CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP014701	Bacillus amyloliquefaciens strain S499 plasmid, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP014700	Bacillus amyloliquefaciens strain S499, complete genome	1 crisprs	cas3,DinG,csa3,WYL,DEDDh,casR	0	0	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP014700_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP014700_1

2335155-2335284

Orphan

Consensus_repeat	Method
AACAGGCTTTCAGCGGGGAATCCGGCGGACAGCAGCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP014700_1

>merge|NZ_CP014700|1|2335155-2335284|CRISPRCasFinder
AACAGGCTTTCAGCGGGGAATCCGGCGGACAGCAGCACACGGACAAAGCACGGCATTCACAAACAGGCTCCATGCAGCCTGCCGAGCTGATCAAACAGGCTTTCGGCGGGGAATCCGGCGGACAGCAGCA

>NZ_CP014700|1|1|2335155-2335284|CRISPRCasFinder
AACAGGCTTTCAGCGGGGAATCCGGCGGACAGCAGCA	CACGGACAAAGCACGGCATTCACAAACAGGCTCCATGCAGCCTGCCGAGCTGATCA
AACAGGCTTTCGGCGGGGAATCCGGCGGACAGCAGCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP014700.1\|WP_015388502.1\|2338175_2339006_-\|methionine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224381
NZ_CP014700.1\|WP_015388503.1\|2339679_2340627_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224196
NZ_CP014700.1\|WP_014304688.1\|2332614_2333280_+\|spore-coat-protein	unknown	unknown	gnl\|CDD\|227864
NZ_CP014700.1\|WP_095315274.1\|2323868_2325221_-\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|181078
NZ_CP014700.1\|WP_003155385.1\|2343510_2343882_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014700.1\|WP_015388505.1\|2341537_2342254_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP014700.1\|WP_003155376.1\|2339387_2339588_+\|cold-shock-protein	unknown	unknown	gnl\|CDD\|224197
NZ_CP014700.1\|WP_007408448.1\|2328364_2328760_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375131
NZ_CP014700.1\|WP_003155367.1\|2337079_2338159_+\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|143635
NZ_CP014700.1\|WP_003155348.1\|2327811_2328234_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341390
NZ_CP014700.1\|WP_003155347.1\|2326994_2327684_-\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|319859
NZ_CP014700.1\|WP_003155360.1\|2333239_2334184_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014700.1\|WP_014304691.1\|2328869_2329778_+\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|161659
NZ_CP014700.1\|WP_015388499.1\|2330366_2332421_-\|LPXTG-cell-wall-anchor-domain-containing-protein	unknown	unknown	gnl\|CDD\|236505
NZ_CP014700.1\|WP_015388504.1\|2340619_2341537_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP014700.1\|WP_015388501.1\|2335536_2336928_-\|L-cystine-transporter	unknown	unknown	gnl\|CDD\|224736
NZ_CP014700.1\|WP_003155362.1\|2334304_2334844_-\|YhcN/YlaJ-family-sporulation-lipoprotein	unknown	unknown	gnl\|CDD\|131944
NZ_CP014700.1\|WP_003155346.1\|2325463_2327002_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|143598
NZ_CP014700.1\|WP_015388507.1\|2342623_2343391_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014700.1\|WP_031306629.1\|2342243_2342621_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224639

Protein	Function_ID	Function_description	E-value
NZ_CP014700.1\|WP_015388502.1\|2338175_2339006_-\|methionine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224381	COG1464, NlpA, ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism].	1.93339e-73
NZ_CP014700.1\|WP_015388503.1\|2339679_2340627_-\|ABC-transporter-permease	gnl\|CDD\|224196	COG1277, NosY, ABC-type transport system involved in multi-copper enzyme maturation, permease component [General function prediction only].	5.60403e-17
NZ_CP014700.1\|WP_014304688.1\|2332614_2333280_+\|spore-coat-protein	gnl\|CDD\|227864	COG5577, COG5577, Spore coat protein [Cell envelope biogenesis, outer membrane].	1.26561e-34
NZ_CP014700.1\|WP_095315274.1\|2323868_2325221_-\|aspartate-aminotransferase-family-protein	gnl\|CDD\|181078	PRK07678, PRK07678, aminotransferase; Validated.	0
NZ_CP014700.1\|WP_015388505.1\|2341537_2342254_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	9.01067e-55
NZ_CP014700.1\|WP_003155376.1\|2339387_2339588_+\|cold-shock-protein	gnl\|CDD\|224197	COG1278, CspC, Cold shock proteins [Transcription].	8.70654e-31
NZ_CP014700.1\|WP_007408448.1\|2328364_2328760_-\|hypothetical-protein	gnl\|CDD\|375131	pfam17326, DUF5365, Family of unknown function (DUF5365). This is a family of unknown function found in Bacillaceae.	1.5508e-44
NZ_CP014700.1\|WP_003155367.1\|2337079_2338159_+\|GGDEF-domain-containing-protein	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	1.49548e-55
NZ_CP014700.1\|WP_003155348.1\|2327811_2328234_-\|CBS-domain-containing-protein	gnl\|CDD\|341390	cd04622, CBS_pair_HRP1_like, CBS pair domain found in Hypoxic Response Protein 1 (HRP1) -like proteinds. Mycobacterium tuberculosis adapts to cellular stresses by upregulation of the dormancy survival regulon. Hypoxic response protein 1 (HRP1) is encoded by one of the most strongly upregulated genes in the dormancy survival regulon. HRP1 is a 'CBS-domain-only protein; however unlike other CBS containing proteins it does not appear to bind AMP. The biological function of the protein remains unclear, but is thought to contribute to the modulation of the host immune response. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	3.79201e-58
NZ_CP014700.1\|WP_003155347.1\|2326994_2327684_-\|HAD-family-hydrolase	gnl\|CDD\|319859	cd16423, HAD_BPGM-like, uncharacterized subfamily of beta-phosphoglucomutase-like family, similar to uncharacterized Bacillus subtilis YhcW. This subfamily includes the uncharacterized Bacillus subtilis YhcW. It belongs to the beta-phosphoglucomutase-like family whose other members include Lactococcus lactis beta-PGM, a mutase which catalyzes the interconversion of beta-D-glucose 1-phosphate (G1P) and D-glucose 6-phosphate (G6P), Saccharomyces cerevisiae phosphatases GPP1 and GPP2 that dephosphorylate DL-glycerol-3-phosphate and DOG1 and DOG2 that dephosphorylate 2-deoxyglucose-6-phosphate, and Escherichia coli 6-phosphogluconate phosphatase YieH. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	1.63554e-70
NZ_CP014700.1\|WP_031306629.1\|2342243_2342621_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224639	COG1725, COG1725, Predicted transcriptional regulators [Transcription].	6.94812e-44
NZ_CP014700.1\|WP_014304691.1\|2328869_2329778_+\|RluA-family-pseudouridine-synthase	gnl\|CDD\|161659	TIGR00005, Ribosomal_large_subunit_pseudouridine_synthase_D, pseudouridine synthase, RluA family. In E. coli, RluD (SfhB) modifies uridine to pseudouridine at 23S RNA U1911, 1915, and 1917, RluC modifies 955, 2504 and 2580, and RluA modifies U746 and tRNA U32. An additional homolog from E. coli outside this family, TruC (SP\|Q46918), modifies uracil-65 in transfer RNAs to pseudouridine. [Protein synthesis, tRNA and rRNA base modification].	6.78639e-102
NZ_CP014700.1\|WP_015388499.1\|2330366_2332421_-\|LPXTG-cell-wall-anchor-domain-containing-protein	gnl\|CDD\|236505	PRK09419, PRK09419, multifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase/5'-nucleotidase.	1.30274e-116
NZ_CP014700.1\|WP_015388504.1\|2340619_2341537_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	8.75437e-98
NZ_CP014700.1\|WP_015388501.1\|2335536_2336928_-\|L-cystine-transporter	gnl\|CDD\|224736	COG1823, COG1823, Predicted Na+/dicarboxylate symporter [General function prediction only].	0
NZ_CP014700.1\|WP_003155362.1\|2334304_2334844_-\|YhcN/YlaJ-family-sporulation-lipoprotein	gnl\|CDD\|131944	TIGR02898, Uncharacterized_lipoprotein_YlaJ, sporulation lipoprotein, YhcN/YlaJ family. YhcN and YlaJ are predicted lipoproteins that have been detected as spore proteins but not vegetative proteins in Bacillus subtilis. Both appear to be expressed under control of the RNA polymerase sigma-G factor. The YlaJ-like members of this family have a low-complexity, strongly acidic 40-residue C-terminal domain that is not included in the seed alignment for this model. A portion of the low-complexity region between the lipoprotein signal sequence and the main conserved region of the protein family was also excised from the seed alignment. [Cellular processes, Sporulation and germination].	9.31894e-47
NZ_CP014700.1\|WP_003155346.1\|2325463_2327002_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|143598	cd07574, nitrilase_Rim1_like, Uncharacterized subgroup of the nitrilase superfamily; some members of this subgroup have an N-terminal RimI domain (class 12 nitrilases). Some members of this subgroup are implicated in post-translational modification, as they contain an N-terminal GCN5-related N-acetyltransferase (GNAT) protein RimI family domain. The nitrilase superfamily is comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13), this subgroup corresponds to class 12. Members of this superfamily generally form homomeric complexes, the basic building block of which is a homodimer.	1.89411e-167

>NZ_CP014700.1|WP_003155362.1|2334304_2334844_-|YhcN/YlaJ-family-sporulation-lipoprotein
MIKKQAVISALLLPMLITAGCSMGNQGEGKRNDNRTQNVNYRNTPNDGATNMNTVNRHNQNTDHNDNRNLRVADKAADKVTDLKEVKNATVIVAGNSAYVAVVLTNGQKGAIANHLKNKITDKVKSADKHVRTVYVSANPDFVERMQGYGKRIQNGHPVSGLFDEFGQMVQRVFPNPNK
>NZ_CP014700.1|WP_003155360.1|2333239_2334184_-|hypothetical-protein
MRDGMGKRAAFTLILCGVLVILAVSSAVSVSMMYVLSGQNSRSVPTKEQVTEHMNKEIYKHTAIYYTADEKPLLDLTKLTLDHAKRINQIIVGYKGAAPLELIFFSDEAEMEQYSGLKNVVGFYSEQEQMMGLLPEEKKQLLKKDELAVFMYKQLIIHEYTHYAFHQKTRQLGTDTSVFPLWFHEGLSEWVAHYDVVIDPIAFSVVPFDQLTTDRKWQKSRMEYETDVYLQSFYMIKDLTETFGEGIILTIINKTAETQDFEKGFEAATKESLKQFEHDFTKAYEKKKTALESQVSNAVFFINGGFAAAVPFVL
>NZ_CP014700.1|WP_014304688.1|2332614_2333280_+|spore-coat-protein
MEQQQNQQQPPVNQGIPGSPQVNHGGHELFDMHEVLAGTVGVLDQFMMLRQFIQDQQLADILDRQYQFILGLYNLTAECFKTGQKPSQETSTYMMEEQNQAVYGIKPTQPKKPNQSLNDVKDLGISGHMLGLIKAQASLLTMSSLEMTNPVTRRVLSAQIQQYVEMAYEIFLYQNKHGYYQVPQLNAQDMQTMLNSFAPAQGQPQMPPIKGQMGQQQQNLH
>NZ_CP014700.1|WP_015388499.1|2330366_2332421_-|LPXTG-cell-wall-anchor-domain-containing-protein
MKKKRGLRLSCCLLTVCFMMFSVKDAEAIGQAGSLNEAGTDKAYKERQTEDSGRIPLRIISMNDLHGKIDQQYELDLNGDGKPDGTFGRMDYAAAYIKKAKAEKEHAFVVHAGDMIGGSSPVSALFQDEPTVELMEDIGFDVGTVGNHEFDEGTNELKRIINGGDHPDGKGTSGYDGQNFPLVCANCKLKSGESFLPPYEIKYVSGIPVAFIGVVTRSAAGMVIPDGIKNITFTDEVKAVNDAAADLKKKGIKAIAVLAHMSAEQNGSAITGESAKLASGTDSEIDVIFAAHNHKVVNGEINGKLIVQAFEYGKAIGIADLELDKESKDIVKKSAEIQYIDQSKIKPDPDAAGKLSKYEEKVKPIISEAVGEAAHDITGGYSNDGDTALGNLIADGMKAKMKSDFALMNGGGIRDGIKKGPITWGDLYNVQPFGNVLTKLEIKGKDLREIINAQISPVYGPDYSISGFSYTWNPETGQAADMKMADGTDIQPEKGYTVTVNQFMATASGAKYGPIGKLGKNPVTGPEDLEATVDYVKSFSAPISYQTDGRIRTASDAETPDDTGNQPGSGETPGSTGPDKGEKPQTEKPAKKPDAAEQPDQTKKPERPVVKEAASDTVQSIPEFRTASAADSEQSTEQTESGTQKGRPLPDTSAGSHQTALAGLVITGAGVYWLFRKKRGTRTR
>NZ_CP014700.1|WP_014304691.1|2328869_2329778_+|RluA-family-pseudouridine-synthase
MKQNDRGLELLITEKHAGKWLFSVLKSEFQASKPVITEWMNQKSIQVNRTSPKNNIILKTGDRLFIDLQEKTGSSVIPEYGEPDILFEDSHMLIANKPAGMPTHPNEEGQTGTLSNLIAYHFQINGEQAKVRHVHRLDRDTSGAVVFAKHRLAHAILDRQLETKTLKRTYIAAAEGKVTPKKGTVDSPIGRDKSHSVRRRVSPGGQAAVTHYKVKGYHPGAQLTLAELELETGRTHQIRVHMASIGHPLAGDDLYGGSRALFHRQALHAKKVSVVHPISGEEIVAEAPMPADLAHFTETYFS
>NZ_CP014700.1|WP_007408448.1|2328364_2328760_-|hypothetical-protein
MARKVIDVRIVNAATDGQESAIQELSSELFQNVFPLYFSELEIQRFKKRGVLSLQNQRYQGTLKEAFQIMACLQTVHIMLSKPHPVYDVKERALFDKNCALLNECGMNFPFTYDDFETGAGSEACGHRRLI
>NZ_CP014700.1|WP_003155348.1|2327811_2328234_-|CBS-domain-containing-protein
MSSIKQSMTTHVATVSPNQTIQEAAALMHQHNVGAIPVVDGGELKGMLTDRDIALRTTAQGRDGQTPVSHVMSSQVVSGNPEMSLEEASHLMAQHQIRRLPIVDQNHLVGIVALGDLAVDQRSNESAGAALSNISSQNTQ
>NZ_CP014700.1|WP_003155347.1|2326994_2327684_-|HAD-family-hydrolase
MIKALIFDFDGLILDTETHEYEVLQEMFEEHGSTLPLSVWGKVIGTAAGFKPFAYLEEQLGRKLDHDELTAIRRGRFEQRMKTETARPGVEAYLAAAKELGLKVGLASSSDFKWVSGHLKELGLFDEFEVIQTADDVEEVKPNPELYLKAAEHLGVEPSECLAFEDSVNGSIAAKRAGMKCVIVPNKVTSALLFEEYDHRLESMAEMELELLLQRLNDQNEPAGGSSIV
>NZ_CP014700.1|WP_003155346.1|2325463_2327002_-|GNAT-family-N-acetyltransferase
MSEKLDLTRFEKKMVIRNMEEKDINKIIELQKDCFPGMEPWEPEHLISHLAHFPEGQFCAEYEGEIIGSCSSLIINFDEYDDRHTWQDITDDGYITNHNPDGLNLYGIEVMVHPEYRRMKIGHRLYEARKDLARRLNLKSIIIGGRIPNYHKYAEEMTARAYVEQVTRHQIYDPVLSFQLMNGFTLMRINPNYLPDDTASIKYATLMEWNNVDYLPQSKRYYKSAFPVRICVIQYEMKKIYSFEEFANQVEYYVDVASDARSDFAVFPEIFTTQLMSFLEERSPSLAIQRITEYTEDYISLFTDLAVKYNVNIIGGSHFVEEEGKIYNIAYLFRRDGTIEKQYKLHITPNERKWWGISAGDRVRVFDTDCGKIAIQICYDIEFPELARIAADQGAKIIFTPFCTEDRQGYLRVRYCSQARAVENQIYTVISGTVGNLPQTENMDIQYAQSAIFAPSDFEFARDGIVGETNPNIEMVVIGDVDLEILRRQRENGTVRQLKDRRKDIYRITHLK
>NZ_CP014700.1|WP_095315274.1|2323868_2325221_-|aspartate-aminotransferase-family-protein
MSGVEHVQKNQSLKQKDKELIWHAMKGAEPDDSIIVQKGEGAWVTDIDGRRYLDGMSGLWCVNIGYGRKELADAAYSQLKELPYYPLTQSHQPAIELAEKLNEWLGGDYVIFFSNSGSEANETAFKIARQYHIENGDHSRFKFISRYRGYHGNTMGALAATGQAQRKYKYEPLSQGFLHAAPPDLYRNPGDAVTLESAHEIDRIMTWELSETIAGVIMEPIITGGGILMPPDGYMAKVEDICRRHGALLISDEVICGFGRTGEPFGFQHYGVSPDIVTMAKGITSAYLPLSATAVKREIFEAYSDAEPYGRFRHVNTFGGNPAACALALKNLQLMEDENLIARSRELGERLLRELEPLKEHPAVGDVRGKGLLAGIELVKDKITKEPADAALVQHVITACREKGLLVGKNGDTVAGYNNVIQLSPPFCLSDEELSFIISTVKESVLSIDF
>NZ_CP014700.1|WP_015388501.1|2335536_2336928_-|L-cystine-transporter
MENLFVVLHVFIMLLLIAGLFVMQKKHVSFSKRVFTALGLGIVFGFALQLIYGPASHIVIQTADWFNIAGGGYVKLLQMIVMPLVFISILGAFTKLKLTHNIGKISGLIIGILIATTAIAAAVGIVSALSFDLKAVHIDQGSTELSRGQELQQKSEDMTAKTLPQQIVELLPGNPFLDFTGARPTSTIGVVIFAAFLGIAFLGVKRKQPEHAATFSGIVDAVYAIIMRVVTLILRLTPYGVLAIMTKTIATSDIDSIAKLGMFVIASYAALIVMFIIHLLLITFSGLNPITYVKKAFPVMVFAFTSRSSAGALPLNIKTQKSMGVPEGIANFAGSFGLSIGQNGCAGIYPAMLAMMIAPTVGQNPFEPGFIISVIAIVAISSFGVAGVGGGATFAALLVLSALNMPVALAGLLISIEPLIDMGRTALNVSGSMTAGLLTSKMTKETDTAVYNDSSIVIEAEEA
>NZ_CP014700.1|WP_003155367.1|2337079_2338159_+|GGDEF-domain-containing-protein
MLKELFLNLTILITFNYLFTLLFKESLSYKEDRPMFQLLKGTVCGLLGVFLIAFGFSYSDSIIDLRNIPIIIAALYGGWVSTAAAFAIIVAGRILINFNASAIFSIAAVGVIAILSAAVLRGKKPDHKMAFVMLLFSNVIFTLTLLFLMPEQPAGALVYYWLISILGGMLSLYIIKHEADARVLFKQYKFQANYDFLTGIFNKRKFEEVSRVLYDRTSQSPSSQLALIYLDIDHFKQINDQYGHYEGDQVLKELGARLRFLLSSSHTSARIGGEEFAVLMPNCTYTKGLHLAEEIRHTIDANPILLTSGDTIPVTVSLGIAHYPTNTPDPQTLPLIADRMLYKAKTSGRNQVCSTEKKE
>NZ_CP014700.1|WP_015388502.1|2338175_2339006_-|methionine-ABC-transporter-substrate-binding-protein
MNLRLINSLFLFILIMPLTSCDYPDGNRTITIGINESDQSIWEFVAKKAGEEGLQLSLVTFSDYAEADLALAGGDLDANAFQSVTNFKSLPPHVKKKLAPLGTTYAASLGVYSKQHKRLKDIPDGAVIAVPDEAAAFGRALFLMQEAGLITLKKGFSGTGSTDMIKDNPKHLTLKTETKKNAYQAAEHADAAVLSQSEAKKAGFHAEKDALIRSAQMKEAYIHLIAVRAEDKDDVRMQKLLSLYQSDDTAALIEKEYEGSLIPVFLRGGFLTEKKE
>NZ_CP014700.1|WP_003155376.1|2339387_2339588_+|cold-shock-protein
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQSVSFEIVEGNRGPQAANVTKA
>NZ_CP014700.1|WP_015388503.1|2339679_2340627_-|ABC-transporter-permease
MFKLIYNEWIKIFSRVGTWAMIVILGVSMIGFALLSNHFTSNEANPNWKQELQAENKEMKQQMKETGNQTLIDNLKQNVAINQYRMDHNIPEDTGYTVWSYVSDSSMMTVLTGLFTIIIAAGIVANEFNWGTIKLLAIRPLSRFQILLSKYMTVLLFGLLMLVILFAGSALLGLVFFGTGGDTAADVHLVYKDGHVFEQNIIAFLAKTYVYESVSAFMLATMAFMLSAVFRNSSLAVGFSIFLLVMGNTATVFLAAKFEWTKYILFANTDLSQYMNGTPLVEGMTMTFSVVMLVIYFVIFLALAFGVFLKRDIAT
>NZ_CP014700.1|WP_015388504.1|2340619_2341537_-|ABC-transporter-ATP-binding-protein
METVLELQQVKKTIKGRTIIHDLSFSVRAGEVFGFLGPNGAGKTTTIRMMVGLMKLSQGDIVICGESITKNYAKAVRHVGAIVENPELYKFLSGYKNLQQYARMVKGVTKEKIDEVIELVGLQDRIHDKVKTYSLGMRQRLGLAQSLLHNPKVLILDEPTNGLDPAGIREIRDHLKKLTREKGMAVIVSSHLLSEMELMCDRIGILQKGELVDIQKVRDEGKEDKDTYFFHIEQREEALAVLSQFVCVKKTNGIEIQLSKQEVPDVISLLVRENIRLYEVKIMTKSLEDRFLEITGGTKEEVQYV
>NZ_CP014700.1|WP_015388505.1|2341537_2342254_-|ABC-transporter-ATP-binding-protein
MNLDFERVTKKYGRRIAVSDVSFSLSPGKIYGILGPNGSGKSTTLKMLAGLAFPTSGAVRMGECKVGRNMLFRTAYLTEHDMFSARTTVGDMLTFYHSQFPDFQLEKAHNLLAEMNLSAKQKIKELSKGSRGRLKIVLALSRKASVILLDEPFSGLDPAVRESIVNSLVSYIDFDSQIVVIATHEIGKIETLLDEVMVFIKGKIAERREVEEIREQEGMSVLQWYRNVMQAHEIEGGF
>NZ_CP014700.1|WP_031306629.1|2342243_2342621_-|GntR-family-transcriptional-regulator
MENEFQSSKPIYLQIADRIYYRLVRSELSPGDKLPSVREMAVQMKVNPNTIQRTYSEMERLGIVETRRGQGTFIAERSDLKAELKDRLTKDVFKRFIQEMAELGLSPEEMLEGIKQYAEEANDES
>NZ_CP014700.1|WP_015388507.1|2342623_2343391_-|hypothetical-protein
MTSFLGLLKKDAKVSWIWLAVWLCGMICWAFAAHVIAARQKEPLVIFGFFTAMGFFQFLVAPLFMYYHLHKEGKNQLWLYNPNGGFYLLASKLTASLLYQLIGQLALTGYGIWMYRMLSAKGALEHTIPLAGTLTGLNAYLLISSAYLSVIVAVFWTVFHSLKHFPVLRWVICIVLAFVWTYIDDKIITPFTSSQHDLWPVKVYANFHFHYTKLSGWTMELKAVHISLFSFLAVIVLAALCLALASMLLNRKVEV
>NZ_CP014700.1|WP_003155385.1|2343510_2343882_-|hypothetical-protein
MAIIIAVIAAVIVIALLITFNVRSTSAGQDVKEEKREAIGTTAEQPEKHDPAEERSAEHAPVVVKSESPREKKNTMGDDVYRQALQKFKTSETDQEPNDPDSGGKMQDSSYRDALLSLKNKKK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

66265 : 76156

Synechococcus_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007408896.1\|66265_67558_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.5e-19	27.3
WP_015388592.1\|67633_68353_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	3.4e-48	44.7
WP_003155758.1\|68352_68607_+	phosphoribosylformylglycinamidine synthase subunit PurS	M4QPE7	Synechococcus_phage	4.7e-05	33.3
WP_015388591.1\|68603_69287_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_015388590.1\|69270_71499_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.2e-158	40.5
WP_015388589.1\|71474_72905_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.6e-54	32.9
WP_015388588.1\|72996_74037_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.4e-63	41.1
WP_003155752.1\|74033_74621_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.0e-26	39.3
WP_015388587.1\|74617_76156_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	5.1e-78	50.8

DBSCAN-SWA_2

583140 : 674298

Bacillus_phage(46.94%)

integrase,capsid,portal,head,terminase,holin,protease,tail,tRNA

attL 616477:616492|attR 632718:632733

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007408194.1\|583140_583584_+\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_015387900.1\|583610_585173_-	SH3 domain-containing protein	E5DV68	Deep-sea_thermophilic_phage	1.5e-13	33.3
WP_003152726.1\|585830_587105_+\|tRNA	histidine--tRNA ligase	NA	NA	NA	NA
WP_015387901.1\|587119_588898_+\|tRNA	aspartate--tRNA ligase	A0A1V0SIS0	Klosneuvirus	8.7e-13	29.1
WP_003152728.1\|589224_589989_+\|tRNA	tRNA threonylcarbamoyladenosine dehydratase	A0A291ATS8	Pandoravirus	4.1e-20	32.5
WP_015387902.1\|590064_591333_-	replication-associated recombination protein A	A0A127AWE7	Bacillus_phage	3.4e-112	52.3
WP_003152730.1\|591527_591944_+	cysteine metabolism transcriptional regulator CymR	NA	NA	NA	NA
WP_003152731.1\|591962_593102_+	cysteine desulfurase	NA	NA	NA	NA
WP_015387903.1\|593138_594254_+\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_088005508.1\|594341_594962_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_014305491.1\|594980_597359_+	ATP-dependent RecD-like DNA helicase	A0A0K2FLP8	Brevibacillus_phage	5.8e-81	29.7
WP_003152735.1\|597477_597936_+	hypothetical protein	NA	NA	NA	NA
WP_003152738.1\|597948_598140_+	hypothetical protein	NA	NA	NA	NA
WP_003152741.1\|598161_598293_+	DUF3918 domain-containing protein	NA	NA	NA	NA
WP_015387904.1\|598328_598985_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003152744.1\|599002_599653_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003152745.1\|599709_600537_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_003152746.1\|600557_601286_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.3e-35	41.4
WP_015387905.1\|601505_602567_+	AI-2E family transporter	NA	NA	NA	NA
WP_003152748.1\|602898_605535_+\|tRNA	alanine--tRNA ligase	A0A2K9L3D8	Tupanvirus	3.1e-67	34.1
WP_003152749.1\|605619_605886_+	IreB family regulatory phosphoprotein	NA	NA	NA	NA
WP_003152750.1\|605894_606311_+	Holliday junction resolvase RuvX	NA	NA	NA	NA
WP_003152751.1\|606323_606605_+	DUF1292 domain-containing protein	NA	NA	NA	NA
WP_014305487.1\|606715_607807_+	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_015387906.1\|607958_608612_+	O-methyltransferase	NA	NA	NA	NA
WP_003152757.1\|608618_609548_+	U32 family peptidase	NA	NA	NA	NA
WP_014305485.1\|609565_610834_+	U32 family peptidase	Q6DW11	Phage_TP	7.3e-38	31.2
WP_014418513.1\|610840_611473_+	uridine kinase	A0A1V0SAA3	Catovirus	4.1e-34	39.2
WP_015387907.1\|611537_612698_-\|integrase	site-specific integrase	S6C485	Thermus_phage	1.3e-65	36.6
WP_014418511.1\|613004_614186_+	helix-turn-helix transcriptional regulator	A0A288WGA2	Bacillus_phage	1.3e-09	25.6
WP_015387909.1\|614556_614946_-	helix-turn-helix transcriptional regulator	A0A0U4B088	Bacillus_phage	2.2e-06	30.6
WP_152514780.1\|615106_615307_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_015387911.1\|615347_615665_+	hypothetical protein	NA	NA	NA	NA
WP_015387912.1\|615678_616551_+	DNA damage-inducible protein DnaD	A0A0U3TZZ4	Bacillus_phage	6.5e-62	50.2
616477:616492	attL	NA	NA	NA	NA
WP_031306578.1\|616534_617368_+	DNA replication protein	Q2I8C8	Bacillus_phage	3.5e-33	34.4
WP_015387916.1\|617683_618232_+	hypothetical protein	A0A0K2CYJ0	Paenibacillus_phage	3.5e-05	36.5
WP_015387918.1\|618339_618480_+	BH0509 family protein	NA	NA	NA	NA
WP_014721584.1\|618727_618931_+	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	9.8e-14	56.9
WP_015387921.1\|619451_619682_+	hypothetical protein	J9PL10	Bacillus_phage	3.0e-11	42.9
WP_015387922.1\|619678_620080_+	hypothetical protein	X2JNJ3	Bacillus_phage	1.3e-28	45.6
WP_015387923.1\|620092_620350_+	hypothetical protein	F8WQ54	Bacillus_phage	9.6e-06	42.3
WP_015387924.1\|620354_621731_+	DNA cytosine methyltransferase	A0A1I9KFD6	Aeromonas_phage	3.4e-142	48.9
WP_015387925.1\|621744_622569_+	DNA adenine methylase	Q8W5X3	Listeria_phage	1.1e-63	48.4
WP_015387927.1\|622678_623002_+	hypothetical protein	M5ABU9	Bacillus_phage	7.8e-05	33.7
WP_015387928.1\|622998_623598_+	hypothetical protein	A0A1L2JY27	Aeribacillus_phage	1.2e-27	39.0
WP_015387930.1\|624096_624531_+	hypothetical protein	A0A2H4J8A0	uncultured_Caudovirales_phage	2.0e-48	69.3
WP_015387932.1\|624778_625291_+	sigma-70 family RNA polymerase sigma factor	A0A2H4J6J3	uncultured_Caudovirales_phage	8.5e-30	38.8
WP_015387933.1\|625302_625755_+	ArpU family transcriptional regulator	S6AVV9	Thermus_phage	2.6e-38	56.6
WP_014418494.1\|625751_626294_+\|integrase	site-specific integrase	D2XR58	Bacillus_phage	1.1e-54	60.0
WP_152514783.1\|626493_626820_-	hypothetical protein	NA	NA	NA	NA
WP_015387934.1\|626854_627589_+	trypsin-like peptidase domain-containing protein	NA	NA	NA	NA
WP_015387935.1\|627723_628005_+	hypothetical protein	NA	NA	NA	NA
WP_015387936.1\|628001_628316_+	hypothetical protein	NA	NA	NA	NA
WP_015387937.1\|628363_628732_+	hypothetical protein	NA	NA	NA	NA
WP_015387938.1\|628721_629087_+	HNH endonuclease	A0A1U7Q1S7	Geobacillus_virus	7.9e-30	54.2
WP_015387939.1\|629314_629830_+\|terminase	phage terminase small subunit P27 family	A6M947	Geobacillus_virus	1.7e-33	44.6
WP_014305147.1\|629826_631536_+\|terminase	terminase large subunit	A0A0S2GLF0	Bacillus_phage	2.1e-205	62.6
WP_015387940.1\|631724_633005_+\|portal	phage portal protein	D6R3Y6	Bacillus_phage	3.4e-152	63.3
632718:632733	attR	NA	NA	NA	NA
WP_015387941.1\|632967_633594_+\|head,protease	HK97 family phage prohead protease	Q9ZXF7	Bacillus_phage	1.5e-84	79.1
WP_015387942.1\|633631_634924_+\|capsid	phage major capsid protein	A0A0A7RTL2	Clostridium_phage	2.4e-89	47.6
WP_014305142.1\|634951_635350_+	collagen-like protein	D6R3Z0	Bacillus_phage	4.8e-12	44.5
WP_014305141.1\|635367_635670_+\|head,tail	phage gp6-like head-tail connector protein	A0A0S2GLH6	Bacillus_phage	2.6e-10	40.5
WP_014418480.1\|635659_635977_+\|head	phage head closure protein	A0A2H4JCB1	uncultured_Caudovirales_phage	1.1e-11	36.3
WP_015387943.1\|635973_636372_+	hypothetical protein	NA	NA	NA	NA
WP_015387944.1\|636368_636752_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_015387945.1\|636766_637381_+\|tail	tail protein	A0A2H4J8F3	uncultured_Caudovirales_phage	8.4e-24	33.9
WP_014305136.1\|637439_637808_+	hypothetical protein	NA	NA	NA	NA
WP_015387946.1\|638013_642501_+\|tail	phage tail tape measure protein	A0A1Q1PVX7	Staphylococcus_phage	8.5e-65	42.5
WP_015387947.1\|642494_643334_+\|tail	phage tail family protein	D6R3Z9	Bacillus_phage	3.1e-93	57.6
WP_015387948.1\|643348_645052_+	alkaline phosphatase	D6R400	Bacillus_phage	1.5e-179	56.3
WP_015387949.1\|645102_647667_+	peptidase G2	D6R401	Bacillus_phage	9.1e-290	57.4
WP_015387950.1\|647679_648957_+	DUF2479 domain-containing protein	D6R402	Bacillus_phage	2.1e-149	81.9
WP_014305128.1\|648953_649316_+	hypothetical protein	Q9ZXE0	Bacillus_phage	7.1e-55	90.8
WP_015387951.1\|649312_649501_+	XkdX family protein	Q9ZXD9	Bacillus_phage	3.7e-31	100.0
WP_015387952.1\|649552_649975_+\|holin	holin family protein	D6R405	Bacillus_phage	3.3e-64	98.5
WP_015387953.1\|650023_651037_+	N-acetylmuramoyl-L-alanine amidase	A0A1J0MS59	Bacillus_phage	4.9e-186	96.7
WP_015387954.1\|651092_651287_-	hypothetical protein	NA	NA	NA	NA
WP_015387955.1\|651304_651814_-	hypothetical protein	NA	NA	NA	NA
WP_015387956.1\|652069_652729_-	hypothetical protein	NA	NA	NA	NA
WP_003152766.1\|653342_653816_+	transcription elongation factor GreA	NA	NA	NA	NA
WP_015387957.1\|653868_655623_+	penicillin-binding protein 2	NA	NA	NA	NA
WP_015387958.1\|655686_656403_+	YrrS family protein	NA	NA	NA	NA
WP_015387959.1\|656442_656646_-	DUF2536 family protein	NA	NA	NA	NA
WP_015387960.1\|656829_657471_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_003152774.1\|657491_658187_+	5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase	NA	NA	NA	NA
WP_015387961.1\|658234_659158_+	cysteine synthase family protein	A0A1W6JHY1	Lactococcus_phage	8.4e-60	43.4
WP_003152778.1\|659159_660302_+	bifunctional cystathionine gamma-lyase/homocysteine desulfhydrase	A0A0B5JD48	Pandoravirus	2.8e-20	29.2
WP_003152779.1\|660385_660616_+	hypothetical protein	NA	NA	NA	NA
WP_015387962.1\|660655_661147_-	DUF1641 domain-containing protein	NA	NA	NA	NA
WP_094247929.1\|661164_664107_-	formate dehydrogenase subunit alpha	NA	NA	NA	NA
WP_003152783.1\|664413_664782_+	DUF2294 domain-containing protein	NA	NA	NA	NA
WP_007408225.1\|665045_665846_+	formate/nitrite transporter family protein	NA	NA	NA	NA
WP_003152787.1\|666234_666375_+	YrzI family small protein	NA	NA	NA	NA
WP_015387964.1\|666876_667416_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_003152789.1\|667625_668192_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_015387965.1\|668219_671381_+	cytochrome P450	V5UQK0	Mycobacterium_phage	6.0e-73	36.7
WP_015387966.1\|671530_672739_-	MFS transporter	NA	NA	NA	NA
WP_003152795.1\|672863_673748_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_015387967.1\|673815_674298_+\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA

DBSCAN-SWA_3

976664 : 982917

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015388054.1\|976664_977780_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	1.2e-55	36.9
WP_003153370.1\|977760_978408_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.5e-39	44.3
WP_003153371.1\|978422_979619_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	2.1e-116	54.9
WP_003153372.1\|979651_980116_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.2e-43	59.3
WP_003153373.1\|980232_980607_+	GNAT family N-acetyltransferase RibT	NA	NA	NA	NA
WP_012117889.1\|980672_981194_-	DUF309 domain-containing protein	NA	NA	NA	NA
WP_003153376.1\|981281_981371_-	YjcZ family sporulation protein	NA	NA	NA	NA
WP_003153377.1\|981578_982334_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	6.5e-10	25.3
WP_003153378.1\|982323_982917_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.6e-14	36.6

DBSCAN-SWA_4

1402840 : 1409055

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015417523.1\|1402840_1403809_-	stage V sporulation protein K	G3MAX6	Bacillus_virus	8.0e-53	40.9
WP_015388200.1\|1403857_1404082_+	hypothetical protein	NA	NA	NA	NA
WP_015388201.1\|1404115_1404874_+	N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	1.1e-52	50.4
WP_015388202.1\|1404924_1405545_-	hypothetical protein	A0A127AYS1	Bacillus_phage	2.7e-46	47.4
WP_003154059.1\|1405593_1406583_-	class 1b ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	8.7e-156	83.6
WP_003154060.1\|1406600_1408703_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	86.0
WP_014305044.1\|1408662_1409055_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	6.5e-30	59.1

DBSCAN-SWA_5

1958581 : 1990319

Bacillus_phage(33.33%)

portal,plate,terminase,holin,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014304858.1\|1958581_1959460_-	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	2.8e-81	60.5
WP_003154813.1\|1959473_1959737_-\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	2.3e-23	65.5
WP_003154815.1\|1959750_1960014_-	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	8.8e-23	63.1
WP_014304857.1\|1960065_1960827_-	hypothetical protein	NA	NA	NA	NA
WP_003154819.1\|1960883_1961081_-	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	4.3e-14	61.8
WP_014304856.1\|1961086_1961458_-	hypothetical protein	NA	NA	NA	NA
WP_014304855.1\|1961470_1963093_-	hypothetical protein	A0A1P8CWR7	Bacillus_phage	5.3e-41	39.3
WP_014304854.1\|1963095_1963368_-	hypothetical protein	NA	NA	NA	NA
WP_003154823.1\|1963364_1963943_-	YmfQ family protein	A0A2H4J717	uncultured_Caudovirales_phage	2.4e-12	31.0
WP_015388353.1\|1963926_1964973_-\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	2.3e-69	43.8
WP_003154825.1\|1964965_1965391_-	DUF2634 domain-containing protein	A0A2H4J6K5	uncultured_Caudovirales_phage	1.5e-11	35.9
WP_003154827.1\|1965494_1965761_-	DUF2577 domain-containing protein	S6C459	Thermus_phage	3.4e-06	37.5
WP_015388354.1\|1965760_1966738_-	hypothetical protein	A0A1L6BY20	Clostridium_phage	2.2e-34	30.9
WP_007610816.1\|1966751_1967411_-	LysM peptidoglycan-binding domain-containing protein	G3MBQ1	Bacillus_virus	1.8e-08	45.3
WP_015388355.1\|1967403_1972368_-	transglycosylase SLT domain-containing protein	A0A1L2JY60	Aeribacillus_phage	3.2e-41	46.6
WP_015239684.1\|1972355_1972508_-	hypothetical protein	NA	NA	NA	NA
WP_003154836.1\|1972549_1972996_-\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	1.0e-10	35.8
WP_003154837.1\|1973072_1973516_-\|tail	phage tail tube protein	A0A0K2CNG3	Brevibacillus_phage	8.4e-26	45.2
WP_015388356.1\|1973517_1974915_-\|portal	phage portal protein	A0A0A7RTT5	Clostridium_phage	9.0e-82	40.4
WP_003154839.1\|1974914_1975124_-	hypothetical protein	NA	NA	NA	NA
WP_014304848.1\|1975120_1975567_-	hypothetical protein	NA	NA	NA	NA
WP_014304847.1\|1975563_1976067_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_003154844.1\|1976063_1976420_-	DUF3599 family protein	NA	NA	NA	NA
WP_015388357.1\|1976416_1976800_-	DUF3199 family protein	NA	NA	NA	NA
WP_007407274.1\|1976816_1977752_-\|portal	phage portal protein	A0A1B1P7E3	Bacillus_phage	3.3e-104	62.8
WP_015388358.1\|1977778_1978624_-\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	2.2e-54	57.1
WP_088005490.1\|1978643_1980035_-\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	3.0e-138	55.6
WP_003154853.1\|1980083_1981382_-\|terminase	PBSX family phage terminase large subunit	M4ZRM5	Bacillus_phage	8.5e-151	59.6
WP_003154855.1\|1981378_1982176_-\|terminase	terminase	A0A0S2MVB6	Bacillus_phage	9.4e-60	50.6
WP_003154857.1\|1982288_1982801_-	sigma-70 family RNA polymerase sigma factor	A0A0K2CNQ1	Brevibacillus_phage	5.0e-22	43.9
WP_003154859.1\|1982913_1983117_-	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	5.4e-12	48.5
WP_003154861.1\|1983106_1983448_-	hypothetical protein	NA	NA	NA	NA
WP_003154865.1\|1983712_1984513_-	ATP-binding protein	A6XMI1	Bacillus_virus	3.6e-59	45.1
WP_003154867.1\|1984412_1985240_-\|portal	phage portal protein	S6BFM4	Thermus_phage	6.4e-19	27.9
WP_003154869.1\|1985229_1985409_-	hypothetical protein	NA	NA	NA	NA
WP_003154871.1\|1985600_1985939_+	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	8.4e-18	45.8
WP_003154873.1\|1986087_1986678_+	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	3.0e-39	51.7
WP_003154876.1\|1986832_1987438_-	poly-gamma-glutamate hydrolase family protein	A0A0Y0AJU6	Bacillus_phage	7.4e-41	46.8
WP_003154878.1\|1987547_1987925_+	PH domain-containing protein	A5GYQ0	Lactococcus_phage	1.1e-15	40.6
WP_003154880.1\|1987962_1988916_-	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	1.1e-62	69.3
WP_003154881.1\|1989058_1989193_-	PhrA family phosphatase inhibitor	NA	NA	NA	NA
WP_150974872.1\|1989182_1990319_-	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	4.9e-94	47.6

DBSCAN-SWA_6

2053001 : 2104853

uncultured_Caudovirales_phage(38.24%)

integrase,capsid,portal,head,terminase,coat,holin,tail

attL 2048818:2048877|attR 2089925:2090008

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2048818:2048877	attL	NA	NA	NA	NA
WP_015239640.1\|2053001_2053424_-\|holin	holin	D6R405	Bacillus_phage	3.8e-60	89.5
WP_015388395.1\|2053691_2053859_-	XkdX family protein	NA	NA	NA	NA
WP_015388396.1\|2053997_2054387_-	hypothetical protein	NA	NA	NA	NA
WP_015388397.1\|2054400_2057784_-	hypothetical protein	Q5YA57	Bacillus_phage	2.1e-132	46.1
WP_015388398.1\|2057796_2058561_-\|tail	phage tail family protein	NA	NA	NA	NA
WP_015388399.1\|2058557_2063372_-	hypothetical protein	M9NRJ5	Staphylococcus_phage	4.7e-37	24.3
WP_003155844.1\|2063376_2063685_-	hypothetical protein	NA	NA	NA	NA
WP_003155845.1\|2063732_2064239_-	hypothetical protein	I6T7F0	Staphylococcus_virus	6.7e-11	33.3
WP_076983191.1\|2064295_2064538_-	fibronectin type III domain-containing protein	NA	NA	NA	NA
WP_076983182.1\|2064551_2064866_-	fibronectin type III domain-containing protein	Q0PDK9	Bacillus_phage	4.6e-26	77.8
WP_015388401.1\|2064807_2065320_-\|tail	phage major tail protein, TP901-1 family	Q0PDK9	Bacillus_phage	1.2e-26	42.4
WP_015239630.1\|2065333_2065732_-	DUF3168 domain-containing protein	W8EK61	Geobacillus_phage	4.9e-25	44.6
WP_007408589.1\|2065750_2066167_-	HK97 gp10 family phage protein	O48447	Bacillus_phage	7.4e-32	54.2
WP_015388402.1\|2066159_2066498_-\|head	phage head closure protein	NA	NA	NA	NA
WP_015388403.1\|2066494_2066794_-	hypothetical protein	NA	NA	NA	NA
WP_015388404.1\|2066802_2067054_-	hypothetical protein	NA	NA	NA	NA
WP_015388405.1\|2067055_2067397_-	hypothetical protein	NA	NA	NA	NA
WP_015388406.1\|2067401_2068319_-\|capsid	phage major capsid protein	A0A2H4JCG0	uncultured_Caudovirales_phage	2.9e-113	67.9
WP_015388407.1\|2068334_2068916_-	DUF4355 domain-containing protein	A0A2H4J4P4	uncultured_Caudovirales_phage	1.5e-54	56.3
WP_015388408.1\|2069018_2069945_-\|head	head protein	A0A1Q1PVS0	Bacillus_phage	3.9e-81	51.5
WP_014304497.1\|2069931_2071335_-\|portal	phage portal protein	A0A2H4J4Q7	uncultured_Caudovirales_phage	1.8e-154	59.8
WP_032865737.1\|2071340_2072549_-\|terminase	PBSX family phage terminase large subunit	A0A2H4J8B0	uncultured_Caudovirales_phage	1.8e-203	84.5
WP_015388410.1\|2072535_2073291_-	hypothetical protein	A0A2H4J4R0	uncultured_Caudovirales_phage	1.2e-61	54.2
WP_015388411.1\|2073450_2073663_-	hypothetical protein	NA	NA	NA	NA
WP_015388412.1\|2074039_2074903_-	C1 family peptidase	A0A1V0SLQ7	Klosneuvirus	3.0e-19	28.5
WP_015388413.1\|2075013_2075229_-	helix-turn-helix domain-containing protein	A0A1Z1LZP5	Bacillus_phage	7.5e-12	48.6
WP_015239615.1\|2075762_2076278_-	sigma-70 family RNA polymerase sigma factor	A0A1L2JY33	Aeribacillus_phage	4.0e-27	43.2
WP_152514779.1\|2076508_2077261_-	hypothetical protein	NA	NA	NA	NA
WP_015388416.1\|2077431_2078256_-	DNA adenine methylase	Q8W5X3	Listeria_phage	2.9e-64	48.4
WP_015388417.1\|2078259_2078517_-	hypothetical protein	F8WQ54	Bacillus_phage	6.6e-07	40.0
WP_015388418.1\|2078513_2078798_-	hypothetical protein	NA	NA	NA	NA
WP_003155894.1\|2078829_2079033_-	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	3.4e-22	75.4
WP_015388419.1\|2079323_2079752_-	RusA family crossover junction endodeoxyribonuclease	S6B1L9	Thermus_phage	7.3e-43	63.5
WP_152514781.1\|2079986_2080934_-	AAA family ATPase	A0A0K2CPA5	Brevibacillus_phage	2.0e-56	50.7
WP_015388423.1\|2080818_2081520_-	DnaD domain protein	A0A2H4J6G9	uncultured_Caudovirales_phage	1.2e-05	33.3
WP_021734186.1\|2081717_2082455_-	hypothetical protein	A0A0A7RUC1	Clostridium_phage	1.5e-51	44.9
WP_015388425.1\|2082474_2083392_-	hypothetical protein	A0A0A7S0A9	Clostridium_phage	1.1e-88	62.5
WP_015388426.1\|2083388_2083580_-	hypothetical protein	NA	NA	NA	NA
WP_015388427.1\|2083579_2083930_-	hypothetical protein	NA	NA	NA	NA
WP_015388428.1\|2084032_2084236_-	hypothetical protein	NA	NA	NA	NA
WP_015388429.1\|2084232_2084490_-	hypothetical protein	A0A2H4J4M9	uncultured_Caudovirales_phage	3.9e-07	38.0
WP_015388430.1\|2084486_2085059_-	helix-turn-helix transcriptional regulator	A0A2H4J884	uncultured_Caudovirales_phage	2.0e-59	56.1
WP_015388431.1\|2085116_2085845_-	phage regulatory protein	A0A2H4J4N4	uncultured_Caudovirales_phage	1.4e-86	63.3
WP_007408621.1\|2085841_2086036_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_015388432.1\|2086046_2086271_-	helix-turn-helix transcriptional regulator	A0A2H4J4N8	uncultured_Caudovirales_phage	7.2e-26	81.1
WP_015239592.1\|2086429_2086804_+	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	1.2e-33	65.9
WP_015388433.1\|2087025_2088003_+	hypothetical protein	NA	NA	NA	NA
WP_015388434.1\|2088075_2088597_+	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	2.7e-55	63.9
WP_015388435.1\|2088601_2089831_+\|integrase	site-specific integrase	A0A0K2CZ62	Paenibacillus_phage	1.2e-106	49.5
WP_003154961.1\|2090171_2091347_-	cystathionine beta-lyase	NA	NA	NA	NA
2089925:2090008	attR	NA	NA	NA	NA
WP_015388436.1\|2091339_2092461_-	methionine biosynthesis PLP-dependent protein	NA	NA	NA	NA
WP_015388437.1\|2092830_2093553_+	esterase family protein	NA	NA	NA	NA
WP_003154969.1\|2093578_2094094_+	hypothetical protein	NA	NA	NA	NA
WP_003154971.1\|2094098_2094530_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003154973.1\|2094690_2094924_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_014304807.1\|2094924_2095662_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	5.2e-28	33.3
WP_003154977.1\|2095654_2096377_+	ABC transporter permease	NA	NA	NA	NA
WP_015388438.1\|2096417_2097167_-	subclass B1 metallo-beta-lactamase	NA	NA	NA	NA
WP_003154980.1\|2097235_2097490_-	hypothetical protein	NA	NA	NA	NA
WP_015388439.1\|2097610_2099896_+	ATP-dependent helicase	A0A068EQC7	Bacillus_phage	1.9e-84	33.2
WP_003154986.1\|2099964_2100219_-	sporulation protein	NA	NA	NA	NA
WP_003154988.1\|2100381_2100549_-	YjcZ family sporulation protein	NA	NA	NA	NA
WP_003154990.1\|2100641_2100839_-	hypothetical protein	NA	NA	NA	NA
WP_015388440.1\|2101126_2101483_-	DUF1360 domain-containing protein	NA	NA	NA	NA
WP_003154992.1\|2101653_2102040_+\|coat	spore coat protein	NA	NA	NA	NA
WP_003154993.1\|2102077_2102392_+	hypothetical protein	NA	NA	NA	NA
WP_003154994.1\|2102484_2102985_+\|coat	spore coat protein	NA	NA	NA	NA
WP_003154995.1\|2103135_2103618_+\|coat	spore coat protein	NA	NA	NA	NA
WP_003154997.1\|2103763_2104207_+\|coat	spore coat protein	NA	NA	NA	NA
WP_015388441.1\|2104265_2104853_-\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_7

3591715 : 3643964

Bacillus_phage(11.11%)

protease,coat,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003151071.1\|3591715_3593386_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
WP_003151069.1\|3593382_3593811_-	DUF1934 family protein	NA	NA	NA	NA
WP_015387560.1\|3594102_3595248_+	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	3.6e-76	42.6
WP_015387559.1\|3595231_3595351_+	phosphatase	NA	NA	NA	NA
WP_003151064.1\|3595549_3595753_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003151062.1\|3595766_3595970_+	hypothetical protein	NA	NA	NA	NA
WP_014306021.1\|3596378_3596660_+	hypothetical protein	NA	NA	NA	NA
WP_015387558.1\|3596703_3597216_+	stage II sporulation protein M	NA	NA	NA	NA
WP_014306022.1\|3597220_3597760_+	hypothetical protein	NA	NA	NA	NA
WP_003151056.1\|3597806_3598025_-	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_003151054.1\|3598194_3599067_-	agmatinase	NA	NA	NA	NA
WP_003151052.1\|3599126_3599957_-	spermidine synthase	NA	NA	NA	NA
WP_015387557.1\|3600156_3602229_+	penicillin-binding protein	NA	NA	NA	NA
WP_015387556.1\|3602252_3602684_-	hypothetical protein	NA	NA	NA	NA
WP_015387555.1\|3602827_3603346_-	hypothetical protein	NA	NA	NA	NA
WP_003151043.1\|3603358_3604018_-\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_003151042.1\|3604123_3604312_+	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_003151040.1\|3604349_3604769_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_003151037.1\|3605159_3606539_+	amino acid permease	NA	NA	NA	NA
WP_003151036.1\|3606603_3607104_-	YwgA family protein	NA	NA	NA	NA
WP_003151035.1\|3607143_3608445_-	HD domain-containing protein	E3T4P8	Cafeteria_roenbergensis_virus	1.0e-23	29.5
WP_003151034.1\|3608605_3608830_-	DUF1450 domain-containing protein	NA	NA	NA	NA
WP_003151032.1\|3609034_3609808_+	RsfA family transcriptional regulator	NA	NA	NA	NA
WP_003151030.1\|3610108_3610384_+	PadR family transcriptional regulator	NA	NA	NA	NA
WP_003151028.1\|3610384_3610939_+	DUF1700 domain-containing protein	NA	NA	NA	NA
WP_015387552.1\|3611304_3612168_-	lipoate--protein ligase family protein	NA	NA	NA	NA
WP_007407666.1\|3612214_3613114_-	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	2.1e-07	40.2
WP_015387551.1\|3613229_3614207_+	putative sulfate exporter family transporter	NA	NA	NA	NA
WP_003151012.1\|3614243_3615215_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_003151011.1\|3615477_3616242_+	heme-dependent peroxidase	NA	NA	NA	NA
WP_003151010.1\|3616361_3617141_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_015387550.1\|3617157_3618357_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_003151007.1\|3618369_3619551_-	MFS transporter	NA	NA	NA	NA
WP_015387549.1\|3619547_3620966_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_003151003.1\|3620983_3621745_-	dihydroanticapsin 7-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	4.4e-22	30.5
WP_015387548.1\|3621741_3622452_-	cupin domain-containing protein	NA	NA	NA	NA
WP_003150997.1\|3622441_3623056_-	bacilysin biosynthesis protein BacA	NA	NA	NA	NA
WP_015387547.1\|3623217_3624456_-	MFS transporter	NA	NA	NA	NA
WP_014306037.1\|3624678_3625881_+	multidrug effflux MFS transporter	S4TR35	Salmonella_phage	6.4e-28	26.3
WP_015387546.1\|3625913_3627332_-	amino acid permease	NA	NA	NA	NA
WP_014306039.1\|3627356_3629039_-	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_014306040.1\|3629110_3630658_-	L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_015387545.1\|3630865_3632152_-	Glu/Leu/Phe/Val dehydrogenase	NA	NA	NA	NA
WP_003150988.1\|3632337_3632799_-	hypothetical protein	NA	NA	NA	NA
WP_015387544.1\|3633014_3633470_-\|coat	spore coat protein	NA	NA	NA	NA
WP_015387543.1\|3633466_3634315_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	7.0e-37	37.3
WP_014306044.1\|3634335_3635283_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	7.7e-69	42.9
WP_015387542.1\|3635285_3636023_-	NTP transferase domain-containing protein	G3MA50	Bacillus_virus	6.5e-47	42.7
WP_015387541.1\|3636050_3637055_-\|coat	spore coat protein	NA	NA	NA	NA
WP_014306047.1\|3637056_3637800_-\|coat	spore coat protein	NA	NA	NA	NA
WP_014306048.1\|3637789_3638911_-\|coat	spore coat protein	NA	NA	NA	NA
WP_015387539.1\|3638910_3639774_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003150976.1\|3639774_3640944_-	DegT/DnrJ/EryC1/StrS family aminotransferase	NA	NA	NA	NA
WP_015387538.1\|3640965_3642390_-	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
WP_015387537.1\|3642394_3643165_-	glycosyltransferase family 2 protein	A0A0F7L2F7	uncultured_marine_virus	4.4e-06	26.3
WP_015387536.1\|3643445_3643964_+\|coat	spore coat protein GerQ	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage