5007, COG5007, Predicted transcriptional regulator, BolA superfamily [Transcription].	6.82773e-31
NZ_CP013235.1\|WP_061532115.1\|481417_481891_+\|outer-membrane-lipid-asymmetry-maintenance-protein-MlaD	gnl\|CDD\|275223	TIGR04430, OM_asym_MlaD, outer membrane lipid asymmetry maintenance protein MlaD. Members of this protein family are the MlaD (maintenance of Lipid Asymmetry D) protein of an ABC transport system that seems to remove phospholipid from the outer leaflet of the Gram-negative bacterial outer membrane (OM), leaving only lipopolysaccharide in the outer leaflet. The Mla locus has long been associated with toluene tolerance, consistent with the proposed role in retrograde transport of phospholipid and therefore with maintaining the integrity of the OM as a protective barrier.	1.4215e-79
NZ_CP013235.1\|WP_061532113.1\|477944_479408_+\|glutamate-synthase-subunit-beta	gnl\|CDD\|237213	PRK12810, gltD, glutamate synthase subunit beta; Reviewed.	0
NZ_CP013235.1\|WP_156477187.1\|461730_464385_+\|TonB-dependent-receptor	gnl\|CDD\|238657	cd01347, ligand_gated_channel, TonB dependent/Ligand-Gated channels are created by a monomeric 22 strand (22,24) anti-parallel beta-barrel. Ligands apparently bind to the large extracellular loops. The N-terminal 150-200 residues form a plug from the periplasmic end of barrel. Energy (proton-motive force) and TonB-dependent conformational alteration of channel (parts of plug, and loops 7 and 8) allow passage of ligand. FepA residues 12-18 form the TonB box, which mediates the interaction with the TonB-containing inner membrane complex. TonB preferentially interacts with ligand-bound receptors. Transport thru the channel may resemble passage thru an air lock. In this model, ligand binding leads to closure of the extracellular end of pore, then a TonB-mediated signal facillitates opening of the interior side of pore, deforming the N-terminal plug and allowing passage of the ligand to the periplasm. Such a mechanism would prevent the free diffusion of small molecules thru the pore.	3.19128e-42
NZ_CP013235.1\|WP_061532117.1\|482838_483471_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|377516	pfam05494, MlaC, MlaC protein. MlaC is a component of the Mla pathway, an ABC transport system that functions to maintain the asymmetry of the outer membrane. This family of proteins is involved in toluene tolerance, which is mediated by increased cell membrane rigidity resulting from changes in fatty acid and phospholipid compositions, exclusion of toluene from the cell membrane, and removal of intracellular toluene by degradation. Many proteins are involved in these processes.	3.21624e-68
NZ_CP013235.1\|WP_061535128.1\|468764_469946_-\|YbfB/YjiJ-family-MFS-transporter	gnl\|CDD\|340869	cd06180, MFS_YjiJ, Uncharacterized protein YjiJ and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Escherichia coli YjiJ and other uncharacterized proteins. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	9.53084e-90
NZ_CP013235.1\|WP_061532116.1\|481887_482622_+\|VacJ-family-lipoprotein	gnl\|CDD\|377309	pfam04333, MlaA, MlaA lipoprotein. MlaA is a component of the Mla pathway, an ABC transport system that functions to maintain the asymmetry of the outer membrane. MlaA is required for the intercellular spreading of Shigella flexneri. It is attached to the outer membrane by a lipid anchor.	2.15119e-106
NZ_CP013235.1\|WP_061532106.1\|466183_466855_+\|glutathione-S-transferase	gnl\|CDD\|198298	cd03189, GST_C_GTT1_like, C-terminal, alpha helical domain of GTT1-like Glutathione S-transferases. Glutathione S-transferase (GST) C-terminal domain family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S. cerevisiae GST protein, GTT1, and the Schizosaccharomyces pombe GST-III. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. GTT1, a homodimer, exhibits GST activity with standard substrates and associates with the endoplasmic reticulum. Its expression is induced after diauxic shift and remains high throughout the stationary phase. S. pombe GST-III is implicated in the detoxification of various metals.	1.17876e-58
NZ_CP013235.1\|WP_061532105.1\|460262_461219_+\|FecR-family-protein	gnl\|CDD\|226235	COG3712, FecR, periplasmic ferric-dicitrate binding protein FecR, regulates iron transport through sigma-19 [Inorganic ion transport and metabolism, Signal transduction mechanisms].	1.30178e-71
NZ_CP013235.1\|WP_061532107.1\|467033_468527_+\|AMP-nucleosidase	gnl\|CDD\|236222	PRK08292, PRK08292, AMP nucleosidase; Provisional.	0
NZ_CP013235.1\|WP_061532111.1\|472228_472960_+\|transposase	gnl\|CDD\|224854	COG1943, COG1943, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	3.50242e-18
NZ_CP013235.1\|WP_061532110.1\|471235_472117_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176133	cd08442, PBP2_YofA_SoxR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold. YofA is a LysR-like transcriptional regulator of cell growth in Bacillus subtillis. YofA controls cell viability and the formation of constrictions during cell division. YofaA positively regulates expression of the cell division gene ftsW, and thus is essential for cell viability during stationary-phase growth of Bacillus substilis. YofA shows significant homology to SoxR from Arthrobacter sp. TE1826. SoxR is a negative regulator for the sarcosine oxidase gene soxA. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine, which is involved in the metabolism of creatine and choline. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.69097e-76
NZ_CP013235.1\|WP_061535127.1\|464476_466048_+\|thioredoxin-family-protein	gnl\|CDD\|379034	pfam13098, Thioredoxin_2, Thioredoxin-like domain.	1.30569e-15
NZ_CP013235.1\|WP_061535129.1\|479642_480446_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224052	COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism].	3.60457e-139
NZ_CP013235.1\|WP_061532118.1\|483559_483865_+\|STAS-domain-containing-protein	gnl\|CDD\|379202	pfam13466, STAS_2, STAS domain. The STAS (after Sulphate Transporter and AntiSigma factor antagonist) domain is found in the C-terminal region of Sulphate transporters and bacterial antisigma factor antagonists. It has been suggested that this domain may have a general NTP binding function.	7.46817e-10

>NZ_CP013235.1|WP_061532111.1|472228_472960_+|transposase
MARLPRLVIANQPHHLIQRGVDRQAIFRETEDYVNFLGRLRDAAKQFKVAIHGYVLMTNHIHLLATPSDVEGLARMMQWVGRHYVPYFNQKYAREGTLWQGRYRATVIDSERYFMLCSCYIDQNPVRAGITSAPGEYPWSSYLHHVGIKPDPLVTDHALYWALGNTPFDREAAYKAMAEQALTSDQSKQLMEATNKGWPLGSDAFKAKLEKQGAVRVRPGQRGRPFKVKPELSADAVVATTKK
>NZ_CP013235.1|WP_061532110.1|471235_472117_+|LysR-family-transcriptional-regulator
MDLLSLEIFRTVVREGGITRAAEQLHRVQSNVTTRIRQLEQSLGVSLFSRNNKRLVLTPAGEILLGYAERLLNLAVEAREAVQPAVPQGRLRIGSMESTAASRLPLPLARFHQQWPAVQLELSTAPTQTLIDRVRAFTLDAALVAGPLEDPSLTILPLYAEELVLLAPRNHPPISSPDDLQTHTLIAFENGCAYRRHAENWLASGSIPGRRPDRILELGSYHAMLACVAAGAGIALAPRSVLELHNSSESLAIYPIGPAGQIPTYLIRRHDYSSPAFDALSQILQAEAKTIRL
>NZ_CP013235.1|WP_061536926.1|469997_471089_-|nitronate-monooxygenase
MSNVNLNSTPQSGSFAAQLDLRYPIVQGPMNGASPIELVTQVCNAGGLGSFAAALLSPAAIIEAVKKIRTLTTRPFNVNLLILETRQPAEAEIALAEKLLLPFRDALGLGLATRPQKFSENFEEQLAALLEAAPPVVSFTFGILSADTVAQFHAKGSKVIGTATTVAEAVAWEQVGADFVCLQGSEAGGHRATFLGDIEQSSVGLMTLIPQAAAAVKVPLIAAGGIMDGRGIAAALLLGAQAAQLGTAFLACPESGIAPAWRAQLAVARDDSTRLTRSFSGRHARGITNTYTEQMAPHESALPVYPVQNALTGEIRQTAAKLNRPEFMSLWAGQGVAMARPMPAAELIATLAAELKVPHAINY
>NZ_CP013235.1|WP_061535128.1|468764_469946_-|YbfB/YjiJ-family-MFS-transporter
MEIDQSREAWRVALAGTLCLAVAMGIGRFAFTPLLPMMLHDGVIDLAAGGWLATANYLGYFVGAMLCMALRGSATRFIRIGLAATVLLTLGMGLSQSSAVWLALRALAGVASACTFVFASGWCLQRLAQLQAPALGGVIYCGPGLGILLTGLATSAMVSHDWKASYGWLSYALLALLLTAIVWRTFTGSTTTTSAPTSASHALPPTQIIRQTRGLTIAYALAGFGYIITATFLPVIARQALPGSSWPDLFWPLFGICVSLGALLATRLPIHWDNRLLLAVCYLLQACGILIGVASPSVFGFALGSILLGLPFTAITLFAMRDARRLRGDQARSLMGLLTAAYGIGQIIGPPLATRLVQGSGNFTSSLCVAAVALVAGACLLGLMYRESKQQLA
>NZ_CP013235.1|WP_061532108.1|468532_468763_+|hypothetical-protein
MATVIKHRGVNIVTLAEGEAIAEHCRDGDIALVQDGAGWWTHFVGADGAIDSYDAPFPSYNKALWTAKAAAEFAGE
>NZ_CP013235.1|WP_061532107.1|467033_468527_+|AMP-nucleosidase
MFPTEKFTDPHAAVERVMEIYEHHTALLRDAFKRFSNGEVMPERVRACYPFVRVTTEVNTRADTRHSFGFVSGPGVYETTLTRPSLYANYLVSQFKLLRDNHDVPLEIGVSELPIPVHFAFPEGIHVEGNLDPEHLRTLPDVFDLPNLATMDDRIVNGTYEEMPGEPHPLSLFTGPRIDYSLHRLKHYTATSPDRFQRYVLFTNYAFYVDEFIRMGRELMQATSDPAQREYRQQYTAFVEPGDLTTWNANLDDLPADRALTGIAPARQPQMPAYHLQRADGSGITLINIGVGPSNAKTITDHVAVLRPHGWIMLGHCAGLSTSQRMGDYVLAHAYVRDDHVLDDDLPLWVPVPALAEVQLALQDAVATITQLEGYELKRIMRTGTVASVDDRNWELRDHRKPLLRFNQSRAIALDMESATVAANGFRFRVPYGTLLCVSDKPLHGEIKLPGMANRFYEQRVNQHLKIGIKALELLRNQGVEQLHSRKLRSFSEPAFR
>NZ_CP013235.1|WP_061532106.1|466183_466855_+|glutathione-S-transferase
MIIVHHLNNSRSQRVLWLLEELGLEYEIKFYQRDPKTMLAPASLRAVHPLGKSPVITDGDNTIAESGAIIEYLVQQYGGGRLIPPVGSKDRLRYTYWLHYAEGSAMPPLLMKLIFGRIDRPPMPALLRPLARMISKGVQRGYIDPQIKSHLDFLEGELGKSTWFAGEEFTAADIQMSFPLEASQSRGGLDASRPRLSAFLQRIHARPAYQRAIERGGKYDLLK
>NZ_CP013235.1|WP_061535127.1|464476_466048_+|thioredoxin-family-protein
MKIQSVTAAIIATLICAAGPALALPTTGQKPAAATPAAVDGINWYDGDVDAAFAFAKAHNKPLFLYWGATWCPPCNQVKATIFNRQAFIERSRFFVPVHIDGDSPGAQKLGERFKVRGYPTMILFKPDGSEITRLPGEVDAERYLQTLTLGISANRPVKQTLQAALSGGKLTADEWRLLGYYSWDTDEQQLVASKDLFPTLKRLAAACPPGETANRLALSALVAAATATPGNIPEIDKAAAVVLLTKAASDTRIARENMDLLTNYPTDLVGLATAPQSPARAKLIGVWTTALQRLALDTSLSKTDRLSALAAQVSLARLDSPEAKLMPALLKEVRQRVAQADAATTDAYERQSVINTAAHALGDAGLLDESDTLLKAELKRSHAPYYFMLSLASNAKKRGDKTAAINWYEQAYQAAQGPATRLQWGAAYLSGVLELAPQDEARIEKVAHGLFQELAGTQNAFYERNRSVLERLGHKLVDWNAGGKHQAVVQRLRTQLDGVCAKLPDADAQRATCQGLLSPTRA
>NZ_CP013235.1|WP_156477187.1|461730_464385_+|TonB-dependent-receptor
MAPKAKTAPAVAAIVATPDEEHKEVLVTGSRIPRASKEGPTSVTVITGEEIEKQGYRNVFDALSAQTQNTGMTQGADFGNTFTPAANTISLRGLGPNHTLILVNGRRVADYPVAYDGSVNFVNLANIPSALVDRIEILNGGASAVYGSDAIAGVVNVILKKKAEGFDLNVKAGGTQDGGGSNQRIQFTGGGSSGNLSGVFGIELSRTQPIWSRQRDFMSSTSSDGTAPTRIAGRMNVDSENYVDPGAGCSQLGQLFSGSVVQTGNPYCASGKAQPSYWTTMTQNESENLFGSLTYQLTPKTEVFSDLMLGFNATQNNTRGPNWTSEGGGNSYFFNQNTGADESWSRRIAPEEIGDATRYNKKWRDIAGNWTVGVRGDIPATSSWNYEAAYNISAYTSRQTTPLLLNNVDSFFLGPRLGYNSDGVAIYAPNPNRLYQPLTPDQFNSIAGEAISRNKSWTQTLSLSANGELFNLPAGPVRMAVVTELGSQGFSNTPDPQINQGVFYNQSEAEGASGSRKRYALGTELNIPLLKQLVATVAGRYDEYNFAGRSDGKFTYNTGLEFRPAKTLLFRGNYATSFRAPDMNYIYSSTTHGYYSSTTDYYLCQQTGQPLAGCSYNNYSPGANYIQTGSKDLKPENGKSWSYGVVWSPSSNFDISADFWRIQIDNLVTNLDPDTILRNEANCRAGQLDINSPTCVDALARVVRNPPNAVYQPNAIQDILVNPINAAQERTSGLDFSGKWRIKGGNVGDFVLKANYTKVLSHHYKQFANDPDQDLLNSLTNPDWGSKVNASVTWLRGPWTSTVQVTRYGSLPSADQTRRISPFALVNLSASYQINPRASVSLIVNNVFNSVKQDTTAGWPYYPVGNYNPYGRMGWLEFNYHFGS
>NZ_CP013235.1|WP_061532105.1|460262_461219_+|FecR-family-protein
MKKFSFDDPIATQAANWMALLRSERATEADRRAYLQWLAADLRHATVGAGLERALGTFQASAQAGVSGEVIDKALQLSGSRRQVLRGGLLLLGLGGVAAVLVDRETPLLELAADIRTGTGQRRSVGLADGSTVILNARSAADIDFDAQQRLLHLRSGELLARVALDHRRPFVVRTEHGAVRALGTAFVLRREADYSEVSVLSSRVEIATRDGVRQRLSAGQSARFDRGGISATPARPEAESAWVDGLLEVNDRPLAQVISAIRPYRSGVIRVAQRAAQLRVSGVFPLDDTDLALSMLRQTLPIRIQRSTPYWVSISMA
>NZ_CP013235.1|WP_061532113.1|477944_479408_+|glutamate-synthase-subunit-beta
MGKVTGFMEFQRVGETYEAPVARKKHYKEFILSLSNDEAKTQGARCMDCGIPFCNNGCPVNNIIPDWNDLVYRGAYHEALETLHSTNNFPEFTGRICPAPCESACTLGINSDPVGIKSIEHFIVDKGWENGWIVPQPALVKTGKKVAVVGSGPAGLAAAQQLARIGHDVTVFEKSDRVGGLLRYGIPDFKMEKSHIDRRVEQMEAEGVTFRTGVLVGKDFPSNVNNWAKKTISPDELKAEFDAVVIAGGAEQPRDLPVPGRELKGVHFAMDFLPQQNKINAGDKVKDQILAGGKHVVVIGGGDTGSDCVGTSNRQGAVSIQQFELMPQPPEQENKPLVWPYWPTKLRTSSSHEEGCDRDWAVATKRLEGKNGKVEKLIAARVEWKDGKMQEVPNSEFEMKADLVFLAMGFVSPVAQVLDAFGVDKDARGNAKATTDGDGCYKTSVDKVFAAGDMRRGQSLVVWAIREGRQCARAVDEFLMGASVLPR
>NZ_CP013235.1|WP_061535129.1|479642_480446_+|ABC-transporter-ATP-binding-protein
MANIVEIRDLQFGYGERTILSGLNMDFARGKVIAVMGGSGSGKTTILRLIGGQLRPQAGSVKVDGETVHTLSTKALYALRRKMGMLFQSGALFTDLTAFENVAFPLREHTDLPPELLNNLVLLKLNAVGLRNAAQLKPSEISGGMARRVALARAIALDPSLIMYDEPFAGLDPISMGVTANLIRKLNDALGSTSILVSHDVNESFAIADYVYFLSQGEIVAQGTPAEMRVSTHPYVKQFVNAEPDGPVPFHYPGKSLAEDLGLKGLR
>NZ_CP013235.1|WP_061532114.1|480445_481234_+|lipid-asymmetry-maintenance-ABC-transporter-permease-subunit-MlaE
MFNWISNGLATIGRTLRESITGLGVATRMFLSILRVSPGLWRRPRLITDQIHFIGNYSLVIIGVSGLFVGFVLGLQGYYTLNKYGSEQALGLLVALSLVRELGPVVTALLFAGRAGTSLTAEIGLMKAGEQLSAMEMMAVDPLQRVVAPRFWAGVVAMPVLAALFSALGIFGGYLVGVKLIGVDEGAFWSQMQGGVDVWLDVANGVLKSVVFGVAVTFVAVWQGYEAKATPEGVSRATTRTVVIASLAVLGLDFLLTALMFN
>NZ_CP013235.1|WP_061532115.1|481417_481891_+|outer-membrane-lipid-asymmetry-maintenance-protein-MlaD
MQQKTVDVWVGMFVLIGVLALGFLALKAGNLSSSSFNATYPVTTKFDNIGGLKVRASVRSAGVVVGRVASINFDDKSFQAVVTLNMDDRYKFPKDSSAKILTAGLLGEQYIGIEPGGDTKNLVAGDNIKLTQSAIVLENLISQFLYSKAADVKDSEQ
>NZ_CP013235.1|WP_061532116.1|481887_482622_+|VacJ-family-lipoprotein
MKMTMRLGSLAMVAALSGCATTGNTSNSNPQDPLEGFNRAMFSFNDTLDKVALKPVATAYRSWLPSFVQTGIHNFFGNIGDVWSSVNGFLQGNVADGTSDVMRVAVNSTLGLGGLLDISSEAGLQKHNKDFGQTLGKWGIGSGPYLVLPLFGPSNIRDTAALPVDFYGDLWSYKYPVRWRNTGSVVRLIDKRANLLDAGDLLEDAALDKYQFVRDAYTQRRQSQIKGDDDSDATDKPGKTKSDE
>NZ_CP013235.1|WP_061532117.1|482838_483471_+|ABC-transporter-substrate-binding-protein
MNILKKYLALSLTVGSLLFSAAASAQEAPDALVKRISQDVLDTAKADKSVQGGNQQRILALVEEKIIPYVDFDRMTALAAGRYWRDATPDQQKQLIAQFRSLLIYTYSGALSQVRDQKIDFKPMRGDPSDTDVEVRSQVIQPGREPIQLNYRMEKISAGWKIYDVNVLGAWLVESYKGTFATEIGKSGIDGLIKTLTDKNKARAAAKGGK
>NZ_CP013235.1|WP_061532118.1|483559_483865_+|STAS-domain-containing-protein
MFRPSHSLTVGNAKVTLEEGLRAIAGGETEIDLSDVVAVDSAAVATLLAWQCAALNQGHSLHFSSLPANLESLIDLYGVTELLSPATVVVAASTQANTQHH
>NZ_CP013235.1|WP_061535131.1|484065_485019_+|ABC-transporter-ATP-binding-protein
MAAIQITNVKKRYQSLQALGGVSLTIEEGEFFGLLGPNGAGKTTLISIIAGLNRPDSGNVTIHGHDVVSDYRAARRNLGVVPQELVFDPFFTVRETLRMQSGYYGLKNNDKWIDEVMENLDLTNKADTNMRALSGGMKRRVLVAQALVHKPPVIVLDEPTAGVDVELRQTLWKFISRLNREGHTVVLTTHYLEEAQEQCNRIAMLKLGQVVALDSTSALIKRIAGSQLLVQLSGGSLPASLQHLVLHADGGKFALRVNEYADVEPILGALRHAGAVIEDMQLQQADLEDVFLQIMDSKISSGGFNVFADEYNVGGVK
>NZ_CP013235.1|WP_061535130.1|485018_485774_+|ABC-transporter-permease
MVGFQTLFYKEVLRFWKVATQTICAPILTAMLYLLIFGHTLKDHVQVYPGVQYTSFLIPGLIMMSVLQNAFANTSSSLTQSKMTGNLVFVLLPPLSHWELFGGYVLASVVRGVAVGLGVFVITAWFANLSFVAPWWIVIFAVLGAALLGTMGLIAGIWADKFDQLAAFQNFLIMPATFLAGVFYSIHSLPPFWQVVSHLNPFFYMIDGFRYGFFGQSDINPLISLAVICVTLALLSTLAVQMLKRGYKLRH
>NZ_CP013235.1|WP_061532119.1|485846_486083_+|BolA-family-transcriptional-regulator
MFPTPDLVKSYIAAGLECSHLEVEGDGQHFKAVIVSAAFAGKRPIQRHQIVYAALGDRMREEIHALSMKTLTPEEYQP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP013235_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013235_2

2234036-2236134

Orphan

Consensus_repeat	Method
TGACNTCGNTGTCGACNTCNGCTTCGACNGGNATNACTTCG	CRT

27 spacers

The CRISPR arrays of NZ_CP013235_2

>merge|NZ_CP013235|2|2234036-2236134|CRT
TCACATCGTTGTCGACATCAACTTCGACCGGCATCAGTACATCACGGGTAGCAGAAGCGTCCTTGTCGACGGGTTTGAGTACAACCAACAGCAACGTCACATCGCTGTCTACCTCGGCTTCTACGGGCATTACTTCGCTGTCGACTGGTCTGAGCACAACCAACAGTAATGTCGCATCGTTGTCGACATCAACTTCGACCGGCATCAGTACATCACGGGTAGCAGAAGCGTCCTTGTCGACTGGCTTGAGCACAACCAACAGTAACGTGACATCGTTGTCGACCTCGGCTTCGACAGGTATCACTTCGTTGTCGACGGGTCTGAGCACCACCAACAGCAACGTCACATCGCTGTCGACCTCGGCTTCGACAGGCATCACTTCGCTGTCCACTGGCTTGAGCACAACTAACAGCAACGTGACCTCGCTGTCGACCTCGGCTTCGACAGGTATTACTTCGCTGTCCACGGGTCTGAGCACCACTAACAGCAACGTGACCTCGCTGTCGACATCTGCCTCGACGGGTATTACTTCGTTGTCCACTGGCCTGAGCACAACCAATAGCAACGTGACATCGCTGTCGACATCTGCCTCGACGGGTATTACTTCGTTGTCCACTGGCCTGAGCACAACCAATAGCAACGTGACATCGCTGTCGACATCTGCCTCGACGGGTATTACTTCGTTGTCCACTGGCCTGAGCACAACCAATAGCAACGTGACATCGCTGTCGACATCTGCCTCGACGGGTATTACTTCGTTGTCCACTGGCCTGAGCACCACCAACAGTAACGTGACATCGCTGTCGACATCTGCCTCGACGGGTATTACTTCGCTGTCCACCGGCCTGAGCACCACCAACAGTAACGTGACATCGCTGTCGACATCTGCTTCGACAGGTATCACTTCGCTGTCCACAGGCCTGAGCACAACCAACAGTAACGTGACATTGCTGTCGACATCTGCCTCGACGGGTATTACTTCGTTGTCCACCGGCCTGAGCACAACCAACAGTAACGTGACATCGCTGTCGACATCTGCCTCGACGGGTATTACTTCGTTGTCCACTGGTCTGAGCACCACTAACAGCAACGTGACTTCGCTGTCGACATCGGCTTCGACCGGCATCACTTCACTGTCCACCGGCCTGAGCACCACTAACAGCAACGTGACTTCGCTGTCGACTTCGGCTTCGACAGGCATCACTTCGCTGTCCACCGGCCTGAGCACCACCAACAGCAACGTGACTTCGTTGTCGACCTCGGCTTCGACAGGCATCACTTCGTTGTCCACTGGCCTGAGCACCACCAACAGTAACGTGACATCGCTGTCGACCTCGGCTTCGACAGGTATCACTTCACTGTCGACTGGTTTGAGCACCACCAACAGCAACGTAACGTCGCTGTCGACATCGGCTTCGACCGGCATCACTTCGCTGTCCACTGGTCTGAGCACAACCAACAGTAACGTGACGTCGTTGTCGACATCTGCCTCGACGGGTATTACTTCGCTGTCCACTGGTCTGAGCACCACCAACAGTAACGTGACATCGCTGTCGACCTCGGCTTCGACAGGTATCACTTCGCTGTCCACTGGCCTGAGCACAACCAACAGTAACGTGACGTCGTTGTCGACTTCGGCTTCGACAGGCATCACTTCGCTGTCCACTGGTCTGAGCACCACCAACAGTAACGTGACATCGCTGTCGACCTCGGCTTCGACAGGTATCACTTCGCTGTCCACTGGCCTGAGCACCACCAACAGTAACTTGACATCGTTGTCGACCTCGGCTTCGACAGGCATCACTTCGCTGTCCACTGGCTTGAGCACAACCAATAGCAACGTGACTTCGTTGTCGACCTCGGCTTCGACAGGCATCACTTCGTTGTCGACCTCGGCTTCGACAGGCATCACTTCGTTGTCGACCTCGGCTTCGACAGGCATCACTTCGTTGTCCACTGGCCTGAGCACCACTAACAGCAACGTGACTTCGTTGTCGACCTCGGCTTCGACAGGTATCACTTCGCTGTCCACTGGCTTGAGCACAACCAATAGCAACGTGACTTCGCTGTCGACATCGGCTTCGACAGGTATCACTTCG

>NZ_CP013235|2|1|2234036-2236134|CRT
TCACATCGTTGTCGACATCAACTTCGACCGGCATCAGTACA	TCACGGGTAGCAGAAGCGTCCTTGTCGACGGGTTTGAGTACAACCAACAGCAACG
TCACATCGCTGTCTACCTCGGCTTCTACGGGCATTACTTCG	CTGTCGACTGGTCTGAGCACAACCAACAGTAATG
TCGCATCGTTGTCGACATCAACTTCGACCGGCATCAGTACA	TCACGGGTAGCAGAAGCGTCCTTGTCGACTGGCTTGAGCACAACCAACAGTAACG
TGACATCGTTGTCGACCTCGGCTTCGACAGGTATCACTTCG	TTGTCGACGGGTCTGAGCACCACCAACAGCAACG
TCACATCGCTGTCGACCTCGGCTTCGACAGGCATCACTTCG	CTGTCCACTGGCTTGAGCACAACTAACAGCAACG
TGACCTCGCTGTCGACCTCGGCTTCGACAGGTATTACTTCG	CTGTCCACGGGTCTGAGCACCACTAACAGCAACG
TGACCTCGCTGTCGACATCTGCCTCGACGGGTATTACTTCG	TTGTCCACTGGCCTGAGCACAACCAATAGCAACG
TGACATCGCTGTCGACATCTGCCTCGACGGGTATTACTTCG	TTGTCCACTGGCCTGAGCACAACCAATAGCAACG
TGACATCGCTGTCGACATCTGCCTCGACGGGTATTACTTCG	TTGTCCACTGGCCTGAGCACAACCAATAGCAACG
TGACATCGCTGTCGACATCTGCCTCGACGGGTATTACTTCG	TTGTCCACTGGCCTGAGCACCACCAACAGTAACG
TGACATCGCTGTCGACATCTGCCTCGACGGGTATTACTTCG	CTGTCCACCGGCCTGAGCACCACCAACAGTAACG
TGACATCGCTGTCGACATCTGCTTCGACAGGTATCACTTCG	CTGTCCACAGGCCTGAGCACAACCAACAGTAACG
TGACATTGCTGTCGACATCTGCCTCGACGGGTATTACTTCG	TTGTCCACCGGCCTGAGCACAACCAACAGTAACG
TGACATCGCTGTCGACATCTGCCTCGACGGGTATTACTTCG	TTGTCCACTGGTCTGAGCACCACTAACAGCAACG
TGACTTCGCTGTCGACATCGGCTTCGACCGGCATCACTTCA	CTGTCCACCGGCCTGAGCACCACTAACAGCAACG
TGACTTCGCTGTCGACTTCGGCTTCGACAGGCATCACTTCG	CTGTCCACCGGCCTGAGCACCACCAACAGCAACG
TGACTTCGTTGTCGACCTCGGCTTCGACAGGCATCACTTCG	TTGTCCACTGGCCTGAGCACCACCAACAGTAACG
TGACATCGCTGTCGACCTCGGCTTCGACAGGTATCACTTCA	CTGTCGACTGGTTTGAGCACCACCAACAGCAACG
TAACGTCGCTGTCGACATCGGCTTCGACCGGCATCACTTCG	CTGTCCACTGGTCTGAGCACAACCAACAGTAACG
TGACGTCGTTGTCGACATCTGCCTCGACGGGTATTACTTCG	CTGTCCACTGGTCTGAGCACCACCAACAGTAACG
TGACATCGCTGTCGACCTCGGCTTCGACAGGTATCACTTCG	CTGTCCACTGGCCTGAGCACAACCAACAGTAACG
TGACGTCGTTGTCGACTTCGGCTTCGACAGGCATCACTTCG	CTGTCCACTGGTCTGAGCACCACCAACAGTAACG
TGACATCGCTGTCGACCTCGGCTTCGACAGGTATCACTTCG	CTGTCCACTGGCCTGAGCACCACCAACAGTAACT
TGACATCGTTGTCGACCTCGGCTTCGACAGGCATCACTTCG	CTGTCCACTGGCTTGAGCACAACCAATAGCAACG
TGACTTCGTTGTCGACCTCGGCTTCGACAGGCATCACTTCG	TTGTCGACCTCGGCTTCGACAGGCA
TCACTTCGTTGTCGACCTCGGCTTCGACAGGCATCACTTCG	TTGTCCACTGGCCTGAGCACCACTAACAGCAACG
TGACTTCGTTGTCGACCTCGGCTTCGACAGGTATCACTTCG	CTGTCCACTGGCTTGAGCACAACCAATAGCAACG
TGACTTCGCTGTCGACATCGGCTTCGACAGGTATCACTTCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013235.1\|WP_061533349.1\|2228195_2229548_+\|GHKL-domain-containing-protein	unknown	unknown	gnl\|CDD\|182388
NZ_CP013235.1\|WP_082797860.1\|2233143_2233236_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379020
NZ_CP013235.1\|WP_061533359.1\|2245440_2247444_+\|cytochrome-o-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|131890
NZ_CP013235.1\|WP_061533345.1\|2225273_2225678_+\|glyoxalase/bleomycin-resistance/dioxygenase-family-protein	unknown	unknown	gnl\|CDD\|380093
NZ_CP013235.1\|WP_061533351.1\|2231353_2232013_+\|SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|366722
NZ_CP013235.1\|WP_061533358.1\|2244408_2245338_+\|ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|213620
NZ_CP013235.1\|WP_061533348.1\|2227557_2228220_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP013235.1\|WP_082797862.1\|2249403_2250753_+\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP013235.1\|WP_082798051.1\|2241323_2242355_-\|cupin-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|372651
NZ_CP013235.1\|WP_061533361.1\|2248068_2248524_+\|cytochrome-o-ubiquinol-oxidase-subunit-IV	unknown	unknown	gnl\|CDD\|131894
NZ_CP013235.1\|WP_061533357.1\|2240822_2241266_+\|DUF4019-domain-containing-protein	unknown	unknown	gnl\|CDD\|372517
NZ_CP013235.1\|WP_061533350.1\|2229590_2230004_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133398
NZ_CP013235.1\|WP_061535280.1\|2242907_2244254_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340927
NZ_CP013235.1\|WP_061533347.1\|2226756_2227503_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227049
NZ_CP013235.1\|WP_061533362.1\|2250742_2251279_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|226933
NZ_CP013235.1\|WP_128083033.1\|2230073_2231327_+\|NADH:flavin-oxidoreductase/NADH-oxidase-family-protein	unknown	unknown	gnl\|CDD\|240084
NZ_CP013235.1\|WP_061533352.1\|2232062_2232341_-\|DUF4148-domain-containing-protein	unknown	unknown	gnl\|CDD\|379321
NZ_CP013235.1\|WP_082797861.1\|2248520_2249420_+\|SURF1-family-protein	unknown	unknown	gnl\|CDD\|225883
NZ_CP013235.1\|WP_061533346.1\|2225912_2226686_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227049
NZ_CP013235.1\|WP_061533360.1\|2247436_2248072_+\|cytochrome-o-ubiquinol-oxidase-subunit-III	unknown	unknown	gnl\|CDD\|131889

Protein	Function_ID	Function_description	E-value
NZ_CP013235.1\|WP_061533349.1\|2228195_2229548_+\|GHKL-domain-containing-protein	gnl\|CDD\|182388	PRK10337, PRK10337, sensor protein QseC; Provisional.	4.14032e-58
NZ_CP013235.1\|WP_082797860.1\|2233143_2233236_+\|hypothetical-protein	gnl\|CDD\|379020	pfam13018, ESPR, Extended Signal Peptide of Type V secretion system. This conserved domain is called ESPR for Extended Signal Peptide Region. It is present at the N-terminus of the signal peptides of proteins belonging to the Type V secretion systems, including the autotransporters (T5aSS), TpsA exoproteins of the two-partner system (T5bSS) and trimeric autotransporters (TAAs). So far, the ESPR is present only in Gram-negative bacterial proteins originating from the classes Beta- and Gamma-proteobacteria. ESPR severely impairs inner membrane translocation, suggesting that it adopts a particular conformation or it interacts with a cytoplasmic or inner membrane co-factor, prior to exportation. Deletion of ESPR causes mis-folding of the TAAs passenger domain in the periplasm, substantially impairing its translocation across the outer membrane.	7.57321e-08
NZ_CP013235.1\|WP_061533359.1\|2245440_2247444_+\|cytochrome-o-ubiquinol-oxidase-subunit-I	gnl\|CDD\|131890	TIGR02843, Cytochrome_bo3_ubiquinol_oxidase_subunit_1, cytochrome o ubiquinol oxidase, subunit I. Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport].	0
NZ_CP013235.1\|WP_061533345.1\|2225273_2225678_+\|glyoxalase/bleomycin-resistance/dioxygenase-family-protein	gnl\|CDD\|380093	pfam18029, Glyoxalase_6, Glyoxalase-like domain. This entry comprises a diverse set of domains related to the Glyoxalase domain. The exact specificity of these proteins is uncertain.	4.15452e-17
NZ_CP013235.1\|WP_061533351.1\|2231353_2232013_+\|SAM-dependent-methyltransferase	gnl\|CDD\|366722	pfam01596, Methyltransf_3, O-methyltransferase. Members of this family are O-methyltransferases. The family includes catechol o-methyltransferase, caffeoyl-CoA O-methyltransferase and a family of bacterial O-methyltransferases that may be involved in antibiotic production.	1.53376e-84
NZ_CP013235.1\|WP_061533358.1\|2244408_2245338_+\|ubiquinol-oxidase-subunit-II	gnl\|CDD\|213620	TIGR01433, precursor_Cytochrome_o_subunit_2_Oxidase, cytochrome o ubiquinol oxidase subunit II. This enzyme catalyzes the oxidation of ubiquinol with the concomitant reduction of molecular oxygen to water. This acts as the terminal electron acceptor in the respiratory chain. Subunit II is responsible for binding and oxidation of the ubiquinone substrate. This sequence is closely related to QoxA, which oxidizes quinol in gram positive bacteria but which is in complex with subunits which utilize cytochromes a in the reduction of molecular oxygen. Slightly more distantly related is subunit II of cytochrome c oxidase which uses cyt. c as the oxidant. [Energy metabolism, Electron transport].	1.79977e-124
NZ_CP013235.1\|WP_061533348.1\|2227557_2228220_+\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	1.69384e-74
NZ_CP013235.1\|WP_082797862.1\|2249403_2250753_+\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	1.03392e-27
NZ_CP013235.1\|WP_082798051.1\|2241323_2242355_-\|cupin-like-domain-containing-protein	gnl\|CDD\|372651	pfam13621, Cupin_8, Cupin-like domain. This cupin like domain shares similarity to the JmjC domain.	1.38871e-74
NZ_CP013235.1\|WP_061533361.1\|2248068_2248524_+\|cytochrome-o-ubiquinol-oxidase-subunit-IV	gnl\|CDD\|131894	TIGR02847, Cytochrome_bo3_ubiquinol_oxidase_subunit_4, cytochrome o ubiquinol oxidase subunit IV. Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport].	7.7463e-35
NZ_CP013235.1\|WP_061533357.1\|2240822_2241266_+\|DUF4019-domain-containing-protein	gnl\|CDD\|372517	pfam13211, DUF4019, Protein of unknown function (DUF4019). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 130 and 183 amino acids in length. There is a single completely conserved residue E that may be functionally important.	1.01845e-23
NZ_CP013235.1\|WP_061533350.1\|2229590_2230004_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133398	cd04770, HTH_HMRTR, Helix-Turn-Helix DNA binding domain of Heavy Metal Resistance transcription regulators. Helix-turn-helix (HTH) heavy metal resistance transcription regulators (HMRTR): MerR1 (mercury), CueR (copper), CadR (cadmium), PbrR (lead), ZntR (zinc), and other related proteins. These transcription regulators mediate responses to heavy metal stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	2.5173e-30
NZ_CP013235.1\|WP_061535280.1\|2242907_2244254_-\|MFS-transporter	gnl\|CDD\|340927	cd17369, MFS_ShiA_like, Shikimate transporter and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli shikimate transporter (ShiA), inner membrane metabolite transport protein YhjE, and other putative metabolite transporters. ShiA is involved in the uptake of shikimate, an aromatic compound involved in siderophore biosynthesis. It has been suggested that YhjE may mediate the uptake of osmoprotectants. The ShiA-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.43087e-89
NZ_CP013235.1\|WP_061533347.1\|2226756_2227503_+\|hypothetical-protein	gnl\|CDD\|227049	COG4705, COG4705, Uncharacterized membrane-anchored protein conserved in bacteria [Function unknown].	1.55673e-90
NZ_CP013235.1\|WP_061533362.1\|2250742_2251279_+\|response-regulator-transcription-factor	gnl\|CDD\|226933	COG4567, COG4567, Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription].	4.94578e-80
NZ_CP013235.1\|WP_128083033.1\|2230073_2231327_+\|NADH:flavin-oxidoreductase/NADH-oxidase-family-protein	gnl\|CDD\|240084	cd04733, OYE_like_2_FMN, Old yellow enzyme (OYE)-related FMN binding domain, group 2. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction. Other members of OYE family include trimethylamine dehydrogenase, 2,4-dienoyl-CoA reductase, enoate reductase, pentaerythriol tetranitrate reductase, xenobiotic reductase, and morphinone reductase.	0
NZ_CP013235.1\|WP_061533352.1\|2232062_2232341_-\|DUF4148-domain-containing-protein	gnl\|CDD\|379321	pfam13663, DUF4148, Domain of unknown function (DUF4148).	8.03372e-05
NZ_CP013235.1\|WP_082797861.1\|2248520_2249420_+\|SURF1-family-protein	gnl\|CDD\|225883	COG3346, COG3346, Uncharacterized conserved protein [Function unknown].	3.52915e-74
NZ_CP013235.1\|WP_061533346.1\|2225912_2226686_+\|hypothetical-protein	gnl\|CDD\|227049	COG4705, COG4705, Uncharacterized membrane-anchored protein conserved in bacteria [Function unknown].	3.25413e-92
NZ_CP013235.1\|WP_061533360.1\|2247436_2248072_+\|cytochrome-o-ubiquinol-oxidase-subunit-III	gnl\|CDD\|131889	TIGR02842, Cytochrome_bo3_ubiquinol_oxidase_subunit_3, cytochrome o ubiquinol oxidase, subunit III. Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport].	1.96084e-102

>NZ_CP013235.1|WP_082797860.1|2233143_2233236_+|hypothetical-protein
MNKVYRTVYSEALGAWVAVSENTAARGKHS
>NZ_CP013235.1|WP_061533352.1|2232062_2232341_-|DUF4148-domain-containing-protein
MRILPTVLAALTLSATASAFAEAPYPPEQPFTSTLSRAQVMQAVTDAQAQGVLVQGDSSYPVTSAPSAPEPQRMTAQHIEKKDAGDAIYSGA
>NZ_CP013235.1|WP_061533351.1|2231353_2232013_+|SAM-dependent-methyltransferase
MSRRTLNLDDTVYNYLLEHSLREHPVQTALRQVTSTHARGTMQISPEQGQFMALLVRLIGARKTIEIGVFTGYSALAVALALPDDGEILACDISDDYTRIGRPYWEEAGVAHKIDLRLAPALETLDARLAAGAAGQYDFAFIDADKTSYDAYYERCLQLLRRGGLIAIDNVLWSGSVASPAKDADTAALQQLNDKLHRDDRIDLSMLPIGDGLTLVRKL
>NZ_CP013235.1|WP_128083033.1|2230073_2231327_+|NADH:flavin-oxidoreductase/NADH-oxidase-family-protein
MTSTLFAPLQLPNGSILPNRLAKAAMEENMADEGQLPGSAILRLYRTWAQGGAGLIITGNVMVDGRALTGPGGIVLESGTPLVPFKQWADVAKEQGAQVWMQINHPGRQILAAMGGTAWAPSAVPLEMGKHSKLFVQPKAMDEAEIREIIERFANTAEAAERAGFNGVEIHAAHGYLISQFLSPLANRRTDQWGGSLVNRARLLLEVVRAVRARVQGGFCVAVKLNSADFQRGGFSEDDAKQVILWLNDLSVDLVELSGGSYESPAMQGRSVDGRTLAREAYFLEFARELAAVARMPLMTTGGIRRKAVAEQVLASGVAVAGMATALAIAPDLPAKWRSGDGPSADSPQVDWKDQVMAAVARMALIKRRLRVLGAGRISTGRHSAAISLFIDQLRTRRLTRRYRRWHQAREASGMVN
>NZ_CP013235.1|WP_061533350.1|2229590_2230004_-|MerR-family-transcriptional-regulator
MKIGELADQTGLAPSAIRYYEHSGLLPKATRGANGYRVYAETAVERLRLIQMAQNLGFSLDALRNVFASGEDFSKEDLLAGLDRRLGEIEQLMRTLRDQRQELRALRSTLTEAWAQGECFKAAGPLNGKLAKSGQAN
>NZ_CP013235.1|WP_061533349.1|2228195_2229548_+|GHKL-domain-containing-protein
MDGIQGKMKRSLQYRLSIWLSLAIIGIALAAGVFSFFSAFRDAHELQDDQLKQIAALVSRHHLQVTLADHPESVPDIDPESRVIVQALPPATGSAQAADGQALLLPANVRDGMHTVAVHDHEWRLFAKTLDDGSRIAVAQQTEVRDEVARDSALRTVMPFVILVPVLLILMGVLIRQMFKPLRHLASDLDERSEQNLEPLSATNLPLEIMPFVVAINRLLARVARSVDVQRRFVADAAHELRTPLTALSLQAERLDAAEMSPPAKERLVTLKRGIQRNRMLLDQLLALARVQQTAYGERNAVSIQQVIRQVLEDLLPLAESKQLDLGMISDVDARVAASEMDLKTLLKNLVDNAIRYTPENGRIDLSIKVDEASVVLQIDDTGPGIAVEERERVFDPFYRVLGNDEVGSGLGLSIVKTIADRIGASVALRAASSSPTPGLSVLLTLKRAM
>NZ_CP013235.1|WP_061533348.1|2227557_2228220_+|response-regulator-transcription-factor
MRVLLVEDDRMIGEAVEQALKDATYAVDWVRDGQAALLAVGTQAYDAVLLDLGLPKRDGVTVLQSIRAQGNPVPLLIVTARDAVEDRIQGLDSGADDYVLKPFEMSELLARIRAVMRRKAGVSGPVLSNGVLSLDPVSREVSIDGVATRLSAREFSLLQALLLRPGAILSRSELEDRIYGWNEEVESNAVEFLIYSLRKKLGSAAIKNVRGMGWMVSKEK
>NZ_CP013235.1|WP_061533347.1|2226756_2227503_+|hypothetical-protein
MNKLPQITLAFWIMKICATTLGETAGDLLSMTLNVGYAASSIILISCFLVMLLIQLSSRKFHPFLYWGVILATSTAGTTMSDYMDRTMGLGYAAGSLLLVSILLAILAYWRITEKTLAVDNIKTFKVELLYWIAILFSNTLGTALGDFLADSSGLGFAGGALLIGGVIGLVVVAHFYTRISGVLLFWVAFVLTRPLGATMGDLFTKPLDKGGLGFGTVGSSAILAVTLAIFVGWSTWDRARLAQRVQG
>NZ_CP013235.1|WP_061533346.1|2225912_2226686_+|hypothetical-protein
MQESAGGNISNMLNKVPEVTFVFWIIKIMATTVGETAADFLAGDLKLGLGGTSVLMAGLLLISLFLQIRSKKYIPWLYWLTVVLVSIVGTLISDNLVDNLGVTLQAITMTFSLALLFVFIAWYASQQTLSIHAIHTTRREMFYWAAILITFALGTAAGDLAAEGLNLGYATSAMIFGGLIGLVYFTYYVFKANAIAAFWIAYILTRPFGASCGDLLSQPNANGGLALGTTGTSAVFLLIILGLVGHLTLRQKVAAAR
>NZ_CP013235.1|WP_061533345.1|2225273_2225678_+|glyoxalase/bleomycin-resistance/dioxygenase-family-protein
MEFLVNLDVDNLDKAIQFYETSFGLTVGRRFGVSGAEMLGSSAPIYLLVKAEGTPAANATAQRRTYERHWTPIHLDFVVEDIESAVRRAVSVGARLEEPVATQKWGRLALMADPFGNGFCFVQFLGRGYDEIAD
>NZ_CP013235.1|WP_061533357.1|2240822_2241266_+|DUF4019-domain-containing-protein
MKRIFVLLSFICLLAGISTTAMAQEGSSADALIQNGIAVLQQIDRDGSGDVWEGAAAFVKAKLPKDAFVKNIRQARSTIGVVAQRRWASVVRIRYNTQAGDTPPGLYANIDYATDLRDGTTVFELISFQLDPNGVWRVTGYIPRNKQ
>NZ_CP013235.1|WP_082798051.1|2241323_2242355_-|cupin-like-domain-containing-protein
MTAESQKLQKIPEWHDVDDEIFKNEIIAQYRPAVLRGFVRKWPVVRHGLHSPEAVCRYLHGFDNGNHVDAIMTPPEVKGRIFYQGDMNGFNFMRNRLPVSAVLEQLLRYARFPESPSVAVQSARIADCMPGFLNENKLTALDPSILPRIWIGNKVTVPAHIDEAHNIACSVSGRRRFTLFPPEQVSNLYIGPLDYAPTGAPISMVSLNQPDFQRYPKFREALAAAQMTELEPGDAIYIPTLWWHHVESLEKINILINYWWGGSIGSADQPHSPFDALFHALLNMRGLSPEIRSAWGAMFAHFAFDAAANPTAHIPAHRHGVLGELPPELAAQLRAWLAGKLQP
>NZ_CP013235.1|WP_061535280.1|2242907_2244254_-|MFS-transporter
MTSIHINSEHSANFSSQSTVKDGQTTRSDHPAIAPGEIAIGVVIGRASEYFDFFVYAIASVLVFPAVFFPSEPQLEGTLYAFVIFSFAFLARPFGTVAFMAIQRYFGREVKLTAALFILGLSTAGIAFLPTYEHLGFASIVLLSLLRIGQGIALGGSWDGLPSLLALNAPAKKRGWYAMMGQLGAPIGFIVAGSLFAYMLANLTTDDFLDWGWRYPFYVAFAINVVALFARLRLVSTPEYARLLDERELEPTNAIEMTRSQGRNLIIGALAALASYALFHLVTVFPLSWITLYSLRAPSDFLHIEIIGAALMAVGVVASGLIADRIGRRTTLGACALLIAILSAFVPTLMNGGEFGQNAFILLGFSLLGLSYGQAAGAVTANFPAKYRYTGAALTSDLAWLVGAGFAPLVALGLSAHFGLAYVSFYLLSGAACSMAALSLNRALEIRD
>NZ_CP013235.1|WP_061533358.1|2244408_2245338_+|ubiquinol-oxidase-subunit-II
MFSLIVRRGLLLLPVILLAGCNTVVMNPSGDIAKQQSHLIIVSTLLMLLIIIPVIALTIWFAWRYRKNNTAARYEPDWDHSTQLELVIWGAPLLIIIALGLLTWISTHTLDPYRPLSRLDADRPVSADTKTLTVEVVALDWKWLFIYPEQGIATVNELAAPVDMPIRFKITASTVMNSFFIPALAGQIYAMPGMETSLNAVINQPGEFEGFSANYSGAGFSGMRFKFHGMTAENFDQWVKNAKAGGGALKRAEYLELEKPSERDPVRRFAAVDSDLYHAIVNRCVEPGQVCMDKMMATDTNVKAGMHHE
>NZ_CP013235.1|WP_061533359.1|2245440_2247444_+|cytochrome-o-ubiquinol-oxidase-subunit-I
MLDHIDLTKLIFGRLTWDAIPFHEPILLVTFAMVALGGVALLAALTYYRVWGTLWRDWFTSIDHKRIGIMYMVLGLVMLLRGFADALMMRAQQAFAFGDSAGFLPPHHYDQIFTAHGVIMIFFVAMPLVTGLMNYVVPLQIGARDVAFPFLNNFSFWMTTFGGGLVMASLFVGEFARTGWLAYPPLSGILGSPDVGVDYYIWALQIAGVGTLLSGVNLIVTIVKMRAPGMNMMKMPVFTWTALCTNVLIVAAFPVLTAVLGMLALDRVVGTNFFTNDMGGNAMMYVNLIWIWGHPEVYILILPAFGIFSEVVSTFSSKRLFGYTSMVYATVVITILSYLVWLHHFFTMGSGASVNSFFGITTMIISIPTGAKIFNWLFTMYRGRIRFEVPMLWTMGFMITFVIGGMTGVLLAVPPADFVLHNSLFLIAHFHNVIIGGVLFGMFAGINYWFPKAFGYKLDDFWGRCCFWFWTIGFYFAFMPLYVLGLMGVTRRMSHFEDPSLQIWFIIAAFGAVLIALGIASFLVQLVVSFRRRHELRDTTGDPWGGRTLEWSTSSPPPDYNFAFTPVVHDNDAWTDMKNNNYVRPQQGFTDIHMPKNTAAGFIIAGLSAAVGFALIWQMWLLAGLGFVAMVAAVIIHTFNYNRDYHIPADEVIRTEGERTRLLASHV
>NZ_CP013235.1|WP_061533360.1|2247436_2248072_+|cytochrome-o-ubiquinol-oxidase-subunit-III
MSDISTSSAGALSADPSSRYFVREHHPENGTLLGFWLYLMSDCLVFACLFATYAVLGRNYAGGPTGAELFDLPLVALNTALLLLSSITYGFAMLEMQRKKQGATIAWLAITGVLGACFIAFELYEFAHLIHEGAGPQRSGFLTSFFALVATHGLHVSFGIIWLITLIFQVRRHGLTPENGRRLMCLSMFWHFLDVVWIGVFTFVYLMGVLP
>NZ_CP013235.1|WP_061533361.1|2248068_2248524_+|cytochrome-o-ubiquinol-oxidase-subunit-IV
MSGHQQHPALVVPHSHDHDTHVDHGTVKSYVTGFVLAVILTAIPFWLVMGKVIDKSSTTGIVLLAFGAVQIVVHMIYFLHMNTKSEGGWTMLAMLFTVMVVGIMLSGSLWVMYHLNHNMMPGMTPASMQETVPESMQNMPASHDMHNMKMQ
>NZ_CP013235.1|WP_082797861.1|2248520_2249420_+|SURF1-family-protein
MTPAPHSKVPGDGLPDNTAVAAQDVKPRQRSRATRLLLAACAGLLFFGFVALGSWQLKRLQWKLDLIERVEQRVHAPATAAPDRESWPHISAENDEYRHVRLTGNFLYELTTPVQAVTELGNGFWLLTPLRSADGNIVMVNRGFVAAKVGDWKSQDSAEQTGAGLSSPAPVSVTGLLRISEPGGGFLRHNDPSANHWYSRDVQAIAAARGLSAAAPYFVDADAGQSGSGGTAAGQPIGGLTVISFHNSHLVYALTWYALALMVAGACFWVVREERRMLRVAASASGDGIDRESEDGKQN
>NZ_CP013235.1|WP_082797862.1|2249403_2250753_+|HAMP-domain-containing-histidine-kinase
MASKIEPNANTGELKEAIAGAAGPEDTTGHKNMLRLIQLRWIAVIGQITTIAVVMIGFGIHLPLPHMLMVLACLIAFNIGSHLRWHERTEVSNNELFLALLVDVGSLTAQLYLSGGTANPFAFLFLLQVILSAVLLEAWSTWTIVAITSACLAGLSLFSEPLRLPADHGNGLASLYVDGMLLCFAMIAALLVFFVTRINHNLRAGDAQLADLRQRAAEEDHIVRMGLLASGAAHELGTPLATLSVILGDWRRMPEFSNNSELLEEISEMQTQLQRCKSIVSGILLSAGEARGESSVKTTISTFLNDLAKEWCTTRPIVSFAYENRIQQDMPVVFDSALKQMICNVLDNALEASPQWVSLEATREGDSLILQVTDAGPGFVPAMLNHIGKPYQSSKGRPGSGLGLFFVVNVARKLGGVVSARNRSEGGAEVRLTLPLAAISLEEEIVNVG
>NZ_CP013235.1|WP_061533362.1|2250742_2251279_+|response-regulator-transcription-factor
MSVDRLLLIIEDDAAFARTLGRSFERRGYTVLLAESLDQAAEFLKQHSPGYAVVDLKLNGNTSGLACVQMLHKHDPEMLIVVLTGFASITTAVEAIKLGACQYLAKPSNTDDIEAAFGHVAGVADVELTSRSTSIKTLEWERIHEVLVETGFNISETARRLGMHRRTLARKLEKQRIK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP013235_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013235_3

2590414-2590520

Orphan

Consensus_repeat	Method
GCCAATGGGCCGCTGCCCGAACCAGTTGCGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013235_3

>merge|NZ_CP013235|3|2590414-2590520|CRISPRCasFinder
GCCAATGGGCCGCTGCCCGAACCAGTTGCGCCGCCGACTGCACCAGTCAAGCCGCTCAGCAAACCGGTAACCGGTGCCAATGGGCCACTGCCCGAACCAGTTGCGCC

>NZ_CP013235|3|2|2590414-2590520|CRISPRCasFinder
GCCAATGGGCCGCTGCCCGAACCAGTTGCGCC	GCCGACTGCACCAGTCAAGCCGCTCAGCAAACCGGTAACCGGT
GCCAATGGGCCACTGCCCGAACCAGTTGCGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013235.1\|WP_061533594.1\|2596912_2597617_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213222
NZ_CP013235.1\|WP_061533590.1\|2587051_2588074_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|227311
NZ_CP013235.1\|WP_082799744.1\|2592333_2593107_+\|peptidoglycan-DD-metalloendopeptidase-family-protein	unknown	unknown	gnl\|CDD\|236782
NZ_CP013235.1\|WP_082797888.1\|2602376_2603507_+\|DUF4401-domain-containing-protein	unknown	unknown	gnl\|CDD\|379574
NZ_CP013235.1\|WP_061537243.1\|2593177_2594410_-\|DUF3443-domain-containing-protein	unknown	unknown	gnl\|CDD\|314750
NZ_CP013235.1\|WP_061533587.1\|2584907_2585525_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013235.1\|WP_061533586.1\|2583283_2584156_-\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|273359
NZ_CP013235.1\|WP_061533596.1\|2600208_2601291_+\|carotenoid-1,2-hydratase	unknown	unknown	gnl\|CDD\|377781
NZ_CP013235.1\|WP_061533595.1\|2597624_2600207_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|274576
NZ_CP013235.1\|WP_061533588.1\|2585622_2586429_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237537
NZ_CP013235.1\|WP_128083058.1\|2584231_2584438_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013235.1\|WP_082797887.1\|2601357_2602422_+\|DUF2157-domain-containing-protein	unknown	unknown	gnl\|CDD\|378311
NZ_CP013235.1\|WP_082798058.1\|2581514_2581637_-\|entericidin-A/B-family-lipoprotein	unknown	unknown	gnl\|CDD\|227797
NZ_CP013235.1\|WP_082799743.1\|2588104_2589670_+\|diguanylate-cyclase	unknown	unknown	gnl\|CDD\|226229
NZ_CP013235.1\|WP_061535316.1\|2596474_2596687_-\|DUF3820-family-protein	unknown	unknown	gnl\|CDD\|378970
NZ_CP013235.1\|WP_061537239.1\|2581673_2583074_-\|3-isopropylmalate-dehydratase-large-subunit	unknown	unknown	gnl\|CDD\|235490
NZ_CP013235.1\|WP_082797886.1\|2594422_2594899_-\|DUF2844-domain-containing-protein	unknown	unknown	gnl\|CDD\|314047
NZ_CP013235.1\|WP_061537241.1\|2589673_2589868_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013235.1\|WP_061537240.1\|2586450_2586744_+\|transposase	unknown	unknown	gnl\|CDD\|366690
NZ_CP013235.1\|WP_061537244.1\|2595060_2596413_-\|C4-dicarboxylate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270238

Protein	Function_ID	Function_description	E-value
NZ_CP013235.1\|WP_061533594.1\|2596912_2597617_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	1.74925e-90
NZ_CP013235.1\|WP_061533590.1\|2587051_2588074_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|227311	COG4977, COG4977, Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription].	3.08873e-76
NZ_CP013235.1\|WP_082799744.1\|2592333_2593107_+\|peptidoglycan-DD-metalloendopeptidase-family-protein	gnl\|CDD\|236782	PRK10871, nlpD, murein hydrolase activator NlpD.	2.08107e-42
NZ_CP013235.1\|WP_082797888.1\|2602376_2603507_+\|DUF4401-domain-containing-protein	gnl\|CDD\|379574	pfam14351, DUF4401, Domain of unknown function (DUF4401). This family of proteins is found in bacteria. Proteins in this family are typically between 357 and 735 amino acids in length. The family is found in association with pfam09925. There is a single completely conserved residue K that may be functionally important.	2.12017e-16
NZ_CP013235.1\|WP_061537243.1\|2593177_2594410_-\|DUF3443-domain-containing-protein	gnl\|CDD\|314750	pfam11925, DUF3443, Protein of unknown function (DUF3443). This family of proteins are functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 400 to 434 amino acids in length. This protein has two conserved sequence motifs: NPV and DNNG.	1.75677e-153
NZ_CP013235.1\|WP_082798058.1\|2581514_2581637_-\|entericidin-A/B-family-lipoprotein	gnl\|CDD\|227797	COG5510, COG5510, Predicted small secreted protein [Function unknown].	2.69627e-05
NZ_CP013235.1\|WP_061533586.1\|2583283_2584156_-\|DMT-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	9.10004e-16
NZ_CP013235.1\|WP_061533588.1\|2585622_2586429_+\|hypothetical-protein	gnl\|CDD\|237537	PRK13875, PRK13875, conjugal transfer protein TrbL; Provisional.	0.00221215
NZ_CP013235.1\|WP_061533596.1\|2600208_2601291_+\|carotenoid-1,2-hydratase	gnl\|CDD\|377781	pfam07143, CrtC, CrtC N-terminal lipocalin domain. This family contains the members of the old Pfam family DUF2006. Structural characterization of family member NE1406 (from DUF2006 now merged into this family) has revealed a lipocalin-like fold with domain duplication.	3.95403e-79
NZ_CP013235.1\|WP_082797887.1\|2601357_2602422_+\|DUF2157-domain-containing-protein	gnl\|CDD\|378311	pfam09925, DUF2157, Predicted membrane protein (DUF2157). This domain, found in various hypothetical prokaryotic proteins, has no known function.	2.07048e-16
NZ_CP013235.1\|WP_061533595.1\|2597624_2600207_+\|ABC-transporter-permease	gnl\|CDD\|274576	TIGR03434, ADOP, Acidobacterial duplicated orphan permease. Members of this protein family are found, so far, only in three species of Acidobacteria, namely Acidobacteria bacterium Ellin345, Acidobacterium capsulatum ATCC 51196, and Solibacter usitatus Ellin6076, where they form large paralogous families. Each protein contains two copies of a domain called the efflux ABC transporter permease protein (pfam02687). However, unlike other members of that family (including LolC, FtsX, and MacB), genes for these proteins are essentially never found fused or adjacent to ABC transporter ATP-binding protein (pfam00005) genes. We name this family ADOP, for Acidobacterial Duplicated Orphan Permease, to reflect the restricted lineage, internal duplication, lack of associated ATP-binding cassette proteins, and permease homology. The function is unknown.	1.17438e-13
NZ_CP013235.1\|WP_082799743.1\|2588104_2589670_+\|diguanylate-cyclase	gnl\|CDD\|226229	COG3706, PleD, Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms].	7.4593e-57
NZ_CP013235.1\|WP_061535316.1\|2596474_2596687_-\|DUF3820-family-protein	gnl\|CDD\|378970	pfam12843, QSregVF_b, Putative quorum-sensing-regulated virulence factor. QSregVF_b is a family of short Pseudomonas proteins that are potential virulence factors. The structure of UniProtKB:Q9HY15 a secreted protein has been solved and deposited as Structure 3npd, from pfam13652. It is predicted that these two adjacent proteins form a single transcriptional unit based on the prediction that together they interact with their adjacent protein PotD, which is the putrescine-binding periplasmic protein in the polyamine uptake system comprising PotABCD. These two adjacent proteins are predicted to be quroum-sensing-regulated virulence factors.	2.32725e-34
NZ_CP013235.1\|WP_061537239.1\|2581673_2583074_-\|3-isopropylmalate-dehydratase-large-subunit	gnl\|CDD\|235490	PRK05478, PRK05478, 3-isopropylmalate dehydratase large subunit.	0
NZ_CP013235.1\|WP_082797886.1\|2594422_2594899_-\|DUF2844-domain-containing-protein	gnl\|CDD\|314047	pfam11005, DUF2844, Protein of unknown function (DUF2844). This bacterial family of proteins has no known function.	4.45494e-47
NZ_CP013235.1\|WP_061537240.1\|2586450_2586744_+\|transposase	gnl\|CDD\|366690	pfam01527, HTH_Tnp_1, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family consists of various E. coli insertion elements and other bacterial transposases some of which are members of the IS3 family.	4.50017e-09
NZ_CP013235.1\|WP_061537244.1\|2595060_2596413_-\|C4-dicarboxylate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270238	cd13520, PBP2_TAXI_TRAP, Substrate binding domain of TAXI proteins of the tripartite ATP-independent periplasmic transporters; the type 2 periplasmic binding protein fold. This group includes Thermus thermophilus GluBP (TtGluBP) of TAXI-TRAP family and closely related proteins. TRAP transporters are ubiquitous in prokaryotes, but absent from eukaryotes. They are comprised of an SBP (substrate-binding protein) of the DctP or TAXI families and two unequally sized integral membrane components. Although TtGluBP is predicted to be an L-glutamate and/or an L-glutamine-binding protein, the substrate spectrum of TAXI proteins remains to be defined. A sequence-homology search also shows that TtGluBP shares low sequence homology with putative immunogenic proteins of uncharacterized function. The substrate-binding domain of TAXI proteins belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and tworeceptor cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.33514e-29

>NZ_CP013235.1|WP_061537241.1|2589673_2589868_-|hypothetical-protein
MRAEQIVDLIACASPQAQVPGNDLLIGMLAREIAALSYKLTEQELYRLIAVGALVYERGRRGRA
>NZ_CP013235.1|WP_082799743.1|2588104_2589670_+|diguanylate-cyclase
MNTPIAIAPRQVRFTLKPLPITLLATVFVVLVCTSLMMIEIWRSWNARSLQLHETEIATSNLARALSQHADDTLKEADTVLVGVVERLEMEGTGNVALERLHRLLVQHIGELPQLNDLSIYDETGLWLANAKNGPLPYLNNSDRQYFIHHLGSTDRGPFIGPPVRSRYDGDWIVTVSRRFNHPDGSFAGLALATINISYFKNYYDSFDIGRAGSIILSLNDGTMLVRRPMSDDTIGKNLANYPIYRDYAAKNAEGTAIVASGQDGVERLIAYRHLQEYPLFVTVARSKDEVLSGWLADSYLHLFGALLLTIALGLLGWRLIHQIRLRLLAEADLLQVQASLKTLNQHLEQLALQDSLTGLANRRQFDSALRDEFSRAMRTENPLALVMIDVDCFKQYNDLYGHPAGDECLRRISDVVKASKKRPGDLATRYGGEELAVLLPDTNLAGAIAVAEKIRLAIYNLHIEHPHGPAGVVTISAGVDAFVPVRDGNIPFELVQAADKALYAAKSAGRNRVCSNADLH
>NZ_CP013235.1|WP_061533590.1|2587051_2588074_+|helix-turn-helix-domain-containing-protein
MDIECVKTLEVIDDSSSIRHIGIIVFEGVVLADVVGAADVFGIGDKLISTVFPGTTRYAVSVLSISGGMIMSSASVQIMTSPLASFDEHQFDTLLIASGTGNFDAYRDPDLIAWLQRMRSSVRRIAAICTGVFVIGAAGFLNNRRATTHWALLDKLAREFPLVKIDRESQISEDDGIFTSCDVGMAADLALRLLENDLGPAVAQRVAQSLVVCQRRRDNPPAKHATRSADPAKSSKIHKASLWFVEHLAESISVVDAANHVSMSERNFVRQFKRETGQTPHDFLLNLRLEAVRQQLTETDLPVDKIARRCGLFSGEHVAKLFRKHMWTSPTEYRKGIRSS
>NZ_CP013235.1|WP_061537240.1|2586450_2586744_+|transposase
MKRTPFSSDQIAAALKQEELGMPVADVIRQAGITERTFLNWKKQYGGLPGYPHDLKCLQEENAKLKQIVAELTLENSRLQDALDDKRGKHEHYSSSN
>NZ_CP013235.1|WP_061533588.1|2585622_2586429_+|hypothetical-protein
MKRKLIGILIASAFTLPAIAQTTTPSTSSTATSVAVGGGGGTGGSAAGGTAAGGTATASSGGSATGGSSTVSLSVTLPSSSTSGTSGTSGTSGTSGTTAGTGTTSAAGDPAGTTSTVNYGGTYTVKTVPNIVAPSLTTTLSDTCMGSASFGLSFTGFGATGGTTMVDQACVRRLDSREFRAMGLNDVALALLCQSEANRKAVESTGRSCPGMERAAAPAAPAAPAAAPSASSTGTIGQNSINNIGDQYKDPLIRARLGLDTLSALTAR
>NZ_CP013235.1|WP_061533587.1|2584907_2585525_+|hypothetical-protein
MKKQIIAASIVSLFAVSAFAHSWGPSGSKTTNTTSTAVGVSIGGNGGAGGSATSGNATGGSATGGKATGGSASQTITGGTATSGNNLTAAGGGKATGGATSAGSTTGSSSTGGNGGGALFGSANGGGSSSGGTTGSGQLANGNALAGGGTATSGTGSSSANTGGYNAGGSAGNFVFAGGGTSGNASAGDGGAGGNASSHVSAGNH
>NZ_CP013235.1|WP_128083058.1|2584231_2584438_+|hypothetical-protein
MRKKFASTSAVRHFHANRESRHGAGVAAFWRNRSSHQIRTDTPSPLPNLDKRLVIFGTLSKSDIAYRD
>NZ_CP013235.1|WP_061533586.1|2583283_2584156_-|DMT-family-transporter
MNIAELLFLAAIWGASFLFMRIGAPEFGPVPLIALRVGIAALVLLPVMRSAVARSHMRSKLWPLLIVGIANSALPFSLFAYSTLHVSAGFDSILNATTPLWTGLIAFLWLKAPMSRAQVLGLLVGMAGVVTLVWDKIGEGLPSVWLAIGAVLLATLSYGFAINYSKTRLAGVPPFVVAFGSQFFATLVLLPLALWYWPSAAVSATAWYAVLALGVVCTGVAYAIFYRLLEHAGAAYAASVTFLIPIFGVIWGALFLQEQVTATMLLGCLIVLFGTALATGKLNPMRLLKS
>NZ_CP013235.1|WP_061537239.1|2581673_2583074_-|3-isopropylmalate-dehydratase-large-subunit
MLKTLYDKLWESHVVHTEPDGTAILYIDRHLLHEVTSPQAFEGLKLAGRKPWRLPANLMVADHNVPTTDRANGIADPISRLQVETLDANAKSYGLTYFGMNDHRQGIVHVIGPEQGATLPGMTVVCGDSHTSTHGAFGCLAHGIGTSEVEHVLATQTLLAKKSKSMLVQVDGAIPNGVTAKDIVLAVIGQIGTAGGTGYAIEFAGSAIRALSMEGRMTVCNMAIEAGARAGMIAVDDTTLNYVKGRPFSPVGPHWERAVSYWRTLHSDPGAKFDMVVTLNAAEIKPQVTWGTSPEMVVAVDGRVPDPDKEKDPTKRDGMEKALAYMALKPNTAIEDIRIDKVFIGSCTNSRIEDLRAAAAVVRGKFRASNVKLAMVVPGSGLVKEQAEREGLDRIFKDAGFEWREPGCSMCLAMNADRLEPGERCASTSNRNFEGRQGAGGRTHLVSPAMAAAAGIAGHFVDVRAL
>NZ_CP013235.1|WP_082798058.1|2581514_2581637_-|entericidin-A/B-family-lipoprotein
MRKVATLCVLLVAGMVMSACNTVHGFGQDMERVGEKIQGK
>NZ_CP013235.1|WP_082799744.1|2592333_2593107_+|peptidoglycan-DD-metalloendopeptidase-family-protein
MSLSVQNPRGLGPQKHKQMKFAGYLLSLVLTAALAACGTPSGSGGASQTPSGPGYYTVQKGDTLSSIARKFRRSNGEIIAWNKLADPNDIKVDQVLRVVPQGTRSSAPSTADSAKSPARGNSSADSNDNDTGADAKDAIDWGWPASGKSSNGAGQGKKGIDIFGQLGQPVLAAASGKVMYAGSGIRGYGNLVIVKHNSNLLSVYAHNKTITVKEGQMVSKGQQIAEMGKSDSNAVKLYFEIRRQGKPVDPTRYLPSR
>NZ_CP013235.1|WP_061537243.1|2593177_2594410_-|DUF3443-domain-containing-protein
MRPLTYLVCLLSSLLLVACGGGGGSSASTTPTTPPVVAPSVQNSVSIVVDSGPNTSSGQSVGAVNSPYVSVTICQPGSSTQCQTIDHILVDTGSSGLRLISSVLSGTAALPALTDAGGNAIAECARFADGYSWGSIKQADLRVAGEVAKGISVQIIGDNAFPNVPSGCSGSLVAENTVAAFRANGVIGISSFAQDCGSACASQALEGWYYTCPGGTCAAAALGVAKQVGNPVAAFPQDNNGTAIQLPAIGSSGAAGVTGTLIFGIGTQANNALGSATIYTLNSSGNLSALYQGTVMQAFFDSGSNGLFFADSTIPNCSVSQGFYCPISTLSRSVVNTGINGRSSTVNFNVANADALFQSNPNNTAFNNLAGGPAFTSYFDWGLPFFFGRSVYTAIEGATAAGTVGPYVAY
>NZ_CP013235.1|WP_082797886.1|2594422_2594899_-|DUF2844-domain-containing-protein
MRFPVSCLCAMLLAQSLPAFAALGGAPGAAQASNPQASSTQADSVRAKVAARVTNYNGYSVSETLEPSGTTVKEYVSADNIVFAVSWQGPSMPNLQQLLGSYSEQYVAAASVPHAGRRAVAIQSDQLVLRSGGHMRSFAGSAYVPALLPQGVTPDDIR
>NZ_CP013235.1|WP_061537244.1|2595060_2596413_-|C4-dicarboxylate-ABC-transporter-substrate-binding-protein
MATPLNPAELKQSAINIKTRFVAISWRDLAISFGPIALLAIIAVWLAIWFIHPAPPKTITIATGPEHSNFWNTADKYRKIMARNGIKLKIVTSEGSLDNLRKLNDPNSGVDVGFVQGGVAGDMPIDQLVSLGSVAYVPVSVFYRGHKVLDRLSELGGKRVAIGLQGSGSRVLALTLLKANGIEPGGKTELLDMGGDEAAQALTDGKIDAAFLMGDSASPPTMGKLLRTPGVRLLDFAQASAYARRFSYLNELQIPKGMFDFGKNIPNRDMRLIAPTAELVAREDLHPALSDLLIDAAKEVNGGANVLQRAGEFPAPLAHEFRISDDATRYYKSGKGFFYRTLPFWLASLVDRTLVVVLPIILLLIPGFKLVPLLYGWRIKSRIYRWYGTLIALERAAVTHTPEEQAHLLKRLDHIEEAVNRMKMPLAFADQFYVLREHIGFVRSRLVNRS
>NZ_CP013235.1|WP_061535316.1|2596474_2596687_-|DUF3820-family-protein
MNPEYLQLLVTRQMPFGKYKGRLLADLPGDYLAWFAREGFPSGELGGLIALMYELDHNALTHLLAPLRGK
>NZ_CP013235.1|WP_061533594.1|2596912_2597617_+|ABC-transporter-ATP-binding-protein
MHITNTTSAINADIPALECRGLRKSYGHGRVVLHHLDFTLAAGEYVAIMGDSGVGKSTLLNLIAGLDNVNGGAILIDGVAMSSLDDDAATRLRRQKLGFIFQAFHVLPHLTVQQNVALPLLLNDEPQARALELLAAVGLDGRGNDFPRQLSGGEMQRVAIARALVHRPTLILADEPTGNLDPDTAHEVLALLRQEIKANGASAIMVTHSAAAAASADRILLMTADGLHPLPAQS
>NZ_CP013235.1|WP_061533595.1|2597624_2600207_+|ABC-transporter-permease
MQAADPTTKKPANPMRTLARWLLLGEWRAHPVRALVAIIAIALGVALGYGVELINGAAFNEFSAAARSLSGQSDLQVRGAQGLFDEKIYPQLATHDGVALASPALELDVTVPGQHAPLKVLGIDVMRAAHIAPDLIGVPDSQRPFDTLADDAIFLSPAAQEWLQAQPGGQLALQNGTGIVTLRVAGGLVRARPGQRIAVMDIGAAQWRFQRLGKLSRIDIKLQQGVNRSAFKQALQAQLADTFQVSESQDQDSRTNNMSRAYRVNLSVLALVALFTGAFLVFSTQALSVIRQRPQFALLRVLGWQRAQLLRQVLLEGSLLGVLGALLGLMLGYALAATALHFFGGDLGGGYFRGVQPSVQFDLPAALFFFALGTGIALLGSLAPALEAARARPAAALKSGSEEAALTRLATPFPALACLLLGGLLTQLPPVFDLPVFGYIAVALLLIGGIGLMPRVAALAFTALQRVMLGRHLSAVPTLALARLANVPGQASIALGGVLSSFSLIVAMAIMVSSFRVSVDDWVQQLLSADIYVRTAGGGETGAMGPTEQQALAAVPGVAHATFLRSASLALDPARPPVTLIARMIDAGDPGRTLPLSGAPLTPAALASASAAGALPIWVSEAMVDLYGYRLGQRVMLPIGGQRHAFVVAGIWRDYARQTGAIQLRLSDYQRLSGDNQVSDAALTLQPGADANTVIGAMRRLPFGAALEFSQPGDIRATTLKIFDRSFAVTYLLEIVAIVIGLFGVAATFSAQTLARTREFGMLRHVGITRRQILAMLALEGGLLTALGMAVGFVLGWSVSLILVFIVNPQSFHWTMDLHMPWRGLGAVALLLLLSAGATALLAGLRAVSIDAVRAVREDW
>NZ_CP013235.1|WP_061533596.1|2600208_2601291_+|carotenoid-1,2-hydratase
MHLRLRDCLLGLLFLSFASLLQAAPPQFAQVTPQRPLTLPHDSGSHPDFRTEWWYATGWLATPDGKPLGFQITFFRSATDHDRANPSAFAPDQLIIAHAALSDPAVGKLLHDQKSARAGFGLAYAKEGNTDVALDNWRLLRQADGSYHARIDANDFTLDIKLTPTQAPLLQGDRGYSLKGPLPTQASYYYSEPQLQVSGKLSRAGREQTVSGSAWLDHEWSTSVLGADAVGWDWLGANLDDGSALMAFQIRNRNGERIWSHATLRDASGNVTQFTPDQVAFQPQRNWRSPRTDASYPVQAMLRTGAIDWQLIPLQDDQELDSRGSTGSVYWEGAVTVKRDGKRTGRGYLELTGYLKPLKF
>NZ_CP013235.1|WP_082797887.1|2601357_2602422_+|DUF2157-domain-containing-protein
MGHYVATLLPKWSLTMNARSILDHWHDTGALDQQGYRQALRALHLAPDAARWRQLAARLLLIGGVLCVLAGTLMLFASNWLAWPRLARVGAAETGWLALLVWAFMTRPDNQARRWALFAVATMTGIWLAVIGQAYQTGADAWQLFALWAALALPWALLANFAPLWGLWIVIVSLALQLWLPHAPWRSALSAWDPFDNANLPLIGFWLAALAVAEWRQNAAAPWTARILPRLLGLGLALLLTIQACMILAGEHLHAFGEYSPTTNGLVLLLWLACVGAALYFYSLRRDLLMLALPLFSVWVAVLAWIANFTHDSGWLYPTALLAIGGLGGIAWWLHARHRQWQTASRSALQELAP
>NZ_CP013235.1|WP_082797888.1|2602376_2603507_+|DUF4401-domain-containing-protein
MANRIAVGITGAGAMSQSINELAGWDSVIAGLRDSGALRQDAALPEHDDSLPWSVMILQTIAAWITAALLVAAVVVPAFIASNESAWLVCGVVLMALAIAVMHFNQKSFFLPQMAVPVAIAGAVLAGFGLKPDSWQLTTFILALILFALASHRLLRFIAAGVMLAVLWYWMTPWLGRYSYNLEQPTAWVRQLAPLRDLLFSFALWWLWTQPLNRLGLGPAVWQPLRHALLWFWLGVQVWQAIFWHTLFGAPADADQWLAPNTLWLAHRLLDLLPLLLAVAATLRHSPGLSARIWPLAVLLPLCVLSPALATAALVLWIGLAEGRSYLTALGIAAALAGFGAFYYNLSWPLLHKGLLLMASGALLLLVWLFMSRRTP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP013235_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013235_4

2830807-2830922

Orphan

Consensus_repeat	Method
AGGCACTTAGCAACTTTGCCGTAGCCATGGGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013235_4

>merge|NZ_CP013235|4|2830807-2830922|CRISPRCasFinder
AGGCACTTAGCAACTTTGCCGTAGCCATGGGCGCTTCCTCTAACGCAGCCGCCAGCAACAGCGTAGCGGTCGGTGTTAACAGTAAGGCACTTAGCAACTTTGCCGTAGCCATGGGC

>NZ_CP013235|4|3|2830807-2830922|CRISPRCasFinder
AGGCACTTAGCAACTTTGCCGTAGCCATGGGC	GCTTCCTCTAACGCAGCCGCCAGCAACAGCGTAGCGGTCGGTGTTAACAGTA
AGGCACTTAGCAACTTTGCCGTAGCCATGGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013235.1\|WP_061533762.1\|2845313_2845874_-\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|239516
NZ_CP013235.1\|WP_061537284.1\|2827205_2828882_-\|PAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|185001
NZ_CP013235.1\|WP_061533758.1\|2839619_2840486_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP013235.1\|WP_082797905.1\|2843459_2845151_+\|electron-transfer-flavoprotein-ubiquinone-oxidoreductase	unknown	unknown	gnl\|CDD\|223717
NZ_CP013235.1\|WP_061537286.1\|2836935_2839203_-\|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase	unknown	unknown	gnl\|CDD\|223394
NZ_CP013235.1\|WP_061533752.1\|2829626_2829977_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013235.1\|WP_061533757.1\|2839221_2839572_-\|RidA-family-protein	unknown	unknown	gnl\|CDD\|100007
NZ_CP013235.1\|WP_061535342.1\|2826480_2827110_+\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
NZ_CP013235.1\|WP_061533760.1\|2841401_2842100_-\|CoA-transferase-subunit-A	unknown	unknown	gnl\|CDD\|224702
NZ_CP013235.1\|WP_061533749.1\|2824899_2825796_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176165
NZ_CP013235.1\|WP_061533751.1\|2829165_2829621_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013235.1\|WP_061533763.1\|2845998_2846313_-\|DUF2818-family-protein	unknown	unknown	gnl\|CDD\|378532
NZ_CP013235.1\|WP_061533750.1\|2825882_2826347_-\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439
NZ_CP013235.1\|WP_061533748.1\|2823576_2824788_-\|serine-hydrolase	unknown	unknown	gnl\|CDD\|365903
NZ_CP013235.1\|WP_061533759.1\|2840727_2841381_-\|CoA-transferase-subunit-B	unknown	unknown	gnl\|CDD\|188219
NZ_CP013235.1\|WP_061535343.1\|2842282_2842852_+\|PAS-domain-S-box-protein	unknown	unknown	gnl\|CDD\|181815
NZ_CP013235.1\|WP_061533746.1\|2822109_2822304_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013235.1\|WP_061535344.1\|2842859_2843279_-\|acyl-CoA-thioesterase	unknown	unknown	gnl\|CDD\|223894
NZ_CP013235.1\|WP_061535341.1\|2820827_2821313_+\|DUF4440-domain-containing-protein	unknown	unknown	gnl\|CDD\|227212
NZ_CP013235.1\|WP_061537283.1\|2821662_2821869_+\|cold-shock-protein	unknown	unknown	gnl\|CDD\|224197

Protein	Function_ID	Function_description	E-value
NZ_CP013235.1\|WP_061537284.1\|2827205_2828882_-\|PAS-domain-containing-protein	gnl\|CDD\|185001	PRK15041, PRK15041, methyl-accepting chemotaxis protein.	2.59842e-105
NZ_CP013235.1\|WP_061533758.1\|2839619_2840486_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.72532e-26
NZ_CP013235.1\|WP_061537286.1\|2836935_2839203_-\|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase	gnl\|CDD\|223394	COG0317, SpoT, Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription].	0
NZ_CP013235.1\|WP_061533757.1\|2839221_2839572_-\|RidA-family-protein	gnl\|CDD\|100007	cd06150, YjgF_YER057c_UK114_like_2, This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function. The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.	1.95e-58
NZ_CP013235.1\|WP_061533762.1\|2845313_2845874_-\|NUDIX-hydrolase	gnl\|CDD\|239516	cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate. Like other members of the Nudix hydrolase superfamily, it requires a divalent cation, such as Mg2+, for its activity. It also contains a highly conserved 23-residue Nudix motif (GX5EX7REUXEEXGU, where U = I, L or V) which functions as a metal binding site/catalytic site. In addition to the Nudix motif, there are additional conserved amino acid residues, distal from the signature sequence, that correlate with substrate specificity. In humans, there are four distinct ADPRase activities, three putative cytosolic enzymes (ADPRase-I, -II, and -Mn) and a single mitochondrial enzyme (ADPRase-m). Human ADPRase-II is also referred to as NUDT5. It lacks the N-terminal target sequence unique to mitochondrial ADPRase. The different cytosolic types are distinguished by their specificities for substrate and specific requirement for metal ions. NUDT5 forms a homodimer.	1.3776e-51
NZ_CP013235.1\|WP_061533760.1\|2841401_2842100_-\|CoA-transferase-subunit-A	gnl\|CDD\|224702	COG1788, AtoD, Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit [Lipid metabolism].	1.93714e-115
NZ_CP013235.1\|WP_061533759.1\|2840727_2841381_-\|CoA-transferase-subunit-B	gnl\|CDD\|188219	TIGR02428, 3-oxoadipate_CoA-transferase_subunit_B, 3-oxoacid CoA-transferase, B subunit. Various members of this family are characterized as the B subunits of succinyl-CoA:3-ketoacid-CoA transferase (EC 2.8.3.5), beta-ketoadipate:succinyl-CoA transferase (EC 2.8.3.6), acetyl-CoA:acetoacetate CoA transferase (EC 2.8.3.8), and butyrate-acetoacetate CoA-transferase (EC 2.8.3.9). This represents a very distinct clade with strong sequence conservation within the larger family defined by pfam01144. The A subunit represents a different clade in pfam01144.	5.47665e-119
NZ_CP013235.1\|WP_061535342.1\|2826480_2827110_+\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	7.84769e-40
NZ_CP013235.1\|WP_061533763.1\|2845998_2846313_-\|DUF2818-family-protein	gnl\|CDD\|378532	pfam10993, DUF2818, Protein of unknown function (DUF2818). This bacterial family of proteins has no known function.	3.11555e-38
NZ_CP013235.1\|WP_061533750.1\|2825882_2826347_-\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	2.51957e-41
NZ_CP013235.1\|WP_061533748.1\|2823576_2824788_-\|serine-hydrolase	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	1.36132e-58
NZ_CP013235.1\|WP_061533749.1\|2824899_2825796_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176165	cd08476, PBP2_CrgA_like_7, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 7. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	9.12233e-114
NZ_CP013235.1\|WP_061535343.1\|2842282_2842852_+\|PAS-domain-S-box-protein	gnl\|CDD\|181815	PRK09390, fixJ, response regulator FixJ; Provisional.	4.21017e-16
NZ_CP013235.1\|WP_082797905.1\|2843459_2845151_+\|electron-transfer-flavoprotein-ubiquinone-oxidoreductase	gnl\|CDD\|223717	COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion].	2.96924e-101
NZ_CP013235.1\|WP_061535344.1\|2842859_2843279_-\|acyl-CoA-thioesterase	gnl\|CDD\|223894	COG0824, FcbC, Predicted thioesterase [General function prediction only].	6.65301e-37
NZ_CP013235.1\|WP_061535341.1\|2820827_2821313_+\|DUF4440-domain-containing-protein	gnl\|CDD\|227212	COG4875, COG4875, Uncharacterized protein conserved in bacteria with a cystatin-like fold [Function unknown].	6.4303e-56
NZ_CP013235.1\|WP_061537283.1\|2821662_2821869_+\|cold-shock-protein	gnl\|CDD\|224197	COG1278, CspC, Cold shock proteins [Transcription].	8.82598e-29

>NZ_CP013235.1|WP_061533752.1|2829626_2829977_-|hypothetical-protein
MQHPNHVAPGDGLDFFQTIHVGLVTNSEANGYVRERTGLNPNAWLDGAYWTSYGDDDRYLERESIPLCAAACSNSLRFGAEPSKPFPMRAVEVTSEGVRDEFAKPNILLFDQTARE
>NZ_CP013235.1|WP_061533751.1|2829165_2829621_-|hypothetical-protein
MKLKLSAVAVLFSALLPFAAHADLPGAHPGYLHALTDLRDARWNLEHRPGDAAVSGQEDVAITEIDRAIGEVKKGARDDAKDLGDHPHEDANLDRPGRLHHAVELLEKAHNDLAQEEDNPEARGLKHRALDHVDRAIDAAKHALHDAEHHR
>NZ_CP013235.1|WP_061537284.1|2827205_2828882_-|PAS-domain-containing-protein
MRLNTPVSNIEYELSDTQTIVSTTDTQGNITYVNPYFVLVSGYTEQELLGAPQNILRHPDMPVEAFADLWRTIKNGQSWTGIIKNRCKNGDFYWVQANVTPVMENGRPVGYMSVRTKPSRRQVEEATALYQTIRNGNRDKIAINQGVAGRSGLLGRLIALKDMSLSKRISWNLGFLICVLAALIVSDLFFVEQVPGKAHHWVSVLAAIAIAGVSYFWYSLYSGVIVPLRQAVRASQVMAGGDLTLDISTRRKDDLGQLLRSLRQLRVNLSSIVGDVRSSFEQIGVATREIATGNADLSGRTESQASALEETASSMEQLASTVEQNSSNATQANDMADGASQVAGKGGDIVMQVVATMGEIHGSSKEIVSIISIIEGIAFQTNILALNAAVEAARAGEQGRGFAVVASEVRSLAQRSATAAKEIKQLIDASVKKVEAGTVLAEHAGVTMREIIESVQRVSSIMSDIATASREQSSGIAQVNDAVTQMDEVTQQNAALVEQAAAAAGSLQDQTMKLEQALTVFKLDRKPQATAAGIPSRGGGKGHLAHRASVRQAIALRA
>NZ_CP013235.1|WP_061535342.1|2826480_2827110_+|LysE-family-translocator
MVSLHLLTVFIGALVVVYALPGPDMALILQTSTNRGIRHGLATAGGLAIARAGHVMLSACGVAALLRGAPWLYSAVRIMGAIYLAYIAIQIFRSPGFGLTDSTASNQPRASLRASFRKGMLSSLLNPKALLFCSVLLPQFVHPESGPVWSQVLELGVVLVAIGLAFDLTLALGAARIAGWLRNSPRAQTVQRWTFSAALMAFALRLSTE
>NZ_CP013235.1|WP_061533750.1|2825882_2826347_-|Lrp/AsnC-family-transcriptional-regulator
MKELDKIDRAILATVRQDGRIPIAKLAERIGLSETPCARRLKQLESAGYIEGYRAVLSRKALDIGVIAFAQIRFNIHDRALSDRFEREIQGLERIVSCHNISGSADYLVQIAVRDLDEYGTFMRDVIRTLPGVTSVESMLSLREIKRDSGFPLL
>NZ_CP013235.1|WP_061533749.1|2824899_2825796_+|LysR-family-transcriptional-regulator
MESLSGFAVFVQVAETRSFVAAGRLLGVSASAIGKRVARLEERLGVRLFHRSTRSITLTSEGVMFLERSRRVLAEIEAAEQELTLSTGAPRGRLRVSLPLVSSLILPVLADFMQQYPEVELDLDFTDRSVDVIEEGFDAVVRTGDLSDSRLSARTLGTSRVLLAGSPDYFSRYGVPQKPADLAAHRCLHYRYPNSGKLEIWPLRQQPSEPQITLPVSMICNNIETRVCFAQRGLGIACLPSFAAAEGIASGKLRTVLDEYVDRTVVFRVLWPSSRHWTPKLRVFIDFLVERVFARADG
>NZ_CP013235.1|WP_061533748.1|2823576_2824788_-|serine-hydrolase
MLIAMPTPEADVPSTLPQTPIDAALDAALIEQRLVGAVVLVAQHGQLVYARAAGFADREAQRRMRTDALFRLASVSKPFVSTAAMILVGQGRIGLDDALARWLPEFHPCLADGRPARITLRQLLSHTAGLGYRFFEVDEQGPLALAGVSDGMDCTPITLTENLRRIATVPLLYEPGTGWGYSLATDVVGALVERICGVPLEAALRQLLMRPLDLHDTAFVAVDAGRLATPYVSQLPQPRRMRELDVVPAFEGTVGIRFVPARALDAKAFQSGGAGMTGSAGDFLQLLELLRQGGGDLLPSALVDEMARNQTGELALPNSPGFGFGLGFSVLRDSVAAASPESAGTWRWGGAYGHSWWVDRAQGLSVVAFTNTLYEGMSGRFVTDLRDAVYAHLPARQNTEQAA
>NZ_CP013235.1|WP_061533746.1|2822109_2822304_+|hypothetical-protein
MQRNDQNSLSQKRYKETIRNLYERINSGDETAWAEVNDKNNLDLVLLAEIAKNHDLIKKLRSWW
>NZ_CP013235.1|WP_061537283.1|2821662_2821869_+|cold-shock-protein
MDTGTVKWFNDSKGIGFIAPDNGGEELFAHFSAIQMGGEKFLREGQKVKFDVMERPKGKQASNIQEAS
>NZ_CP013235.1|WP_061535341.1|2820827_2821313_+|DUF4440-domain-containing-protein
MQTPIFLALATTVLALAGCASSSPTTPDGARREVCKRTSEKEISALFDRWNNSLQTGDPHKVLENYAERSILLPTLSNQPRLTAAEKEAYFRHFLEYKPMGRIDSRFIDIGCNTAVDAGLYTFTFASTGIQAKARYTFTYKWDGMQWLITSQHSSAMPGKD
>NZ_CP013235.1|WP_061537286.1|2836935_2839203_-|bifunctional-(p)ppGpp-synthetase/guanosine-3',5'-bis(diphosphate)-3'-pyrophosphohydrolase
MVSLTATQRASQTQLCTAGLSAEDSARVLDALAFVEPLYADNVITTGQSTLDFSQGVTSILALLDTDVETRIAALLFELPLIDASYSEAIEQRFGKEISDLVGGIRQLMRLHGFTFGLPQEVMRGKNAAQQAASQVETLRKMLLAMATDMRVVLVRLASRVTALRYFAENKMENPRTSQYARETLDLYAPLANRLGIWQLKWELEDLSFRFIDPVAYKRIAKMLEERRIERESFVDAAITRLRSELAAAGIKAEVSGRPKHIFSIWNKMKGKEIDFSELYDVRAFRVIVDDVKTCYTVLGIVHNIWVPIPKEFDDYISRPKQNGYQSLHTVVLADDERALEVQIRTNEMHHFAEYGVAAHWRYKEAGGSNFSAQKYDEKIAWLRQLLAWKSEVVDAVVEHEDSRREWLEKLKQATLNDHIYVLTPQARVIELPSGATPIDFAYYLHTDVGHRCRGARVDGTMVPLNTPLKNGQTVEIITAKNSPGGAGPSRDWLTPGYAASARTRSKVRAWFNAIEQQETLVTGRSLLDKTLQREGKTAVNLEELARKLEFAKLEDLLLALGKDEFSLRHVEQALHDDPGLKSIEHDSEMEEAAITRKSRASSVVRGGKSGVLVVGTDGLMTQLAKCCKPAPPDPIVGFITRGKGVSIHRENCKNFAEMRIKAPERVILTTWGAQEAETVYPVDIFVLASDRQGLLRDISDVFLREKINVIGVSTQSAKAHARMAFTAEIASTAQLQKALAVIREVKGVLEAKRQ
>NZ_CP013235.1|WP_061533757.1|2839221_2839572_-|RidA-family-protein
MTIQRLHVGKRLSEVAIHNGTIYLAGQLAEDTTQNIEGQTRETLGHIDRLLAEAGSDKHHILSCQIYLADIKDFDGMNVVWDEWVAAGNSPPRATVEAKLARSEILIEIVVVAAQK
>NZ_CP013235.1|WP_061533758.1|2839619_2840486_-|alpha/beta-hydrolase
MTIPTHKTVQCISPAGLHKMAYQEWGDPHNPNVLLCIHGVTRVSGDFDQLARALCDTYRVVCPDVVGRGRSDWLRDPQYYVVPQYLSDMVTLLARLNAETVDLVGTSMGGLIGMALASLPENPVRKLVLNDVGPKLDLEAMARIGEYIGADMRFNTFDEAAAYIRAISASFGEHTDAEWHKLAADVLRQDRDGKWIRHYDLKLSVPFTMTTGEAFKASEALLWAAYNAITCPTLLLRGAQSDLLSPEVAQIMTQCGPKAKLVELPGAGHAPTLLHIDQIEVVTDFLVG
>NZ_CP013235.1|WP_061533759.1|2840727_2841381_-|CoA-transferase-subunit-B
MAWTRDEMAARAAKELQDGFYVNLGIGLPTLVANHVPQEIEVWLQSENGLLGIGPFPTDDAVDPDLINAGKQTVTSLPGSSYFSSADSFAMIRGGKINIAILGAMQVSKNGDLANWMIPGKMVKGMGGAMDLVAGVGRVVVLMEHVAKAKDGSTSHKILDACSLPLTGVGVVNRIITDLGVLDVTPQGLKVIELAPGVSQQDIIEQTGTPLDVSALH
>NZ_CP013235.1|WP_061533760.1|2841401_2842100_-|CoA-transferase-subunit-A
MNKVYPDAASALAGIVKDGQTIAVGGFGLCGIPEALILALRDSGVQNLTAISNNAGVDGFGLGQLLSTRQIKKMIASYVGENKEFERQYLAGELELEFTPQGTLAEKLRAGGAGIPAFFTKTGVGTLVAEGKEIREFDGAKYVMERSLVADVSLVKAYKADRSGNLVFNKTARNFNPNVAMAGKITVVEVEHLVEVGEIDPDQVHTPGIFVHRIVVNATPEKRIEQRTVRTA
>NZ_CP013235.1|WP_061535343.1|2842282_2842852_+|PAS-domain-S-box-protein
MPNSLINYQTIFAHAPIGMCVSERRVMQVCNLALTRMFGYQPTELNGQSFQVLYPTQDEFERTGARIVPIMNAKGMYSDERIMRRANGELFWCHVTGHALVPEDTHAAGIWTFEDLSEKRKASAELSPREREIAALLVEGKTSKLIGKQIGLSPRTVEMHRANLMKKFAASTSSELVHRLLGVTQAERI
>NZ_CP013235.1|WP_061535344.1|2842859_2843279_-|acyl-CoA-thioesterase
METRKHVHTTKIAMRWGDMDALGHVNNTIYFRYMEQARIEWLQQIGSDFDSRHGPVLVNAQCSFLRQLKYPCDVEVKSYIGAIGRSSFEASYEIRRADMPDVVFAEGSAKIVWVDFDLEKSMPLPDDLRQLLTNPASPA
>NZ_CP013235.1|WP_082797905.1|2843459_2845151_+|electron-transfer-flavoprotein-ubiquinone-oxidoreductase
MTPTPGQNQQNLVEQYGPREAMEYDVVVVGGGPAGLAAAIRLKQQAAEQGREVSVCVLEKGSEIGAHILSGAVMDPQALTELLPNWKELGAPLTTEVSEDRFLFLTEKKAYKTPNWLLPACFQNHGNYVISLANVVRWLGQQAELLGVEIFPGFPAAEVLYNEDGSVKGVATGNMGVDRHGQPTDAFQLGMELHAKYTLFAEGARGHLGKQLMAKFDLNKGKDPQTYAIGIKELWEIDPKLHQPGLVVHTAGWPLDTQTYGGSFLYHLENNQVAVGYVVGLAYENPYLSPYEEFQRYKTHPEISKFFQGGKRISYGARAITAGGLQSLPKLTFPGGALIGCDAGFLNASRIKGSHAAIKTGMLAANAAFEALGNNRQFDELTAYSQAFEQSWLHEELHKARNFKPWMSKGLYVGTLMVGIDQVVFGGKAPWTLRHTHADHECLKPAANYTPIKYPKPDGKLTFDRLSSVFISNTNHAEDQPIHLTLKDPNVPVNVNLRDYAGPEARYCPAGVYEFVTNEDNTERLQINAQNCVHCKTCDIKDPTQNIVWVTPEGGGGPNYPNM
>NZ_CP013235.1|WP_061533762.1|2845313_2845874_-|NUDIX-hydrolase
MDSHLKEIRITSSLAYDGHFLKVQRDAVQLPDGKETSREFIKHPGAVVILPLFEDGTVLLERQYRYPLERVFIEYPAGKIDAGEDPLSCAKRELQEETGYTASEWLHVCTIHNAIAYSDEHLELYLARGLVAGERKLDDGEFLDVFKAPLSDMLNWVREGKVTDVKTVIGTFWLEKIVTGNWQLPA
>NZ_CP013235.1|WP_061533763.1|2845998_2846313_-|DUF2818-family-protein
MNVSLSSLFVILLALIAANLPFFNERVFALVPIKSGAQGTVKPVWVRLLELLALYALVGLFAHLLEANIGNTFSQGWEFYAVTGCMFLVLAYPGYVLRYLKKHR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP013235_2	2.2\|2234173\|34\|NZ_CP013235\|CRT	2234173-2234206	34	NZ_CP013235.1	2234002-2234035	2	0.941
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013235.1	3849400-3849433	2	0.941
NZ_CP013235_2	2.5\|2234419\|34\|NZ_CP013235\|CRT	2234419-2234452	34	NZ_CP013235.1	3849751-3849784	2	0.941
NZ_CP013235_2	2.5\|2234419\|34\|NZ_CP013235\|CRT	2234419-2234452	34	NZ_CP013235.1	3853039-3853072	2	0.941
NZ_CP013235_2	2.6\|2234494\|34\|NZ_CP013235\|CRT	2234494-2234527	34	NZ_CP013235.1	3850210-3850243	2	0.941
NZ_CP013235_2	2.6\|2234494\|34\|NZ_CP013235\|CRT	2234494-2234527	34	NZ_CP013235.1	3851758-3851791	2	0.941
NZ_CP013235_2	2.6\|2234494\|34\|NZ_CP013235\|CRT	2234494-2234527	34	NZ_CP013235.1	3854233-3854266	2	0.941
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP013235.1	4378723-4378756	2	0.941
NZ_CP013235_2	2.18\|2235394\|34\|NZ_CP013235\|CRT	2235394-2235427	34	NZ_CP013235.1	3849751-3849784	2	0.941
NZ_CP013235_2	2.18\|2235394\|34\|NZ_CP013235\|CRT	2235394-2235427	34	NZ_CP013235.1	2833077-2833110	2	0.941
NZ_CP013235_2	2.21\|2235619\|34\|NZ_CP013235\|CRT	2235619-2235652	34	NZ_CP013235.1	3850039-3850072	2	0.941
NZ_CP013235_2	2.24\|2235844\|34\|NZ_CP013235\|CRT	2235844-2235877	34	NZ_CP013235.1	3849751-3849784	2	0.941
NZ_CP013235_2	2.24\|2235844\|34\|NZ_CP013235\|CRT	2235844-2235877	34	NZ_CP013235.1	3853039-3853072	2	0.941
NZ_CP013235_2	2.24\|2235844\|34\|NZ_CP013235\|CRT	2235844-2235877	34	NZ_CP013235.1	3856264-3856297	2	0.941
NZ_CP013235_2	2.27\|2236060\|34\|NZ_CP013235\|CRT	2236060-2236093	34	NZ_CP013235.1	3849751-3849784	2	0.941
NZ_CP013235_2	2.27\|2236060\|34\|NZ_CP013235\|CRT	2236060-2236093	34	NZ_CP013235.1	3853039-3853072	2	0.941
NZ_CP013235_2	2.27\|2236060\|34\|NZ_CP013235\|CRT	2236060-2236093	34	NZ_CP013235.1	3856264-3856297	2	0.941

1. spacer 2.2|2234173|34|NZ_CP013235|CRT matches to position: 2234002-2234035, mismatch: 2, identity: 0.941

ctgtcgactggtctgagcacaaccaacagtaatg	CRISPR spacer
ctgtcgactggtttgagcaccaccaacagtaatg	Protospacer
************.******* *************

2. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to position: 3849400-3849433, mismatch: 2, identity: 0.941

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ttgtcgaccggtctgagcacaaccaacagcaacg	Protospacer
******** *********** *************

3. spacer 2.5|2234419|34|NZ_CP013235|CRT matches to position: 3849751-3849784, mismatch: 2, identity: 0.941

ctgtccactggcttgagcacaactaacagcaacg	CRISPR spacer
ctgtcgactggcttgagcacaaccaacagcaacg	Protospacer
***** *****************.**********

4. spacer 2.5|2234419|34|NZ_CP013235|CRT matches to position: 3853039-3853072, mismatch: 2, identity: 0.941

ctgtccactggcttgagcacaactaacagcaacg	CRISPR spacer
ctgtcaactggcttgagcacaaccaacagcaacg	Protospacer
***** *****************.**********

5. spacer 2.6|2234494|34|NZ_CP013235|CRT matches to position: 3850210-3850243, mismatch: 2, identity: 0.941

ctgtccacgggtctgagcaccactaacagcaacg	CRISPR spacer
ctgtccacgggtttgagcacgactaacagcaacg	Protospacer
************.******* *************

6. spacer 2.6|2234494|34|NZ_CP013235|CRT matches to position: 3851758-3851791, mismatch: 2, identity: 0.941

ctgtccacgggtctgagcaccactaacagcaacg	CRISPR spacer
ctgtccacgggtttgagcacgactaacagcaacg	Protospacer
************.******* *************

7. spacer 2.6|2234494|34|NZ_CP013235|CRT matches to position: 3854233-3854266, mismatch: 2, identity: 0.941

ctgtccacgggtctgagcaccactaacagcaacg	CRISPR spacer
ctgtccacgggtttgagcacgactaacagcaacg	Protospacer
************.******* *************

8. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to position: 4378723-4378756, mismatch: 2, identity: 0.941

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgtcgaccggcctgagcacgaccaacagcaacg	Protospacer
***** ************** *************

9. spacer 2.18|2235394|34|NZ_CP013235|CRT matches to position: 3849751-3849784, mismatch: 2, identity: 0.941

ctgtcgactggtttgagcaccaccaacagcaacg	CRISPR spacer
ctgtcgactggcttgagcacaaccaacagcaacg	Protospacer
***********.******** *************

10. spacer 2.18|2235394|34|NZ_CP013235|CRT matches to position: 2833077-2833110, mismatch: 2, identity: 0.941

ctgtcgactggtttgagcaccaccaacagcaacg	CRISPR spacer
ctctcgactggtttgagctccaccaacagcaacg	Protospacer
** *************** ***************

11. spacer 2.21|2235619|34|NZ_CP013235|CRT matches to position: 3850039-3850072, mismatch: 2, identity: 0.941

ctgtccactggcctgagcacaaccaacagtaacg	CRISPR spacer
ctgtcaactggcttgagcacaaccaacagtaacg	Protospacer
***** ******.*********************

12. spacer 2.24|2235844|34|NZ_CP013235|CRT matches to position: 3849751-3849784, mismatch: 2, identity: 0.941

ctgtccactggcttgagcacaaccaatagcaacg	CRISPR spacer
ctgtcgactggcttgagcacaaccaacagcaacg	Protospacer
***** ********************.*******

13. spacer 2.24|2235844|34|NZ_CP013235|CRT matches to position: 3853039-3853072, mismatch: 2, identity: 0.941

ctgtccactggcttgagcacaaccaatagcaacg	CRISPR spacer
ctgtcaactggcttgagcacaaccaacagcaacg	Protospacer
***** ********************.*******

14. spacer 2.24|2235844|34|NZ_CP013235|CRT matches to position: 3856264-3856297, mismatch: 2, identity: 0.941

ctgtccactggcttgagcacaaccaatagcaacg	CRISPR spacer
ctgtcgactggcctgagcacaaccaatagcaacg	Protospacer
***** ******.*********************

15. spacer 2.27|2236060|34|NZ_CP013235|CRT matches to position: 3849751-3849784, mismatch: 2, identity: 0.941

ctgtccactggcttgagcacaaccaatagcaacg	CRISPR spacer
ctgtcgactggcttgagcacaaccaacagcaacg	Protospacer
***** ********************.*******

16. spacer 2.27|2236060|34|NZ_CP013235|CRT matches to position: 3853039-3853072, mismatch: 2, identity: 0.941

ctgtccactggcttgagcacaaccaatagcaacg	CRISPR spacer
ctgtcaactggcttgagcacaaccaacagcaacg	Protospacer
***** ********************.*******

17. spacer 2.27|2236060|34|NZ_CP013235|CRT matches to position: 3856264-3856297, mismatch: 2, identity: 0.941

ctgtccactggcttgagcacaaccaatagcaacg	CRISPR spacer
ctgtcgactggcctgagcacaaccaatagcaacg	Protospacer
***** ******.*********************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP013235_2	2.26\|2235985\|34\|NZ_CP013235\|CRT	2235985-2236018	34	NC_015382	Burkholderia gladioli BSR3 plasmid bgla_1p, complete sequence	15345-15378	1	0.971
NZ_CP013235_2	2.14\|2235094\|34\|NZ_CP013235\|CRT	2235094-2235127	34	NC_015382	Burkholderia gladioli BSR3 plasmid bgla_1p, complete sequence	15345-15378	2	0.941
NZ_CP013235_2	2.15\|2235169\|34\|NZ_CP013235\|CRT	2235169-2235202	34	NC_010553	Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence	75919-75952	2	0.941
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NC_010553	Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence	75919-75952	2	0.941
NZ_CP013235_2	2.5\|2234419\|34\|NZ_CP013235\|CRT	2234419-2234452	34	NC_015382	Burkholderia gladioli BSR3 plasmid bgla_1p, complete sequence	15345-15378	3	0.912
NZ_CP013235_2	2.15\|2235169\|34\|NZ_CP013235\|CRT	2235169-2235202	34	NC_015382	Burkholderia gladioli BSR3 plasmid bgla_1p, complete sequence	15345-15378	3	0.912
NZ_CP013235_2	2.25\|2235919\|25\|NZ_CP013235\|CRT	2235919-2235943	25	NC_015382	Burkholderia gladioli BSR3 plasmid bgla_1p, complete sequence	14106-14130	3	0.88
NZ_CP013235_2	2.25\|2235919\|25\|NZ_CP013235\|CRT	2235919-2235943	25	NZ_CP023451	Rhizorhabdus dicambivorans strain Ndbn-20 plasmid p2, complete sequence	150500-150524	3	0.88
NZ_CP013235_2	2.25\|2235919\|25\|NZ_CP013235\|CRT	2235919-2235943	25	NZ_AP017656	Sphingobium cloacae strain JCM 10874 plasmid pSCLO_2, complete sequence	153209-153233	3	0.88
NZ_CP013235_2	2.25\|2235919\|25\|NZ_CP013235\|CRT	2235919-2235943	25	NC_015974	Sphingobium sp. SYK-6 plasmid pSLPG, complete sequence	89414-89438	3	0.88
NZ_CP013235_2	2.25\|2235919\|25\|NZ_CP013235\|CRT	2235919-2235943	25	CP021182	Sphingomonas wittichii DC-6 plasmid pDC01, complete sequence	65964-65988	3	0.88
NZ_CP013235_2	2.25\|2235919\|25\|NZ_CP013235\|CRT	2235919-2235943	25	NZ_CP041018	Sphingobium fuliginis ATCC 27551 plasmid pSF1, complete sequence	178468-178492	3	0.88
NZ_CP013235_2	2.25\|2235919\|25\|NZ_CP013235\|CRT	2235919-2235943	25	NZ_AP018666	Sphingobium amiense strain DSM 16289 plasmid pSAMIE_3, complete sequence	104656-104680	3	0.88
NZ_CP013235_2	2.25\|2235919\|25\|NZ_CP013235\|CRT	2235919-2235943	25	NC_015595	Sphingobium chlorophenolicum L-1 plasmid pSPHCH01, complete sequence	98685-98709	3	0.88
NZ_CP013235_2	2.25\|2235919\|25\|NZ_CP013235\|CRT	2235919-2235943	25	NZ_CP011450	Sphingomonas sanxanigenens DSM 19645 = NX02 plasmid pNXO2, complete sequence	141405-141429	3	0.88
NZ_CP013235_2	2.25\|2235919\|25\|NZ_CP013235\|CRT	2235919-2235943	25	NZ_CP018821	Sphingomonas koreensis strain ABOJV plasmid tig00000001, complete sequence	202672-202696	3	0.88
NZ_CP013235_2	2.25\|2235919\|25\|NZ_CP013235\|CRT	2235919-2235943	25	NZ_CP020539	Sphingobium herbicidovorans strain MH plasmid pMSHV, complete sequence	647017-647041	3	0.88
NZ_CP013235_2	2.25\|2235919\|25\|NZ_CP013235\|CRT	2235919-2235943	25	NZ_CP005085	Sphingobium sp. TKS plasmid pTK1, complete sequence	411146-411170	3	0.88
NZ_CP013235_1	1.1\|473013\|25\|NZ_CP013235\|CRISPRCasFinder	473013-473037	25	MN693134	Marine virus AFVG_25M117, complete genome	17534-17558	4	0.84
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	114402-114435	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	114519-114552	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	114678-114711	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	114795-114828	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	114912-114945	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	115029-115062	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	115146-115179	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	115263-115296	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	115380-115413	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	115497-115530	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	115614-115647	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	115731-115764	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	115806-115839	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	116082-116115	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	116358-116391	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	116475-116508	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	116592-116625	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	116709-116742	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	116826-116859	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	116943-116976	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	117060-117093	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	117219-117252	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	117336-117369	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	117453-117486	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	117612-117645	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	117729-117762	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	117846-117879	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	117963-117996	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	118572-118605	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	118689-118722	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	118848-118881	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	118965-118998	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	119082-119115	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP013412	Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence	119199-119232	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	5524-5557	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	5641-5674	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	5800-5833	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	5917-5950	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	6034-6067	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	6151-6184	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	6268-6301	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	6385-6418	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	6502-6535	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	6619-6652	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	6736-6769	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	6853-6886	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	6928-6961	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	7204-7237	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	7480-7513	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	7597-7630	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	7714-7747	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	7831-7864	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	7948-7981	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	8065-8098	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	8182-8215	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	8341-8374	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	8458-8491	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	8575-8608	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	8734-8767	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	8851-8884	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	8968-9001	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	9085-9118	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	9694-9727	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	9811-9844	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	9970-10003	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	10087-10120	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	10204-10237	4	0.882
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP010016	Burkholderia thailandensis 34 plasmid unnamed, complete sequence	10321-10354	4	0.882
NZ_CP013235_2	2.25\|2235919\|25\|NZ_CP013235\|CRT	2235919-2235943	25	NC_002682	Mesorhizobium japonicum MAFF 303099 plasmid pMLb, complete sequence	34980-35004	4	0.84
NZ_CP013235_2	2.25\|2235919\|25\|NZ_CP013235\|CRT	2235919-2235943	25	NZ_CP014599	Yangia sp. CCB-MM3 plasmid unnamed3, complete sequence	43723-43747	4	0.84
NZ_CP013235_1	1.1\|473013\|25\|NZ_CP013235\|CRISPRCasFinder	473013-473037	25	NZ_CP029793	Psychrobacter sp. YP14 plasmid pYP14d, complete sequence	673-697	5	0.8
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP052134	Burkholderia glumae strain HN plasmid pbghn2, complete sequence	97237-97270	7	0.794
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP052134	Burkholderia glumae strain HN plasmid pbghn2, complete sequence	97345-97378	7	0.794
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP052134	Burkholderia glumae strain HN plasmid pbghn2, complete sequence	97453-97486	7	0.794
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP052134	Burkholderia glumae strain HN plasmid pbghn2, complete sequence	97561-97594	7	0.794
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP052134	Burkholderia glumae strain HN plasmid pbghn2, complete sequence	97885-97918	7	0.794
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP052134	Burkholderia glumae strain HN plasmid pbghn2, complete sequence	97993-98026	7	0.794
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP052134	Burkholderia glumae strain HN plasmid pbghn2, complete sequence	98101-98134	7	0.794
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP052134	Burkholderia glumae strain HN plasmid pbghn2, complete sequence	98209-98242	7	0.794
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP052134	Burkholderia glumae strain HN plasmid pbghn2, complete sequence	98749-98782	7	0.794
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP045089	Burkholderia glumae strain GX plasmid pWSGX1, complete sequence	70634-70667	7	0.794
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP045089	Burkholderia glumae strain GX plasmid pWSGX1, complete sequence	71174-71207	7	0.794
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP045089	Burkholderia glumae strain GX plasmid pWSGX1, complete sequence	71714-71747	7	0.794
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP045089	Burkholderia glumae strain GX plasmid pWSGX1, complete sequence	72146-72179	7	0.794
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP045089	Burkholderia glumae strain GX plasmid pWSGX1, complete sequence	72254-72287	7	0.794
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP045089	Burkholderia glumae strain GX plasmid pWSGX1, complete sequence	72578-72611	7	0.794
NZ_CP013235_2	2.4\|2234344\|34\|NZ_CP013235\|CRT	2234344-2234377	34	NZ_CP045089	Burkholderia glumae strain GX plasmid pWSGX1, complete sequence	72686-72719	7	0.794
NZ_CP013235_2	2.11\|2234869\|34\|NZ_CP013235\|CRT	2234869-2234902	34	CP052339	Klebsiella pneumoniae strain D17KP0018 plasmid unnamed	44017-44050	7	0.794
NZ_CP013235_2	2.11\|2234869\|34\|NZ_CP013235\|CRT	2234869-2234902	34	NZ_CP032224	Klebsiella pneumoniae strain AR_0046 plasmid unnamed2, complete sequence	52429-52462	7	0.794
NZ_CP013235_2	2.11\|2234869\|34\|NZ_CP013235\|CRT	2234869-2234902	34	NZ_CP027046	Klebsiella pneumoniae strain 1_GR_13 plasmid unnamed, complete sequence	10608-10641	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP021942	Klebsiella pneumoniae strain AR_0145 plasmid tig00000218j2847_linear, complete sequence	1646-1679	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP021942	Klebsiella pneumoniae strain AR_0145 plasmid tig00000218j2847_linear, complete sequence	17958-17991	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP017988	Klebsiella pneumoniae strain 825795-1 plasmid unnamed3, complete sequence	1262-1295	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP017988	Klebsiella pneumoniae strain 825795-1 plasmid unnamed3, complete sequence	17577-17610	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP018715	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-5, complete sequence	58622-58655	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP018715	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-5, complete sequence	74939-74972	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP018721	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-5, complete sequence	58247-58280	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP018703	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-5, complete sequence	49946-49979	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP041953	Klebsiella pneumoniae strain KP2 plasmid pKP2_7, complete sequence	46552-46585	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP028992	Klebsiella pneumoniae strain AR_0142 plasmid unnamed2, complete sequence	56767-56800	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	CP052194	Klebsiella pneumoniae strain F16KP0014 plasmid pF16KP0014-2, complete sequence	43802-43835	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP024837	Klebsiella pneumoniae strain CRKP-2297 plasmid pCRKP-2297_3, complete sequence	59506-59539	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP008844	Klebsiella michiganensis strain M1 plasmid pKOXM1C, complete sequence	47300-47333	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP024433	Klebsiella pneumoniae strain DA48896 plasmid p48896_4, complete sequence	1525-1558	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP032191	Klebsiella pneumoniae strain AR_0075 plasmid unnamed6, complete sequence	60296-60329	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP032191	Klebsiella pneumoniae strain AR_0075 plasmid unnamed6, complete sequence	76514-76547	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP021949	Klebsiella pneumoniae strain AR_0152 plasmid tig00000216_u, complete sequence	58302-58335	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP021949	Klebsiella pneumoniae strain AR_0152 plasmid tig00000216_u, complete sequence	74618-74651	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP018688	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-5, complete sequence	1710-1743	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP018688	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-5, complete sequence	18022-18055	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_LR025090	Klebsiella pneumoniae isolate KP980 plasmid 4, complete sequence	45475-45508	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP021760	Klebsiella pneumoniae strain AR_0138 plasmid tig00000003, complete sequence	14895-14928	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP018697	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-5, complete sequence	3643-3676	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP018697	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-5, complete sequence	19960-19993	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP018709	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-5, complete sequence	56354-56387	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP018709	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-5, complete sequence	72673-72706	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	CP038007	Klebsiella phage 020009, complete genome	46974-47007	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	MK416021	Klebsiella phage ST846-OXA48phi9.1, complete genome	31511-31544	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP023421	Klebsiella pneumoniae strain 1050 plasmid unnamed, complete sequence	31960-31993	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP015504	Klebsiella pneumoniae strain SKGH01 plasmid unnamed 4, complete sequence	9339-9372	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP009276	Klebsiella variicola strain DX120E plasmid pKV2, complete sequence	7446-7479	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP028794	Klebsiella pneumoniae strain WCHKP040035 plasmid p1_040035, complete sequence	20016-20049	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP031806	Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed6, complete sequence	22415-22448	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP009878	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH31 plasmid pKPN-852, complete sequence	6646-6679	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP031794	Klebsiella pneumoniae strain INF116-sc-2279924 plasmid unnamed2, complete sequence	7589-7622	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP024841	Klebsiella pneumoniae strain CRKP-1215 plasmid pCRKP-1215_3, complete sequence	9847-9880	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP036444	Klebsiella pneumoniae strain ABFPV plasmid tig00001255_pilon, complete sequence	37662-37695	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP050366	Klebsiella pneumoniae strain 47733 plasmid p47733L, complete sequence	8103-8136	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_LR025094	Klebsiella pneumoniae isolate KP9201 plasmid 4, complete sequence	6241-6274	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	NZ_CP018314	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-6, complete sequence	15544-15577	7	0.794
NZ_CP013235_2	2.16\|2235244\|34\|NZ_CP013235\|CRT	2235244-2235277	34	MT090961	Klebsiella pneumoniae strain KP18-2079 plasmid pKP18-2079_54kb, complete sequence	8082-8115	7	0.794
NZ_CP013235_2	2.23\|2235769\|34\|NZ_CP013235\|CRT	2235769-2235802	34	NZ_CP013855	Pseudonocardia sp. HH130630-07 plasmid pLS2-1, complete sequence	287098-287131	7	0.794
NZ_CP013235_2	2.23\|2235769\|34\|NZ_CP013235\|CRT	2235769-2235802	34	NZ_CP011869	Pseudonocardia sp. HH130629-09 plasmid pLS1-1, complete sequence	82940-82973	7	0.794
NZ_CP013235_2	2.10\|2234794\|34\|NZ_CP013235\|CRT	2234794-2234827	34	NZ_CP027046	Klebsiella pneumoniae strain 1_GR_13 plasmid unnamed, complete sequence	10608-10641	9	0.735
NZ_CP013235_2	2.10\|2234794\|34\|NZ_CP013235\|CRT	2234794-2234827	34	CP052339	Klebsiella pneumoniae strain D17KP0018 plasmid unnamed	44017-44050	9	0.735
NZ_CP013235_2	2.10\|2234794\|34\|NZ_CP013235\|CRT	2234794-2234827	34	NZ_CP032224	Klebsiella pneumoniae strain AR_0046 plasmid unnamed2, complete sequence	52429-52462	9	0.735
NZ_CP013235_2	2.17\|2235319\|34\|NZ_CP013235\|CRT	2235319-2235352	34	NZ_CP027046	Klebsiella pneumoniae strain 1_GR_13 plasmid unnamed, complete sequence	10608-10641	9	0.735
NZ_CP013235_2	2.17\|2235319\|34\|NZ_CP013235\|CRT	2235319-2235352	34	CP052339	Klebsiella pneumoniae strain D17KP0018 plasmid unnamed	44017-44050	9	0.735
NZ_CP013235_2	2.17\|2235319\|34\|NZ_CP013235\|CRT	2235319-2235352	34	NZ_CP032224	Klebsiella pneumoniae strain AR_0046 plasmid unnamed2, complete sequence	52429-52462	9	0.735
NZ_CP013235_2	2.18\|2235394\|34\|NZ_CP013235\|CRT	2235394-2235427	34	NZ_CP023303	Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence	48335-48368	9	0.735
NZ_CP013235_2	2.18\|2235394\|34\|NZ_CP013235\|CRT	2235394-2235427	34	NZ_CP028242	Lactobacillus plantarum strain SRCM101518 plasmid unnamed1, complete sequence	54758-54791	9	0.735
NZ_CP013235_2	2.18\|2235394\|34\|NZ_CP013235\|CRT	2235394-2235427	34	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	46503-46536	9	0.735
NZ_CP013235_2	2.18\|2235394\|34\|NZ_CP013235\|CRT	2235394-2235427	34	NZ_CP024060	Lactobacillus plantarum strain KACC 92189 plasmid unnamed2	55165-55198	9	0.735
NZ_CP013235_2	2.18\|2235394\|34\|NZ_CP013235\|CRT	2235394-2235427	34	NZ_CP017381	Lactobacillus plantarum strain TMW 1.1623 plasmid pL11623-2, complete sequence	23455-23488	9	0.735
NZ_CP013235_2	2.10\|2234794\|34\|NZ_CP013235\|CRT	2234794-2234827	34	MN445185	Escherichia phage vB_EcoM_EC001, complete genome	137510-137543	10	0.706
NZ_CP013235_2	2.10\|2234794\|34\|NZ_CP013235\|CRT	2234794-2234827	34	KU726251	Enterobacteria phage SEGD1, complete genome	137475-137508	10	0.706
NZ_CP013235_2	2.10\|2234794\|34\|NZ_CP013235\|CRT	2234794-2234827	34	MT679221	Proteus phage 7, complete genome	139581-139614	10	0.706
NZ_CP013235_2	2.10\|2234794\|34\|NZ_CP013235\|CRT	2234794-2234827	34	NC_027402	Salmonella phage SPN3US, complete genome	138716-138749	10	0.706
NZ_CP013235_2	2.10\|2234794\|34\|NZ_CP013235\|CRT	2234794-2234827	34	MT799840	Salmonella phage JN03, complete genome	138103-138136	10	0.706
NZ_CP013235_2	2.12\|2234944\|34\|NZ_CP013235\|CRT	2234944-2234977	34	MK422450	Klebsiella phage ST13-OXA48phi12.4, complete genome	14443-14476	10	0.706
NZ_CP013235_2	2.17\|2235319\|34\|NZ_CP013235\|CRT	2235319-2235352	34	MN445185	Escherichia phage vB_EcoM_EC001, complete genome	137510-137543	10	0.706
NZ_CP013235_2	2.17\|2235319\|34\|NZ_CP013235\|CRT	2235319-2235352	34	KU726251	Enterobacteria phage SEGD1, complete genome	137475-137508	10	0.706
NZ_CP013235_2	2.17\|2235319\|34\|NZ_CP013235\|CRT	2235319-2235352	34	MT679221	Proteus phage 7, complete genome	139581-139614	10	0.706
NZ_CP013235_2	2.17\|2235319\|34\|NZ_CP013235\|CRT	2235319-2235352	34	NC_027402	Salmonella phage SPN3US, complete genome	138716-138749	10	0.706
NZ_CP013235_2	2.17\|2235319\|34\|NZ_CP013235\|CRT	2235319-2235352	34	MT799840	Salmonella phage JN03, complete genome	138103-138136	10	0.706
NZ_CP013235_2	2.23\|2235769\|34\|NZ_CP013235\|CRT	2235769-2235802	34	MN445185	Escherichia phage vB_EcoM_EC001, complete genome	137510-137543	10	0.706
NZ_CP013235_2	2.23\|2235769\|34\|NZ_CP013235\|CRT	2235769-2235802	34	KU726251	Enterobacteria phage SEGD1, complete genome	137475-137508	10	0.706
NZ_CP013235_2	2.23\|2235769\|34\|NZ_CP013235\|CRT	2235769-2235802	34	MT679221	Proteus phage 7, complete genome	139581-139614	10	0.706
NZ_CP013235_2	2.23\|2235769\|34\|NZ_CP013235\|CRT	2235769-2235802	34	NC_027402	Salmonella phage SPN3US, complete genome	138716-138749	10	0.706
NZ_CP013235_2	2.23\|2235769\|34\|NZ_CP013235\|CRT	2235769-2235802	34	MT799840	Salmonella phage JN03, complete genome	138103-138136	10	0.706

1. spacer 2.26|2235985|34|NZ_CP013235|CRT matches to NC_015382 (Burkholderia gladioli BSR3 plasmid bgla_1p, complete sequence) position: , mismatch: 1, identity: 0.971

ttgtccactggcctgagcaccactaacagcaacg	CRISPR spacer
ttgtccactggcctgagcacgactaacagcaacg	Protospacer
******************** *************

2. spacer 2.14|2235094|34|NZ_CP013235|CRT matches to NC_015382 (Burkholderia gladioli BSR3 plasmid bgla_1p, complete sequence) position: , mismatch: 2, identity: 0.941

ttgtccactggtctgagcaccactaacagcaacg	CRISPR spacer
ttgtccactggcctgagcacgactaacagcaacg	Protospacer
***********.******** *************

3. spacer 2.15|2235169|34|NZ_CP013235|CRT matches to NC_010553 (Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence) position: , mismatch: 2, identity: 0.941

ctgtccaccggcctgagcaccactaacagcaacg	CRISPR spacer
ctgtccaccggcctgagcacgacgaacagcaacg	Protospacer
******************** ** **********

4. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NC_010553 (Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence) position: , mismatch: 2, identity: 0.941

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgtccaccggcctgagcacgacgaacagcaacg	Protospacer
******************** ** **********

5. spacer 2.5|2234419|34|NZ_CP013235|CRT matches to NC_015382 (Burkholderia gladioli BSR3 plasmid bgla_1p, complete sequence) position: , mismatch: 3, identity: 0.912

ctgtccactggcttgagcacaactaacagcaacg	CRISPR spacer
ttgtccactggcctgagcacgactaacagcaacg	Protospacer
.***********.*******.*************

6. spacer 2.15|2235169|34|NZ_CP013235|CRT matches to NC_015382 (Burkholderia gladioli BSR3 plasmid bgla_1p, complete sequence) position: , mismatch: 3, identity: 0.912

ctgtccaccggcctgagcaccactaacagcaacg	CRISPR spacer
ttgtccactggcctgagcacgactaacagcaacg	Protospacer
.*******.*********** *************

7. spacer 2.25|2235919|25|NZ_CP013235|CRT matches to NC_015382 (Burkholderia gladioli BSR3 plasmid bgla_1p, complete sequence) position: , mismatch: 3, identity: 0.88

ttgtcgacctcggcttcgacaggca	CRISPR spacer
ctgtctacctcggcctcgacaggca	Protospacer
.**** ********.**********

8. spacer 2.25|2235919|25|NZ_CP013235|CRT matches to NZ_CP023451 (Rhizorhabdus dicambivorans strain Ndbn-20 plasmid p2, complete sequence) position: , mismatch: 3, identity: 0.88

ttgtcgacctcggcttcgacaggca	CRISPR spacer
ttggcgacctcggcttcgaccggga	Protospacer
*** **************** ** *

9. spacer 2.25|2235919|25|NZ_CP013235|CRT matches to NZ_AP017656 (Sphingobium cloacae strain JCM 10874 plasmid pSCLO_2, complete sequence) position: , mismatch: 3, identity: 0.88

ttgtcgacctcggcttcgacaggca	CRISPR spacer
ttggcgacctcggcttcgaccggga	Protospacer
*** **************** ** *

10. spacer 2.25|2235919|25|NZ_CP013235|CRT matches to NC_015974 (Sphingobium sp. SYK-6 plasmid pSLPG, complete sequence) position: , mismatch: 3, identity: 0.88

ttgtcgacctcggcttcgacaggca	CRISPR spacer
ttggcgacctcggcttcgaccggga	Protospacer
*** **************** ** *

11. spacer 2.25|2235919|25|NZ_CP013235|CRT matches to CP021182 (Sphingomonas wittichii DC-6 plasmid pDC01, complete sequence) position: , mismatch: 3, identity: 0.88

ttgtcgacctcggcttcgacaggca	CRISPR spacer
ttggcgacctcggcttcgaccggga	Protospacer
*** **************** ** *

12. spacer 2.25|2235919|25|NZ_CP013235|CRT matches to NZ_CP041018 (Sphingobium fuliginis ATCC 27551 plasmid pSF1, complete sequence) position: , mismatch: 3, identity: 0.88

ttgtcgacctcggcttcgacaggca	CRISPR spacer
ttggcgacctcggcttcgaccggga	Protospacer
*** **************** ** *

13. spacer 2.25|2235919|25|NZ_CP013235|CRT matches to NZ_AP018666 (Sphingobium amiense strain DSM 16289 plasmid pSAMIE_3, complete sequence) position: , mismatch: 3, identity: 0.88

ttgtcgacctcggcttcgacaggca	CRISPR spacer
ttggcgacctcggcttcgaccggga	Protospacer
*** **************** ** *

14. spacer 2.25|2235919|25|NZ_CP013235|CRT matches to NC_015595 (Sphingobium chlorophenolicum L-1 plasmid pSPHCH01, complete sequence) position: , mismatch: 3, identity: 0.88

ttgtcgacctcggcttcgacaggca	CRISPR spacer
ttggcgacctcggcttcgaccggga	Protospacer
*** **************** ** *

15. spacer 2.25|2235919|25|NZ_CP013235|CRT matches to NZ_CP011450 (Sphingomonas sanxanigenens DSM 19645 = NX02 plasmid pNXO2, complete sequence) position: , mismatch: 3, identity: 0.88

ttgtcgacctcggcttcgacaggca	CRISPR spacer
ttggcgacctcggcttcgaccggga	Protospacer
*** **************** ** *

16. spacer 2.25|2235919|25|NZ_CP013235|CRT matches to NZ_CP018821 (Sphingomonas koreensis strain ABOJV plasmid tig00000001, complete sequence) position: , mismatch: 3, identity: 0.88

ttgtcgacctcggcttcgacaggca	CRISPR spacer
ttggcgacctcggcttcgaccggga	Protospacer
*** **************** ** *

17. spacer 2.25|2235919|25|NZ_CP013235|CRT matches to NZ_CP020539 (Sphingobium herbicidovorans strain MH plasmid pMSHV, complete sequence) position: , mismatch: 3, identity: 0.88

ttgtcgacctcggcttcgacaggca	CRISPR spacer
ttggcgacctcggcttcgaccggga	Protospacer
*** **************** ** *

18. spacer 2.25|2235919|25|NZ_CP013235|CRT matches to NZ_CP005085 (Sphingobium sp. TKS plasmid pTK1, complete sequence) position: , mismatch: 3, identity: 0.88

ttgtcgacctcggcttcgacaggca	CRISPR spacer
ttggcgacctcggcttcgaccggga	Protospacer
*** **************** ** *

19. spacer 1.1|473013|25|NZ_CP013235|CRISPRCasFinder matches to MN693134 (Marine virus AFVG_25M117, complete genome) position: , mismatch: 4, identity: 0.84

attttggtgcaaaaatggatgcaat	CRISPR spacer
catttggtgcaaaaatgggtgctat	Protospacer
  ****************.*** **

20. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

21. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

22. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

23. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

24. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

25. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

26. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

27. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

28. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

29. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

30. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

31. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

32. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

33. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

34. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

35. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

36. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

37. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

38. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

39. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

40. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

41. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

42. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

43. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

44. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

45. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

46. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

47. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

48. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

49. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

50. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

51. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

52. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

53. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP013412 (Burkholderia thailandensis strain 2002721643 plasmid p2002721643, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

54. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

55. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

56. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

57. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

58. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

59. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

60. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

61. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

62. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

63. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

64. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

65. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

66. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

67. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

68. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

69. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

70. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

71. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

72. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

73. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

74. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

75. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

76. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

77. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

78. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

79. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

80. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

81. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

82. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

83. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

84. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

85. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

86. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

87. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP010016 (Burkholderia thailandensis 34 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.882

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
ctttccacgggtctgagcacgaccaacagcaacg	Protospacer
.* ** ************** *************

88. spacer 2.25|2235919|25|NZ_CP013235|CRT matches to NC_002682 (Mesorhizobium japonicum MAFF 303099 plasmid pMLb, complete sequence) position: , mismatch: 4, identity: 0.84

ttgtcgacctcggcttcgacaggca	CRISPR spacer
gcgtcgatctcggcttcgacatgca	Protospacer
 .*****.************* ***

89. spacer 2.25|2235919|25|NZ_CP013235|CRT matches to NZ_CP014599 (Yangia sp. CCB-MM3 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.84

ttgtcgacctcggcttcgacaggca	CRISPR spacer
cggtcgacctcggcttcaacagtca	Protospacer
. ***************.**** **

90. spacer 1.1|473013|25|NZ_CP013235|CRISPRCasFinder matches to NZ_CP029793 (Psychrobacter sp. YP14 plasmid pYP14d, complete sequence) position: , mismatch: 5, identity: 0.8

attttggtgcaaaaatggatgcaat	CRISPR spacer
attttggtgcaaaaatggaattatc	Protospacer
*******************  .* .

91. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP052134 (Burkholderia glumae strain HN plasmid pbghn2, complete sequence) position: , mismatch: 7, identity: 0.794

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
acctcgacggggctgagcacgaccaacagcacgg	Protospacer
 . ******** ******** **********  *

92. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP052134 (Burkholderia glumae strain HN plasmid pbghn2, complete sequence) position: , mismatch: 7, identity: 0.794

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
acctcgacggggctgagcacgaccaacagcacgg	Protospacer
 . ******** ******** **********  *

93. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP052134 (Burkholderia glumae strain HN plasmid pbghn2, complete sequence) position: , mismatch: 7, identity: 0.794

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
acctcgacggggctgagcacgaccaacagcacgg	Protospacer
 . ******** ******** **********  *

94. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP052134 (Burkholderia glumae strain HN plasmid pbghn2, complete sequence) position: , mismatch: 7, identity: 0.794

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
acctcgacggggctgagcacgaccaacagcacgg	Protospacer
 . ******** ******** **********  *

95. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP052134 (Burkholderia glumae strain HN plasmid pbghn2, complete sequence) position: , mismatch: 7, identity: 0.794

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
acctcgacggggctgagcacgaccaacagcacgg	Protospacer
 . ******** ******** **********  *

96. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP052134 (Burkholderia glumae strain HN plasmid pbghn2, complete sequence) position: , mismatch: 7, identity: 0.794

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
acctcgacggggctgagcacgaccaacagcacgg	Protospacer
 . ******** ******** **********  *

97. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP052134 (Burkholderia glumae strain HN plasmid pbghn2, complete sequence) position: , mismatch: 7, identity: 0.794

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
acctcgacggggctgagcacgaccaacagcacgg	Protospacer
 . ******** ******** **********  *

98. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP052134 (Burkholderia glumae strain HN plasmid pbghn2, complete sequence) position: , mismatch: 7, identity: 0.794

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
acctcgacggggctgagcacgaccaacagcacgg	Protospacer
 . ******** ******** **********  *

99. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP052134 (Burkholderia glumae strain HN plasmid pbghn2, complete sequence) position: , mismatch: 7, identity: 0.794

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
acctcgacgggcctgagcacgaccaacagcacgg	Protospacer
 . ********.******** **********  *

100. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP045089 (Burkholderia glumae strain GX plasmid pWSGX1, complete sequence) position: , mismatch: 7, identity: 0.794

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
acctcgacgggcctgagcacgaccaacagcacgg	Protospacer
 . ********.******** **********  *

101. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP045089 (Burkholderia glumae strain GX plasmid pWSGX1, complete sequence) position: , mismatch: 7, identity: 0.794

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
acctcgacggggctgagcacgaccaacagcacgg	Protospacer
 . ******** ******** **********  *

102. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP045089 (Burkholderia glumae strain GX plasmid pWSGX1, complete sequence) position: , mismatch: 7, identity: 0.794

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
acctcgacggggctgagcacgaccaacagcacgg	Protospacer
 . ******** ******** **********  *

103. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP045089 (Burkholderia glumae strain GX plasmid pWSGX1, complete sequence) position: , mismatch: 7, identity: 0.794

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
acctcgacggggctgagcacgaccaacagcacgg	Protospacer
 . ******** ******** **********  *

104. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP045089 (Burkholderia glumae strain GX plasmid pWSGX1, complete sequence) position: , mismatch: 7, identity: 0.794

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
acctcgacggggctgagcacgaccaacagcacgg	Protospacer
 . ******** ******** **********  *

105. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP045089 (Burkholderia glumae strain GX plasmid pWSGX1, complete sequence) position: , mismatch: 7, identity: 0.794

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
acctcgacggggctgagcacgaccaacagcacgg	Protospacer
 . ******** ******** **********  *

106. spacer 2.4|2234344|34|NZ_CP013235|CRT matches to NZ_CP045089 (Burkholderia glumae strain GX plasmid pWSGX1, complete sequence) position: , mismatch: 7, identity: 0.794

ttgtcgacgggtctgagcaccaccaacagcaacg	CRISPR spacer
acctcgacggggctgagcacgaccaacagcacgg	Protospacer
 . ******** ******** **********  *

107. spacer 2.11|2234869|34|NZ_CP013235|CRT matches to CP052339 (Klebsiella pneumoniae strain D17KP0018 plasmid unnamed) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagtaacg	CRISPR spacer
ctgcagaacagcctcaacaccaccaacagtaacg	Protospacer
***.  * *.**** *.*****************

108. spacer 2.11|2234869|34|NZ_CP013235|CRT matches to NZ_CP032224 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagtaacg	CRISPR spacer
ctgcagaacagcctcaacaccaccaacagtaacg	Protospacer
***.  * *.**** *.*****************

109. spacer 2.11|2234869|34|NZ_CP013235|CRT matches to NZ_CP027046 (Klebsiella pneumoniae strain 1_GR_13 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagtaacg	CRISPR spacer
ctgcagaacagcctcaacaccaccaacagtaacg	Protospacer
***.  * *.**** *.*****************

110. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP021942 (Klebsiella pneumoniae strain AR_0145 plasmid tig00000218j2847_linear, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

111. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP021942 (Klebsiella pneumoniae strain AR_0145 plasmid tig00000218j2847_linear, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

112. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP017988 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

113. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP017988 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

114. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP018715 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-5, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

115. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP018715 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-5, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

116. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP018721 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-5, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

117. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP018703 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-5, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

118. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP041953 (Klebsiella pneumoniae strain KP2 plasmid pKP2_7, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

119. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP028992 (Klebsiella pneumoniae strain AR_0142 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

120. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to CP052194 (Klebsiella pneumoniae strain F16KP0014 plasmid pF16KP0014-2, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

121. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP024837 (Klebsiella pneumoniae strain CRKP-2297 plasmid pCRKP-2297_3, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

122. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP008844 (Klebsiella michiganensis strain M1 plasmid pKOXM1C, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

123. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP024433 (Klebsiella pneumoniae strain DA48896 plasmid p48896_4, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

124. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP032191 (Klebsiella pneumoniae strain AR_0075 plasmid unnamed6, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

125. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP032191 (Klebsiella pneumoniae strain AR_0075 plasmid unnamed6, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

126. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP021949 (Klebsiella pneumoniae strain AR_0152 plasmid tig00000216_u, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

127. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP021949 (Klebsiella pneumoniae strain AR_0152 plasmid tig00000216_u, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

128. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP018688 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-5, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

129. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP018688 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-5, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

130. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_LR025090 (Klebsiella pneumoniae isolate KP980 plasmid 4, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

131. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP021760 (Klebsiella pneumoniae strain AR_0138 plasmid tig00000003, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

132. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP018697 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-5, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

133. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP018697 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-5, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

134. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP018709 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-5, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

135. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP018709 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-5, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

136. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to CP038007 (Klebsiella phage 020009, complete genome) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

137. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to MK416021 (Klebsiella phage ST846-OXA48phi9.1, complete genome) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

138. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP023421 (Klebsiella pneumoniae strain 1050 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

139. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP015504 (Klebsiella pneumoniae strain SKGH01 plasmid unnamed 4, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

140. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP009276 (Klebsiella variicola strain DX120E plasmid pKV2, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

141. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP028794 (Klebsiella pneumoniae strain WCHKP040035 plasmid p1_040035, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

142. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP031806 (Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed6, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

143. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP009878 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH31 plasmid pKPN-852, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

144. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP031794 (Klebsiella pneumoniae strain INF116-sc-2279924 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

145. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP024841 (Klebsiella pneumoniae strain CRKP-1215 plasmid pCRKP-1215_3, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

146. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP036444 (Klebsiella pneumoniae strain ABFPV plasmid tig00001255_pilon, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

147. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP050366 (Klebsiella pneumoniae strain 47733 plasmid p47733L, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

148. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_LR025094 (Klebsiella pneumoniae isolate KP9201 plasmid 4, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

149. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to NZ_CP018314 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-6, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

150. spacer 2.16|2235244|34|NZ_CP013235|CRT matches to MT090961 (Klebsiella pneumoniae strain KP18-2079 plasmid pKP18-2079_54kb, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccaccggcctgagcaccaccaacagcaacg	CRISPR spacer
ctgcagaacagcctgaacaccaccaacaacaacg	Protospacer
***.  * *.******.***********.*****

151. spacer 2.23|2235769|34|NZ_CP013235|CRT matches to NZ_CP013855 (Pseudonocardia sp. HH130630-07 plasmid pLS2-1, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccactggcctgagcaccaccaacagtaact--	CRISPR spacer
ctgcccactggcctgaacaccacc--ccgcacctct	Protospacer
***.************.*******  * *.* **

152. spacer 2.23|2235769|34|NZ_CP013235|CRT matches to NZ_CP011869 (Pseudonocardia sp. HH130629-09 plasmid pLS1-1, complete sequence) position: , mismatch: 7, identity: 0.794

ctgtccactggcctgagcaccaccaacagtaact--	CRISPR spacer
ctgcccactggcctgaacaccacc--ccgcacctct	Protospacer
***.************.*******  * *.* **

153. spacer 2.10|2234794|34|NZ_CP013235|CRT matches to NZ_CP027046 (Klebsiella pneumoniae strain 1_GR_13 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.735

ttgtccactggcctgagcaccaccaacagtaacg	CRISPR spacer
ctgcagaacagcctcaacaccaccaacagtaacg	Protospacer
.**.  * ..**** *.*****************

154. spacer 2.10|2234794|34|NZ_CP013235|CRT matches to CP052339 (Klebsiella pneumoniae strain D17KP0018 plasmid unnamed) position: , mismatch: 9, identity: 0.735

ttgtccactggcctgagcaccaccaacagtaacg	CRISPR spacer
ctgcagaacagcctcaacaccaccaacagtaacg	Protospacer
.**.  * ..**** *.*****************

155. spacer 2.10|2234794|34|NZ_CP013235|CRT matches to NZ_CP032224 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.735

ttgtccactggcctgagcaccaccaacagtaacg	CRISPR spacer
ctgcagaacagcctcaacaccaccaacagtaacg	Protospacer
.**.  * ..**** *.*****************

156. spacer 2.17|2235319|34|NZ_CP013235|CRT matches to NZ_CP027046 (Klebsiella pneumoniae strain 1_GR_13 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.735

ttgtccactggcctgagcaccaccaacagtaacg	CRISPR spacer
ctgcagaacagcctcaacaccaccaacagtaacg	Protospacer
.**.  * ..**** *.*****************

157. spacer 2.17|2235319|34|NZ_CP013235|CRT matches to CP052339 (Klebsiella pneumoniae strain D17KP0018 plasmid unnamed) position: , mismatch: 9, identity: 0.735

ttgtccactggcctgagcaccaccaacagtaacg	CRISPR spacer
ctgcagaacagcctcaacaccaccaacagtaacg	Protospacer
.**.  * ..**** *.*****************

158. spacer 2.17|2235319|34|NZ_CP013235|CRT matches to NZ_CP032224 (Klebsiella pneumoniae strain AR_0046 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.735

ttgtccactggcctgagcaccaccaacagtaacg	CRISPR spacer
ctgcagaacagcctcaacaccaccaacagtaacg	Protospacer
.**.  * ..**** *.*****************

159. spacer 2.18|2235394|34|NZ_CP013235|CRT matches to NZ_CP023303 (Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence) position: , mismatch: 9, identity: 0.735

ctgtcgactggtttgagcaccaccaacagcaacg	CRISPR spacer
cattcgactggtttcagcaccatcaacttctctg	Protospacer
*  *********** *******.****  *  .*

160. spacer 2.18|2235394|34|NZ_CP013235|CRT matches to NZ_CP028242 (Lactobacillus plantarum strain SRCM101518 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

ctgtcgactggtttgagcaccaccaacagcaacg	CRISPR spacer
cattcgactggtttcagcaccatcaacttctctg	Protospacer
*  *********** *******.****  *  .*

161. spacer 2.18|2235394|34|NZ_CP013235|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 9, identity: 0.735

ctgtcgactggtttgagcaccaccaacagcaacg	CRISPR spacer
cattcgactggtttcagcaccatcaacttctctg	Protospacer
*  *********** *******.****  *  .*

162. spacer 2.18|2235394|34|NZ_CP013235|CRT matches to NZ_CP024060 (Lactobacillus plantarum strain KACC 92189 plasmid unnamed2) position: , mismatch: 9, identity: 0.735

ctgtcgactggtttgagcaccaccaacagcaacg	CRISPR spacer
cattcgactggtttcagcaccatcaacttctctg	Protospacer
*  *********** *******.****  *  .*

163. spacer 2.18|2235394|34|NZ_CP013235|CRT matches to NZ_CP017381 (Lactobacillus plantarum strain TMW 1.1623 plasmid pL11623-2, complete sequence) position: , mismatch: 9, identity: 0.735

ctgtcgactggtttgagcaccaccaacagcaacg	CRISPR spacer
cattcgactggtttcagcaccatcaacttctctg	Protospacer
*  *********** *******.****  *  .*

164. spacer 2.10|2234794|34|NZ_CP013235|CRT matches to MN445185 (Escherichia phage vB_EcoM_EC001, complete genome) position: , mismatch: 10, identity: 0.706

ttgtccactggcctgagcaccaccaacagtaacg	CRISPR spacer
gttaaaactgacctgagcaccaccaacggtgaac	Protospacer
 *    ****.****************.**.*

165. spacer 2.10|2234794|34|NZ_CP013235|CRT matches to KU726251 (Enterobacteria phage SEGD1, complete genome) position: , mismatch: 10, identity: 0.706

ttgtccactggcctgagcaccaccaacagtaacg	CRISPR spacer
gttaaaactgacctgagcaccaccaacggtgaac	Protospacer
 *    ****.****************.**.*

166. spacer 2.10|2234794|34|NZ_CP013235|CRT matches to MT679221 (Proteus phage 7, complete genome) position: , mismatch: 10, identity: 0.706

ttgtccactggcctgagcaccaccaacagtaacg	CRISPR spacer
gttaaaactgacctgagcaccaccaacggtgaac	Protospacer
 *    ****.****************.**.*

167. spacer 2.10|2234794|34|NZ_CP013235|CRT matches to NC_027402 (Salmonella phage SPN3US, complete genome) position: , mismatch: 10, identity: 0.706

ttgtccactggcctgagcaccaccaacagtaacg	CRISPR spacer
gttaaaactgacctgagcaccaccaacggtgaac	Protospacer
 *    ****.****************.**.*

168. spacer 2.10|2234794|34|NZ_CP013235|CRT matches to MT799840 (Salmonella phage JN03, complete genome) position: , mismatch: 10, identity: 0.706

ttgtccactggcctgagcaccaccaacagtaacg	CRISPR spacer
gttaaaactgacctgagcaccaccaacggtgaac	Protospacer
 *    ****.****************.**.*

169. spacer 2.12|2234944|34|NZ_CP013235|CRT matches to MK422450 (Klebsiella phage ST13-OXA48phi12.4, complete genome) position: , mismatch: 10, identity: 0.706

ctgtccacaggcctgagcacaaccaacagtaacg	CRISPR spacer
acgggcacaggcatgagcccaaccaacagcctgg	Protospacer
 .*  ******* ***** **********.   *

170. spacer 2.17|2235319|34|NZ_CP013235|CRT matches to MN445185 (Escherichia phage vB_EcoM_EC001, complete genome) position: , mismatch: 10, identity: 0.706

ttgtccactggcctgagcaccaccaacagtaacg	CRISPR spacer
gttaaaactgacctgagcaccaccaacggtgaac	Protospacer
 *    ****.****************.**.*

171. spacer 2.17|2235319|34|NZ_CP013235|CRT matches to KU726251 (Enterobacteria phage SEGD1, complete genome) position: , mismatch: 10, identity: 0.706

ttgtccactggcctgagcaccaccaacagtaacg	CRISPR spacer
gttaaaactgacctgagcaccaccaacggtgaac	Protospacer
 *    ****.****************.**.*

172. spacer 2.17|2235319|34|NZ_CP013235|CRT matches to MT679221 (Proteus phage 7, complete genome) position: , mismatch: 10, identity: 0.706

ttgtccactggcctgagcaccaccaacagtaacg	CRISPR spacer
gttaaaactgacctgagcaccaccaacggtgaac	Protospacer
 *    ****.****************.**.*

173. spacer 2.17|2235319|34|NZ_CP013235|CRT matches to NC_027402 (Salmonella phage SPN3US, complete genome) position: , mismatch: 10, identity: 0.706

ttgtccactggcctgagcaccaccaacagtaacg	CRISPR spacer
gttaaaactgacctgagcaccaccaacggtgaac	Protospacer
 *    ****.****************.**.*

174. spacer 2.17|2235319|34|NZ_CP013235|CRT matches to MT799840 (Salmonella phage JN03, complete genome) position: , mismatch: 10, identity: 0.706

ttgtccactggcctgagcaccaccaacagtaacg	CRISPR spacer
gttaaaactgacctgagcaccaccaacggtgaac	Protospacer
 *    ****.****************.**.*

175. spacer 2.23|2235769|34|NZ_CP013235|CRT matches to MN445185 (Escherichia phage vB_EcoM_EC001, complete genome) position: , mismatch: 10, identity: 0.706

ctgtccactggcctgagcaccaccaacagtaact	CRISPR spacer
gttaaaactgacctgagcaccaccaacggtgaac	Protospacer
 *    ****.****************.**.* .

176. spacer 2.23|2235769|34|NZ_CP013235|CRT matches to KU726251 (Enterobacteria phage SEGD1, complete genome) position: , mismatch: 10, identity: 0.706

ctgtccactggcctgagcaccaccaacagtaact	CRISPR spacer
gttaaaactgacctgagcaccaccaacggtgaac	Protospacer
 *    ****.****************.**.* .

177. spacer 2.23|2235769|34|NZ_CP013235|CRT matches to MT679221 (Proteus phage 7, complete genome) position: , mismatch: 10, identity: 0.706

ctgtccactggcctgagcaccaccaacagtaact	CRISPR spacer
gttaaaactgacctgagcaccaccaacggtgaac	Protospacer
 *    ****.****************.**.* .

178. spacer 2.23|2235769|34|NZ_CP013235|CRT matches to NC_027402 (Salmonella phage SPN3US, complete genome) position: , mismatch: 10, identity: 0.706

ctgtccactggcctgagcaccaccaacagtaact	CRISPR spacer
gttaaaactgacctgagcaccaccaacggtgaac	Protospacer
 *    ****.****************.**.* .

179. spacer 2.23|2235769|34|NZ_CP013235|CRT matches to MT799840 (Salmonella phage JN03, complete genome) position: , mismatch: 10, identity: 0.706

ctgtccactggcctgagcaccaccaacagtaact	CRISPR spacer
gttaaaactgacctgagcaccaccaacggtgaac	Protospacer
 *    ****.****************.**.* .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1115447 : 1177276

uncultured_Mediterranean_phage(10.53%)

integrase,protease,tRNA

attL 1113276:1113292|attR 1119269:1119285

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1113276:1113292	attL	NA	NA	NA	NA
WP_061532583.1\|1115447_1116464_-\|integrase	site-specific integrase	A0A248XD46	Klebsiella_phage	1.1e-60	40.4
WP_061537533.1\|1118007_1118760_-	glucose 1-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	4.3e-22	33.6
WP_061532585.1\|1118917_1119496_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
1119269:1119285	attR	NA	NA	NA	NA
WP_061532586.1\|1120349_1121330_+	proline dehydrogenase	A0A2H4PQT6	Staphylococcus_phage	2.8e-21	27.6
WP_061532587.1\|1121599_1122775_-	porin	NA	NA	NA	NA
WP_061532588.1\|1123319_1124024_-	response regulator transcription factor	NA	NA	NA	NA
WP_061532589.1\|1124539_1125784_-	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_156477062.1\|1125954_1126869_+	hypothetical protein	NA	NA	NA	NA
WP_156477064.1\|1126865_1127012_+	hypothetical protein	NA	NA	NA	NA
WP_061532591.1\|1127085_1127850_-	histidine kinase	NA	NA	NA	NA
WP_061532592.1\|1128320_1130228_+	ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	3.4e-47	27.8
WP_061535170.1\|1130334_1130898_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_061532593.1\|1130908_1131760_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_061532594.1\|1133724_1133991_+	30S ribosomal protein S20	NA	NA	NA	NA
WP_061532595.1\|1134243_1134705_-	DUF192 domain-containing protein	A0A1B1IUW8	uncultured_Mediterranean_phage	7.2e-12	38.2
WP_061535171.1\|1134846_1135068_-	hypothetical protein	NA	NA	NA	NA
WP_061532596.1\|1135272_1135842_-	pseudouridine synthase	NA	NA	NA	NA
WP_061532597.1\|1135986_1137240_+	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	4.0e-12	64.8
WP_009665919.1\|1137366_1137570_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.4e-23	81.8
WP_014007243.1\|1137897_1138206_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	6.3e-12	45.7
WP_061532598.1\|1138202_1140503_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.2e-168	41.7
WP_061532599.1\|1140653_1141766_-\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_061532600.1\|1141765_1142215_-	dUTP diphosphatase	Q2NP83	Xanthomonas_phage	4.2e-49	64.4
WP_061537029.1\|1142368_1143583_-	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	3.7e-39	31.8
WP_061532602.1\|1143732_1144242_-	lipoprotein signal peptidase	NA	NA	NA	NA
WP_061532603.1\|1144372_1147270_-\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	9.3e-73	25.0
WP_061532604.1\|1147343_1148345_-	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
WP_061532605.1\|1148637_1149093_-	DUF937 domain-containing protein	NA	NA	NA	NA
WP_061532606.1\|1149325_1150051_-	16S rRNA (uracil(1498)-N(3))-methyltransferase	NA	NA	NA	NA
WP_128083184.1\|1150109_1150505_-	DUF350 domain-containing protein	NA	NA	NA	NA
WP_061532608.1\|1150622_1151768_-	glutathionylspermidine synthase family protein	B2ZXR7	Ralstonia_phage	3.2e-109	51.8
WP_061537030.1\|1151770_1152196_-	hypothetical protein	NA	NA	NA	NA
WP_061532610.1\|1152310_1153591_-	polyamine aminopropyltransferase	Q5GQE8	Synechococcus_phage	7.9e-08	39.0
WP_061532611.1\|1153871_1155866_+	transketolase	NA	NA	NA	NA
WP_082797800.1\|1155862_1156438_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_061537031.1\|1156505_1157519_+	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_061532612.1\|1157647_1158022_+	hypothetical protein	NA	NA	NA	NA
WP_082799722.1\|1158034_1160878_-	bifunctional [glutamate--ammonia ligase]-adenylyl-L-tyrosine phosphorylase/[glutamate--ammonia-ligase] adenylyltransferase	NA	NA	NA	NA
WP_082797801.1\|1161090_1165311_+	TIGR02099 family protein	NA	NA	NA	NA
WP_061532614.1\|1165409_1166243_+	carbon-nitrogen hydrolase family protein	M1I6H3	Paramecium_bursaria_Chlorella_virus	1.5e-15	27.5
WP_061532615.1\|1166411_1167872_+\|protease	metalloprotease TldD	NA	NA	NA	NA
WP_061535173.1\|1167906_1168374_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_061532616.1\|1168365_1168623_-	metal-binding protein	NA	NA	NA	NA
WP_061532617.1\|1168628_1169708_-	bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	7.1e-18	51.6
WP_061532618.1\|1169824_1170484_-	DNA-3-methyladenine glycosylase 2 family protein	S4VP92	Pandoravirus	5.3e-08	38.0
WP_061537033.1\|1170484_1171138_-	DNA oxidative demethylase AlkB	A0A0H3Y8P5	Apricot_vein_clearing_associated_virus	6.4e-06	34.2
WP_061532619.1\|1171148_1171886_-	2OG-Fe(II) oxygenase	NA	NA	NA	NA
WP_061535174.1\|1171882_1172407_-	methylated-DNA--[protein]-cysteine S-methyltransferase	NA	NA	NA	NA
WP_156477066.1\|1173241_1173769_+	hypothetical protein	NA	NA	NA	NA
WP_061532622.1\|1175442_1176510_+	3-deoxy-7-phosphoheptulonate synthase AroG	A0A218MA87	Escherichia_phage	3.9e-77	45.9
WP_061532623.1\|1176640_1177276_-\|protease	TIGR02281 family clan AA aspartic protease	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP013235

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection