CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP011831	Enterococcus faecium strain UW8175 plasmid unnamed3, complete sequence	0 crisprs	NA	0	0
NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	1 crisprs	cas14j,csa3	1	3
NZ_CP011830	Enterococcus faecium strain UW8175 plasmid unnamed2, complete sequence	0 crisprs	WYL	0	2
NZ_CP011828	Enterococcus faecium strain UW8175 chromosome, complete genome	1 crisprs	cas3,csa3,cas14j,DinG,DEDDh,cas2	0	190

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP011829_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011829_1

60296-60424

TypeV

Consensus_repeat	Method
GGTATGATTTTCATACCCTCTTGA	CRISPRCasFinder

2 spacers

cas14j

The CRISPR arrays of NZ_CP011829_1

>merge|NZ_CP011829|1|60296-60424|CRISPRCasFinder
GGTATGATTTTCATACCCTCTGATTTATCAACGTTTTGGCACGGTATGATTTTCATACCCTCTTGAGCCCCAAGGGATTCAGCGTCTGATTTTTCGTCGAGGGTGGGTATGATTTTCATACCCTCTGAT

>NZ_CP011829|1|1|60296-60424|CRISPRCasFinder
GGTATGATTTTCATACCCTCTGAT	TTATCAACGTTTTGGCAC
GGTATGATTTTCATACCCTCTTGA	GCCCCAAGGGATTCAGCGTCTGATTTTTCGTCGAGGGTG
GGTATGATTTTCATACCCTCTGAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011829.1\|WP_002348857.1\|63270_63465_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011829.1\|WP_002311530.1\|52123_53242_-\|transposase	cas14j	-	gnl\|CDD\|223747
NZ_CP011829.1\|WP_002311521.1\|57695_58037_-\|DUF5406-domain-containing-protein	unknown	unknown	gnl\|CDD\|379975
NZ_CP011829.1\|WP_002290397.1\|64208_64463_+\|AbrB-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274230
NZ_CP011829.1\|WP_002290394.1\|64463_64781_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|368240
NZ_CP011829.1\|WP_002311523.1\|57386_57677_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011829.1\|WP_002311533.1\|50100_50928_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237019
NZ_CP011829.1\|WP_002287525.1\|65312_66461_-\|transposase	cas14j	-	gnl\|CDD\|223747
NZ_CP011829.1\|WP_002287522.1\|66477_66882_-\|IS200/IS605-like-element-ISEfa4-family-transposase	unknown	unknown	gnl\|CDD\|376616
NZ_CP011829.1\|WP_002307630.1\|68920_69217_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011829.1\|WP_002311527.1\|54175_55804_-\|isopeptide-forming-domain-containing-fimbrial-protein	unknown	unknown	gnl\|CDD\|374637
NZ_CP011829.1\|WP_002311528.1\|53265_53667_-\|IS200/IS605-family-transposase	unknown	unknown	gnl\|CDD\|376616
NZ_CP011829.1\|WP_002295288.1\|69226_69433_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011829.1\|WP_002322486.1\|58655_58988_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011829.1\|WP_112009138.1\|67216_68379_+\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP011829.1\|WP_061573552.1\|61719_62679_+\|IS30-like-element-IS6770-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP011829.1\|WP_002311524.1\|56961_57195_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011829.1\|WP_002311526.1\|55856_56528_-\|class-A-sortase	unknown	unknown	gnl\|CDD\|320680
NZ_CP011829.1\|WP_002311532.1\|50924_51680_-\|class-C-sortase	unknown	unknown	gnl\|CDD\|320676
NZ_CP011829.1\|WP_002307629.1\|68572_68839_+\|YfhO-family-protein	unknown	unknown	gnl\|CDD\|370572

Protein	Function_ID	Function_description	E-value
NZ_CP011829.1\|WP_002311530.1\|52123_53242_-\|transposase	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	3.49829e-52
NZ_CP011829.1\|WP_002311521.1\|57695_58037_-\|DUF5406-domain-containing-protein	gnl\|CDD\|379975	pfam17400, DUF5406, Family of unknown function (DUF5406). This is a family of unknown function found in Bacteria.	8.60138e-49
NZ_CP011829.1\|WP_002290394.1\|64463_64781_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|368240	pfam05016, ParE_toxin, ParE toxin of type II toxin-antitoxin system, parDE. ParE is the toxin family of a type II toxin-antitoxin family. It is toxic towards DNA gyrase, but is neutralized by the antitoxin ParD. The family also encompasses RelE/ParE described in.	2.94793e-05
NZ_CP011829.1\|WP_002290397.1\|64208_64463_+\|AbrB-family-transcriptional-regulator	gnl\|CDD\|274230	TIGR02609, hypothetical_protein_XAC1195, putative addiction module antidote. Members of this protein family are putative addiction module antidote proteins that appear recurringly in two-gene operons with members of the Doc (death-on-curing) family TIGR01550. Members of this family contain a SpoVT/AbrB-like domain (pfam04014). Note that the gene pairs with a member of this family tend to be found on bacterial chromosomes, not on plasmids. [Mobile and extrachromosomal element functions, Other].	1.45571e-07
NZ_CP011829.1\|WP_002311533.1\|50100_50928_-\|hypothetical-protein	gnl\|CDD\|237019	PRK11907, PRK11907, bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase.	0.00482945
NZ_CP011829.1\|WP_002287525.1\|65312_66461_-\|transposase	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.29752e-54
NZ_CP011829.1\|WP_002287522.1\|66477_66882_-\|IS200/IS605-like-element-ISEfa4-family-transposase	gnl\|CDD\|376616	pfam01797, Y1_Tnp, Transposase IS200 like. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS200 from E. coli.	2.76401e-48
NZ_CP011829.1\|WP_002311527.1\|54175_55804_-\|isopeptide-forming-domain-containing-fimbrial-protein	gnl\|CDD\|374637	pfam16569, GramPos_pilinBB, Gram-positive pilin backbone subunit 2, Cna-B-like domain. GramPos_pilinBB is one of the major backbone units of Gram-positive pili, such as those from S.pneumoniae. There are three major pilin subunits that form the polymeric backbone of the pilin from S. pneumoniae, constructed of three transthyretin-like, CnaB, domains along with a crucial N-terminal domain, D1. The three Cna-B like domains are stabilized by internal Lys-Asn isopeptdie bonds, Gram-positive pili are formed from a single chain of covalently linked subunit proteins (pilins), usually comprising an adhesin at the distal tip, a major pilin that forms the polymer shaft and a minor pilin that mediates cell wall anchoring at the base.	1.13339e-27
NZ_CP011829.1\|WP_002311528.1\|53265_53667_-\|IS200/IS605-family-transposase	gnl\|CDD\|376616	pfam01797, Y1_Tnp, Transposase IS200 like. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS200 from E. coli.	1.83008e-44
NZ_CP011829.1\|WP_112009138.1\|67216_68379_+\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	7.59417e-48
NZ_CP011829.1\|WP_061573552.1\|61719_62679_+\|IS30-like-element-IS6770-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	1.12188e-52
NZ_CP011829.1\|WP_002311526.1\|55856_56528_-\|class-A-sortase	gnl\|CDD\|320680	cd06165, Sortase_A, Sortase domain found in class A sortases. Class A sortases are membrane-bound cysteine transpeptidases distributed in Gram-positive bacteria (mainly present in Firmicutes). They perform a housekeeping role in the cell as members of this group are capable of anchoring a large number of functionally distinct surface proteins containing a cell wall sorting signal to an amino group located on the bacterial cell wall. They do so by catalyzing a transpeptidation reaction in which the surface protein substrate is cleaved at a conserved cell wall-sorting signal (Class A sortases recognize a canonical LPXTG motif, X can be any amino acid), and covalently linked to peptidoglycan for display on the bacterial surface. The prototypical sortase A protein from Staphylococcus aureus (named Sa-SrtA) cleaves the amide bond between threonine and glycine residues of the canonical LPXTG motif in a wide range of protein substrates with diverse functions that can promote bacterial adhesion, nutrient acquisition, host cell invasion, and immune evasion. Next, it catalyzes a transpeptidation reaction by which the proteins are covalently linked to the peptidoglycan precursor lipid II. SrtA is therefore affects the ability of a pathogen to establish successful infection. SrtA contains an N-terminal hydrophobic segment, a linker region and an extra-cellular C-terminal catalytic domain. The hydrophobic segment functions as both a signal peptide for secretion and a stop-transfer signal for membrane anchoring. The catalytic domain contains the catalytic TLXTC signature sequence where X is usually a valine, isoleucine or a threonine. The gene encoding SrtA is generally not located in the same gene cluster as its substrates while the gene encoding SrtB is usually clustered in the same locus as its substrate.	1.18165e-44
NZ_CP011829.1\|WP_002311532.1\|50924_51680_-\|class-C-sortase	gnl\|CDD\|320676	cd05827, Sortase_C, Sortase domain found in class C sortases. Class C sortases are membrane-bound cysteine transpeptidases broadly distributed in Gram-positive bacteria (mainly present in Firmicutes and Actinobacteria). They function as pilin polymerases responsible for the assembly of pili, which are multi-subunit hair-like fibres that extend from the cell surface to promote microbial adhesion and biofilm formation. First, one or more class C sortases form the long thin shaft of the pilus through linking together pilin subunits via isopeptide bonds. The base of the pilus is then anchored to the cell wall by a housekeeping sortase or, in some cases, the class C sortase itself. Depending upon the organism both the number and type of sortase enzymes involved varies, and in some cases, accessory factors appear to be needed. In three-component spaA pilus from Corynebacterium diphtheriae, the prototypical class C sortase (named Cd-SrtA) catalyzes polymerization of the SpaA-type pilus, consisting of the shaft pilin SpaA, tip pilin SpaC and minor pilin SpaB. The pilus shaft is then attached to the cell wall by a housekeeping class E sortase, Cd-SrtF. In the absence of Cd-SrtF, Cd-SrtA attaches the pilus to the cell wall, albeit at a reduced rate. Cd-SrtA can recognize two distinct sorting signals (LPLTG in SpaA and SpaC, and LAFTG in SpaB) and it can employ lysine residues that originate from different proteins (either Lys190 within the pilin motif of SpaA or Lys139 in SpaB). However, Cd-SrtA cannot be able to polymerize the major pilin subunit SpaH, even though it contains LPLTG motif. In two-component pili of prototypical Bacillus cereus, the class C sortase (named Bc-SrtD) cleaves related sorting signals within a major pilin protein BcpA (LPVTG) and a minor tip pilin BcpB (IPNTG), and catalyzes a transpeptidation that joins the threonine residues in each signal to the side-chain of Lys162 in BcpA (located within a pilin motif). Unlike the SpaA pilus in C. diphtheriae, in B. cereus Bc-SrtD is unable to covalently attach the pilus to the cell wall without the help of the housekeeping sortase.	1.06599e-60
NZ_CP011829.1\|WP_002307629.1\|68572_68839_+\|YfhO-family-protein	gnl\|CDD\|370572	pfam09586, YfhO, Bacterial membrane protein YfhO. This protein is a conserved membrane protein. The yfhO gene is transcribed in Difco sporulation medium and the transcription is affected by the YvrGHb two-component system. Some members of this family have been annotated as glycosyl transferases of the PMT family.	7.49269e-07

>NZ_CP011829.1|WP_002322486.1|58655_58988_-|hypothetical-protein
MSYTGILSLKDICHYGKRCTATEKITKKLSTGQSKTVVQCKKYIIQKDKVSEEMIYYIGKQKQIILKDPIPLKELYPTIKHVYDQNGVLIGRRKNGVLRCTAKGMGRLIS
>NZ_CP011829.1|WP_002311521.1|57695_58037_-|DUF5406-domain-containing-protein
MKNYDPNIRLGTHTIKVSFQRWDYKGFVTFRRGGNCKGLDVLALNEDDLYDQTLTDNPIGFGLLPEDDEGNEWFKMTLMNDNGDELSVEDTWSYLSDYIVSVEIIEFVADKEE
>NZ_CP011829.1|WP_002311523.1|57386_57677_-|hypothetical-protein
MKFFEVKSPYYYALIAAKNEEECAELYEQVVTDIENREEFIRCLHELNRNEAIQEDAKKISEETLQPIGMEEATKDIFTIIDEQKSCVLSIDSTLV
>NZ_CP011829.1|WP_002311524.1|56961_57195_-|hypothetical-protein
MARPVLDAMDMDTLTKGRYVQLLARGYSPKDVFKALSKGTDMEKERLRKEFDYWREHNGIKDLKPARPVIRRKKLKK
>NZ_CP011829.1|WP_002311526.1|55856_56528_-|class-A-sortase
MKKWLFGFLGVALIVFCSVFGYVSYQKHEGDVFKQNIEKKMPVDQINAHAKSYKEDATNVNNDMSLGQMLSIQKEAIEMGVNKQVFAQIQIPALGLALPIFKGANQYTLSLGAATYFYEDAEMGKGNYVLAGHNMEMPGVLFSDIQKLSLGEVMDLVSNDGVYRYKVTCKFIVSEYFKLIDGVPEENSFLSLPKKGEKPLLTLFTCVYTSQGKERYVVQGELQ
>NZ_CP011829.1|WP_002311527.1|54175_55804_-|isopeptide-forming-domain-containing-fimbrial-protein
MAINRYVKKAGMLVGMLGIIAGCFQGYRAYAEDVTQKTPPEKVNITVHKLMYDQGTQLNVDIDGIKNDGYTHDQYPTGVTKYNKADYGDVEFTLGNITDQVLPREDSDLTNAKVDEIVKDVEDKGSNSEYVKNATNKITSAVDENGEITFADQPAYVNSKGNVYVVYESKSAAGLVTQKAKPMVVIAPMTDNTGSGFLKDIHLYPKNIVSKLSFELTKFGDDGTAQSKQTPLKGAKFELYKGEPGKGTKLGDLVSDDQGKLTATDLTLGKYYFVEVPSEVVVGSDKEPTADQYLLGADARNDAHNKLTFEITNDGVTSDLKASYVNYKAPVIDKTVTNGTGQEHSFQIGDAVNYQGTIHIPTDIAGGADGITVNGVKSETSPYSVFKWGDTAGQGLSYVAEKANIKVTNNDGSVVLKENTDYKIENSDSGFVIDFIVNNGQVSDTVANLHGQDLKMTYNMFVNDSAEIANPLTNSVDFVYSNNPFNQEEHHEKTKADAVTYGAKFLKADGGLFGTGIKATPLEGAEFAAKNAEGKYYSFCGR
>NZ_CP011829.1|WP_002311528.1|53265_53667_-|IS200/IS605-family-transposase
MDNEYRYSKTTVSLVNYHFVFCPRYRRKIFVNSEVDARFKALVQEIAKENEWNIIAIETDKDHCHLLINVQPTYSPSKIMKIIKGKTSSIIRQEFEHLSKMPSVWTRSYFVSTAGNVSSEIIKRYVENQRTRY
>NZ_CP011829.1|WP_002311530.1|52123_53242_-|transposase
MKKAHKIRIYPNCRQEIQFQKTFGCVRFYWNFLLDQRITNYKKKKENADYKEDKTTYASLKKMEEYAWLKEVEAQPLSQVAMDLNKAFKNTFNSTFGFPKFKSKKYSKKSYRTAMGIKVNRNYFYVSKVGWVKMAETLRFNGKLMNVTISQSKTEKYFATFLVDIENFQKDPVTESIGLDLGLTHFCITSAGEKIGNERFYRSLEKRLVVEQRKLSRRLEVAKKHNRKLEECKNYQKQRVKVARIHEKIFNQRNDFLHKLSSRITDENQIICIEDLNVTGMVRNHKLAKSIADVSWSEFVRQLTYKCEWKGRTLVKIDRFYPSSQICSSCGHNDGKKELDIREWTCSNCGTNHDRDINASINIRTEGLSGIA
>NZ_CP011829.1|WP_002311532.1|50924_51680_-|class-C-sortase
MIIRKPPKRRVMHKLMIFFWLLSAVAVYLIPVVETNVAKFQQKQRILAIENLEKTDSSLDVAKIELGDPVGVLTIPSISLKLPIYDGTSEKILENGVGITEGTGDITGGNGKNPLIAGHSGLYKDNLFDDLPSVKKGQKFFIKVNEEQHAYQIYRIEEVKAEELQKNYLDYLMPEKDQDRITLMTCTPKGVNSHRFLVYGERVSFSKEDLKLQKKAKNRKSISLDWRLALLFAFFAFLLFLFIKKIRRRSE
>NZ_CP011829.1|WP_002311533.1|50100_50928_-|hypothetical-protein
MNKRKWLFVCVAALFATAAYSQISFADSSTTPTTSQTTDSSTTATSDTDSSKNTAEETADSSTSSTESAESTSESSSETSEKLQEVEDTQVIKQNIHIQKIISSNRINNQGRQVAHQEGVNGAKFIVYDITNILEEMTQDDNEKNQSVEIIESKLKDRAKKLSYDQLKKVTEGETKTIDDQEGVIDFSIEVPANKKQAYYIVNESSPENISNSEDIILLTPISDEKGEFLTDVWLYPKSKKSEPKEEIKKVVSTGVKKNFFDNCWDFFTHLFFND
>NZ_CP011829.1|WP_061573552.1|61719_62679_+|IS30-like-element-IS6770-family-transposase
MTYKHLTIDELTMIESYYLQHNKPVEIANRMGRAIQTIYNVVNKFKQGKTALDYWHQYKENKKKCGRKVIQLPAHEVDYIKEKVTLGWTPDVIIGRKERPVSCGMRTLYRLFSKGIFDIDTLPMKGKRKPNGHQEKRGKQQYQRSIHDRPDNYPDFNSEFGHLEDDTIVGIHHKSAVITLVERLSKVIITIKPNGRKALDIETALNQWFSRFPKNFFKSITFDCGKEFSNWKAISNQHDIDIYFADPGTPSQRPLNENSNGILRRNGLPKSMDFREVNQTFISSVSNQRNHIPRESLNYRTPIEIFLSYVQEAFYSSLI
>NZ_CP011829.1|WP_002348857.1|63270_63465_+|hypothetical-protein
MMGFFLRFYIIELTGRLTVFFGNFAIKPFAEVTAHYICKWLDCKNKIKKVFHYISSSPCQIRPG
>NZ_CP011829.1|WP_002290397.1|64208_64463_+|AbrB-family-transcriptional-regulator
MGKELKVRKIGNSVGVILPSSLGLKSGDTIQAKQEGNLFILDTTQIAKEHDRKLIEESFQDFEKGLTVSEIEMVKAFGKYGWSE
>NZ_CP011829.1|WP_002290394.1|64463_64781_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MKEYTLVYSKSFQTSLETIIEEWENELALSPASIKRFVGAIQKALELTKNFPTMHEEVSEIYGMDIPTYRIVIGKSYALFYRIDHEKKEILVGRIFQSKQMKLGF
>NZ_CP011829.1|WP_002287525.1|65312_66461_-|transposase
MEQLKAYKFRIYPTEEQEIFFAKSFGCVRKVYNLMLDDRKKAYEEVKNDSSKKMTFPTPAKYKKEFPFLKEIDSLALANAQLNLDKAYKNFFRDKSVGFPRFKSKKNPVQSYTTNNQNGTVALIDSKFIKVPKLKSLVRIKLHRQPKGIIKSATISRHSSGKYYISLLCKEEIIELPKTNSTIGIDLGIMDFAILSDGQKIDNNKFTSKMEKKLKREQRKLSRRALLAKNKGTNLFEAKNYQKQKRKVARLHEKVMNQRTDFLNKLSTEMIKNHDIICIEDLNTKGMLRNHKLAKSISDVSWSKFVTKLQYKADWYGRKIIKVDKWFPSSQICSECGHKDGKKSLEIREWTCPVCHTHHDRDINASINILTEGLRLHSMGLA
>NZ_CP011829.1|WP_002287522.1|66477_66882_-|IS200/IS605-like-element-ISEfa4-family-transposase
MELDTNNHSVFLLYYHLVLVTKYRRQVIDDEISDYAKTTFERISESYHITLVEWNHDKDHVHIMFKAQPKTELTKFINAYKSASSRLIKRDFPRVKQFLWKEMFWSKSFCLLTTGGAPIDVIKKYIQNQGNNHK
>NZ_CP011829.1|WP_112009138.1|67216_68379_+|IS3-family-transposase
MSKRTRRTFSQEFKQQIVNLYLAGKPRVEIIREYELTASAFDKWVKQSKTSGSFKEKDNPTPEQKELLELRKRNQQLEMENDILKQAALIFGPKRQVIDANKHLYPISAMCRILGLSRQSYYYQSKPKKDESELEEAVAEEFIRSRKAHGSRKIKKALSKRGIQISRRKISRIMKNRGLKSSYTVAYFKVHHSTCNEAKTTNVLNRKFLRDNPLEAIVTDLTYVRVGKKWNYVYFILDLFNREILGYSCGEHKDAVLVKKAFSRIKQPLTEVEIFHTDRGKEFDNQAIDELLTTFDINRSLSHKGCPFDNAVAESTYKSLKVEFVYQYTFETLQQLDLELFDYVNWWNHLRLHGTLGYETPVGYRNQRLAQRILDNELGCANASEAV
>NZ_CP011829.1|WP_002307629.1|68572_68839_+|YfhO-family-protein
MTSTYASFDKDNLYYDFPSVSGFSSMNNKKYLLMLTRLGYSTSNVRAKRNGGTVITDILLSNQYQVIPNQEIQHQATSGVKIIESEVS
>NZ_CP011829.1|WP_002307630.1|68920_69217_+|hypothetical-protein
MANNLHYVTNLESRQFDPCWHQIDAQTKELLLGWEENQVVRDFSLNFIMIDYYNLATSMQRFPNYGMDIDSFKQKSFSGEIQNEESNNLVIPILYEPG
>NZ_CP011829.1|WP_002295288.1|69226_69433_+|hypothetical-protein
MDGEEYPYKVAFDDLIQLSNLPKDSNMKIAGEFFAPGFLVGLVISSIATGCFLFLLFLDYIKKTEDIP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP011282	Enterococcus faecium strain E39 plasmid p1, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	221216-221254	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	452-490	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	244126-244164	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP043485	Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence	27883-27921	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	96547-96585	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	454-492	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	95092-95130	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	358205-358243	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	119937-119975	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	111370-111408	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	126934-126972	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	153621-153659	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	129212-129250	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	71269-71307	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	249118-249156	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP017798	Enterococcus faecium strain E243 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135180	Enterococcus faecium isolate E0595 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	107198-107236	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	91402-91440	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	102426-102464	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	1397-1435	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	60362-60400	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR132068	Enterococcus faecium isolate E0139 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	97677-97715	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	52637-52675	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	102651-102689	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	200630-200668	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP040877	Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence	56543-56581	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	65333-65371	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	67328-67366	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP017793	Enterococcus faecium strain E240 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	14572-14610	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	178898-178936	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NC_017963	Enterococcus faecium DO plasmid 3, complete sequence	33082-33120	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP040850	Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence	105709-105747	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	39887-39925	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP037956	Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence	35165-35203	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	225612-225650	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	92046-92084	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	17089-17127	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	86167-86205	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	61653-61691	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	5084-5122	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	177278-177316	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	244126-244164	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	LR135186	Enterococcus faecium isolate E4413 genome assembly, plasmid: 2	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	192113-192151	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	453-491	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	168263-168301	0	1.0
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP027401	Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence	109448-109486	1	0.974
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	453-491	1	0.974
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_LR134096	Enterococcus faecium isolate E1334 plasmid 2	453-491	1	0.974
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	47629-47667	1	0.974
NZ_CP011829_1	1.2\|60362\|39\|NZ_CP011829\|CRISPRCasFinder	60362-60400	39	NZ_CP012367	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence	3358-3396	4	0.897

1. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP011282 (Enterococcus faecium strain E39 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

2. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

3. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

4. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

5. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

6. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP043485 (Enterococcus faecium strain DMEA02 plasmid pDMEA1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

7. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

8. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

9. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

10. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

11. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

12. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP018073 (Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

13. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

14. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

15. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

16. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

17. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

18. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

19. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

20. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

21. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

22. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

23. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

24. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

25. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

26. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

27. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

28. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

29. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

30. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

31. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

32. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

33. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

34. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

35. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

36. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

37. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

38. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP017798 (Enterococcus faecium strain E243 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

39. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

40. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

41. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

42. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

43. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

44. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135180 (Enterococcus faecium isolate E0595 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

45. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

46. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

47. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

48. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

49. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

50. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

51. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

52. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

53. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

54. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

55. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

56. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

57. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

58. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

59. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

60. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

61. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

62. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

63. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

64. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

65. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

66. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR132068 (Enterococcus faecium isolate E0139 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

67. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

68. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

69. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

70. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

71. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

72. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

73. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

74. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

75. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP040877 (Enterococcus faecium strain HB-1 plasmid punnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

76. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

77. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

78. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

79. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP017793 (Enterococcus faecium strain E240 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

80. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

81. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

82. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

83. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

84. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

85. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

86. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

87. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NC_017963 (Enterococcus faecium DO plasmid 3, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

88. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

89. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP040850 (Enterococcus faecium strain F17E0263 plasmid p_unnamned1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

90. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

91. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

92. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

93. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

94. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP037956 (Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

95. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

96. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

97. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

98. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

99. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

100. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

101. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

102. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

103. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

104. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

105. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

106. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

107. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

108. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to LR135186 (Enterococcus faecium isolate E4413 genome assembly, plasmid: 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

109. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

110. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

111. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

112. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

113. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 0, identity: 1.0

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgagggtg	Protospacer
***************************************

114. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP027401 (Enterococcus faecium strain FDAARGOS_323 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgcctgatttttcgtcgagggtg	Protospacer
******************.********************

115. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgcctgatttttcgtcgagggtg	Protospacer
******************.********************

116. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_LR134096 (Enterococcus faecium isolate E1334 plasmid 2) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgcctgatttttcgtcgagggtg	Protospacer
******************.********************

117. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 1, identity: 0.974

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
gccccaagggattcagcgtctgatttttcgtcgaggatg	Protospacer
************************************.**

118. spacer 1.2|60362|39|NZ_CP011829|CRISPRCasFinder matches to NZ_CP012367 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence) position: , mismatch: 4, identity: 0.897

gccccaagggattcagcgtctgatttttcgtcgagggtg	CRISPR spacer
agccccaaggattcagcgtctgatttttcgtcgagggtg	Protospacer
. *** *.*******************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

987 : 53667

Streptococcus_phage(33.33%)

holin,transposase,bacteriocin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002300843.1\|987_2508_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.1e-48	31.6
WP_002300842.1\|2694_3267_-	SIS domain-containing protein	NA	NA	NA	NA
WP_002300841.1\|3273_3936_-	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_002300840.1\|3951_4467_-	YjbQ family protein	NA	NA	NA	NA
WP_002300838.1\|4468_4753_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002300836.1\|4786_6115_-	PTS galactitol transporter subunit IIC	NA	NA	NA	NA
WP_002300835.1\|6128_6584_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_002300833.1\|6586_8533_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_000997695.1\|8921_10100_-\|transposase	IS256-like element ISEf1 family transposase	A0A220NQR7	Corynebacterium_phage	3.0e-30	25.6
WP_002300807.1\|10471_10735_-\|bacteriocin	uberolysin/carnocyclin family circular bacteriocin	NA	NA	NA	NA
WP_000222572.1\|10855_11809_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.7e-34	35.8
WP_002311569.1\|12777_13134_-	hypothetical protein	NA	NA	NA	NA
WP_002300804.1\|13192_13372_-	hypothetical protein	NA	NA	NA	NA
WP_002300801.1\|13816_14089_-	hypothetical protein	NA	NA	NA	NA
WP_002300799.1\|14098_14254_-	hypothetical protein	NA	NA	NA	NA
WP_002300797.1\|14269_14521_-	hypothetical protein	NA	NA	NA	NA
WP_002305810.1\|14520_14727_-	hypothetical protein	NA	NA	NA	NA
WP_002305809.1\|15169_15394_-	hypothetical protein	NA	NA	NA	NA
WP_002295624.1\|15583_15706_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_002295625.1\|15864_16122_-	hypothetical protein	NA	NA	NA	NA
WP_002301800.1\|16631_17531_-	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_002299811.1\|17543_18140_-	type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein	NA	NA	NA	NA
WP_002295632.1\|18220_18370_-	hypothetical protein	NA	NA	NA	NA
WP_002303486.1\|18485_20495_-	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	1.6e-111	52.6
WP_002313123.1\|20505_21975_-	toprim domain-containing protein	NA	NA	NA	NA
WP_002317424.1\|22035_24408_-	hypothetical protein	B5SP25	Lactococcus_phage	1.8e-13	32.5
WP_002330536.1\|24817_26068_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	3.0e-113	63.3
WP_002322479.1\|26203_26398_-	hypothetical protein	NA	NA	NA	NA
WP_002296380.1\|26543_26879_-	hypothetical protein	NA	NA	NA	NA
WP_002296379.1\|26899_28492_-	hypothetical protein	NA	NA	NA	NA
WP_002296378.1\|28510_28933_-	hypothetical protein	NA	NA	NA	NA
WP_002296377.1\|28934_29231_-	hypothetical protein	NA	NA	NA	NA
WP_002305788.1\|29462_29732_-	hypothetical protein	NA	NA	NA	NA
WP_002296375.1\|29775_30849_-	DUF4199 domain-containing protein	NA	NA	NA	NA
WP_002317425.1\|31121_31928_-	hypothetical protein	NA	NA	NA	NA
WP_002311547.1\|31938_32583_-	hypothetical protein	NA	NA	NA	NA
WP_061573551.1\|32598_33804_-	glucosaminidase domain-containing protein	Q6SEC2	Lactobacillus_prophage	1.5e-32	41.8
WP_002317427.1\|33803_35828_-	hypothetical protein	NA	NA	NA	NA
WP_002317428.1\|35990_36584_-	hypothetical protein	NA	NA	NA	NA
WP_002295656.1\|36584_36917_-	hypothetical protein	NA	NA	NA	NA
WP_002332868.1\|36968_39341_-	hypothetical protein	NA	NA	NA	NA
WP_010725834.1\|39337_41947_-	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_002317430.1\|41946_44010_-	hypothetical protein	NA	NA	NA	NA
WP_002295662.1\|44079_44382_-	hypothetical protein	NA	NA	NA	NA
WP_002305229.1\|44399_44642_-	DUF5415 family protein	NA	NA	NA	NA
WP_002311541.1\|44638_45097_-	hypothetical protein	NA	NA	NA	NA
WP_002311538.1\|45284_45494_+	hypothetical protein	NA	NA	NA	NA
WP_002311537.1\|45613_47665_+	FIVAR domain-containing protein	NA	NA	NA	NA
WP_002311535.1\|47700_49800_-	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
WP_002311534.1\|49842_50091_-	hypothetical protein	NA	NA	NA	NA
WP_002311533.1\|50100_50928_-	hypothetical protein	NA	NA	NA	NA
WP_002311532.1\|50924_51680_-	class C sortase	NA	NA	NA	NA
WP_002311530.1\|52123_53242_-\|transposase	transposase	A0A286QMQ9	Streptococcus_phage	1.1e-95	50.8
WP_002311528.1\|53265_53667_-\|transposase	IS200/IS605 family transposase	Q332K6	Clostridium_botulinum_C_phage	6.9e-43	62.4

DBSCAN-SWA_2

61719 : 109781

Bacillus_phage(29.41%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061573552.1\|61719_62679_+\|transposase	IS30-like element IS6770 family transposase	W5R8L2	Staphylococcus_phage	5.1e-36	36.1
WP_002348857.1\|63270_63465_+	hypothetical protein	NA	NA	NA	NA
WP_002290397.1\|64208_64463_+	AbrB family transcriptional regulator	NA	NA	NA	NA
WP_002290394.1\|64463_64781_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_002287525.1\|65312_66461_-\|transposase	transposase	A0A288TXV8	Enterococcus_phage	1.2e-204	93.4
WP_002287522.1\|66477_66882_-\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8
WP_112009138.1\|67216_68378_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	3.3e-77	50.5
WP_002307629.1\|68572_68839_+	YfhO family protein	NA	NA	NA	NA
WP_002307630.1\|68920_69217_+	hypothetical protein	NA	NA	NA	NA
WP_002295288.1\|69226_69433_+	hypothetical protein	NA	NA	NA	NA
WP_080447711.1\|70445_72089_-	peptidoglycan DD-metalloendopeptidase family protein	V5R8R0	Arthrobacter_phage	1.9e-14	39.7
WP_002307641.1\|72347_72755_+	NusG domain II-containing protein	NA	NA	NA	NA
WP_002328342.1\|72933_74217_+	hypothetical protein	NA	NA	NA	NA
WP_002328849.1\|74927_76478_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	2.8e-92	38.1
WP_002325573.1\|76591_76771_-	DUF2933 domain-containing protein	NA	NA	NA	NA
WP_002307648.1\|76773_76998_-	DUF2933 domain-containing protein	NA	NA	NA	NA
WP_002294779.1\|76981_77785_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_002307650.1\|77940_78555_+	TIGR01906 family membrane protein	NA	NA	NA	NA
WP_002294786.1\|80518_80743_+	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_002375819.1\|80753_82337_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_002294790.1\|82364_83045_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.8e-36	37.4
WP_002307657.1\|83044_84439_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	7.2e-39	32.8
WP_002307659.1\|84453_84660_+	hypothetical protein	NA	NA	NA	NA
WP_002316691.1\|84680_85277_+	YdhK family protein	NA	NA	NA	NA
WP_104681286.1\|86324_87451_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	1.9e-74	53.7
WP_002294574.1\|88061_88517_+	copper-responsive transcriptional repressor TcrY	NA	NA	NA	NA
WP_002346959.1\|88529_90995_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	9.6e-103	35.4
WP_002335389.1\|91079_91286_+	copper chaperone TcrZ	NA	NA	NA	NA
WP_002346660.1\|91424_93557_+	copper-translocating P-type ATPase TcrB	E4ZFI9	Streptococcus_phage	2.3e-60	29.4
WP_002287920.1\|93781_94462_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	7.6e-127	99.1
WP_002292678.1\|94705_95035_+	AbrB family transcriptional regulator	NA	NA	NA	NA
WP_010722134.1\|95024_95312_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_002292680.1\|95597_96455_+	ParA family protein	F0PIG8	Enterococcus_phage	8.1e-33	30.7
WP_002292681.1\|96455_97004_+	hypothetical protein	NA	NA	NA	NA
WP_002295679.1\|97263_97992_+	peptidase	A0A1B0T6A2	Bacillus_phage	3.1e-09	26.1
WP_002326175.1\|98021_99149_+	S8 family serine peptidase	A0A217EQY2	Bacillus_phage	1.1e-13	33.5
WP_010780430.1\|101675_102671_+	2-dehydro-3-deoxygalactonokinase	NA	NA	NA	NA
WP_049142559.1\|102675_103302_+	2-dehydro-3-deoxy-phosphogluconate aldolase	NA	NA	NA	NA
WP_060810755.1\|103695_104703_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_016922317.1\|105169_106576_+	6-phospho-beta-galactosidase	A0A0B5JD41	Pandoravirus	3.4e-44	30.2
WP_060810756.1\|106598_106922_+	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_010780435.1\|106932_108615_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002343723.1\|108821_109781_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	9.7e-19	27.2

DBSCAN-SWA_3

127592 : 187152

Staphylococcus_phage(21.43%)

integrase,transposase

attL 146885:146902|attR 192960:192977

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002324630.1\|127592_128783_-\|transposase	IS256-like element ISLgar5 family transposase	A0A0N9STL0	Staphylococcus_phage	4.3e-24	28.4
WP_002326561.1\|128929_130018_+	hypothetical protein	NA	NA	NA	NA
WP_080447712.1\|131073_131250_+	foldase PrsA domain protein	NA	NA	NA	NA
WP_002326565.1\|131373_132234_-	aldose 1-epimerase	NA	NA	NA	NA
WP_002287525.1\|132378_133527_-\|transposase	transposase	A0A288TXV8	Enterococcus_phage	1.2e-204	93.4
WP_002287522.1\|133543_133948_-\|transposase	IS200/IS605-like element ISEfa4 family transposase	A0A286QN76	Streptococcus_phage	1.3e-52	73.8
WP_002328395.1\|134290_134956_-	beta-phosphoglucomutase	M1H9H9	Acanthocystis_turfacea_Chlorella_virus	1.8e-11	27.8
WP_002328394.1\|134948_137243_-	glycoside hydrolase family 65 protein	NA	NA	NA	NA
WP_002328393.1\|137524_139687_+	PTS transporter subunit EIIC	A0A2I7SAJ6	Vibrio_phage	4.3e-06	41.1
WP_002328392.1\|139899_140724_+	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_002291320.1\|141044_141206_-	hypothetical protein	NA	NA	NA	NA
WP_002325884.1\|142530_143484_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.3e-34	36.1
WP_061573554.1\|145766_146342_-	hypothetical protein	NA	NA	NA	NA
WP_061573555.1\|146883_147294_+	arsenate reductase (thioredoxin)	A0A2H4PQT9	Staphylococcus_phage	4.3e-32	51.1
146885:146902	attL	NA	NA	NA	NA
WP_137277835.1\|147712_148807_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_061573578.1\|149259_150099_+	hypothetical protein	NA	NA	NA	NA
WP_061573557.1\|150114_150717_+	hypothetical protein	NA	NA	NA	NA
WP_061573558.1\|150706_152983_+	AAA family ATPase	NA	NA	NA	NA
WP_061573559.1\|153129_153819_+	AAA family ATPase	NA	NA	NA	NA
WP_010719963.1\|154607_155339_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_061573560.1\|155351_156524_+	SIS domain-containing protein	NA	NA	NA	NA
WP_061573561.1\|156546_157554_+	tagatose-bisphosphate aldolase	NA	NA	NA	NA
WP_061573562.1\|157565_158504_+	hexose kinase	NA	NA	NA	NA
WP_010738366.1\|159337_161116_+	beta-galactosidase	NA	NA	NA	NA
WP_010719958.1\|161119_161599_+	PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB	NA	NA	NA	NA
WP_061573563.1\|161611_162508_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_010719956.1\|162494_163304_+	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_010719955.1\|163341_163746_+	PTS fructose transporter subunit IIA	NA	NA	NA	NA
WP_061573579.1\|164218_165100_-	response regulator transcription factor	NA	NA	NA	NA
WP_061573566.1\|165425_166445_+	putrescine carbamoyltransferase	M1HWF9	Paramecium_bursaria_Chlorella_virus	1.1e-15	26.1
WP_061573567.1\|167948_168353_+	organic hydroperoxide resistance protein	NA	NA	NA	NA
WP_002292292.1\|168515_169559_+	hypothetical protein	NA	NA	NA	NA
WP_061573568.1\|169573_170137_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_002327891.1\|170332_171511_-\|transposase	IS256-like element ISEfm2 family transposase	A0A220NQR7	Corynebacterium_phage	4.4e-29	25.2
WP_010829815.1\|171788_171980_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_061573569.1\|171960_173457_+	N-6 DNA methylase	A0A076FHE5	Aureococcus_anophage	2.8e-12	26.3
WP_010731541.1\|173456_174542_+	DNA cytosine methyltransferase	A0A1P8CX13	Bacillus_phage	8.9e-45	46.0
WP_061573570.1\|174628_177166_+	BpuSI family type II restriction endonuclease	NA	NA	NA	NA
WP_002296569.1\|177490_178000_+	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	2.8e-17	34.8
WP_002326131.1\|178190_178751_+	hypothetical protein	NA	NA	NA	NA
WP_002291914.1\|179201_180140_+	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_002291912.1\|180152_181205_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_148654935.1\|182573_182918_+	hypothetical protein	NA	NA	NA	NA
WP_002311756.1\|183519_184125_+	Fic family protein	NA	NA	NA	NA
WP_061573572.1\|184546_185455_-\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002290383.1\|185951_186506_+\|integrase	tyrosine-type recombinase/integrase	W8CYP1	Bacillus_phage	8.6e-36	46.1
WP_002290382.1\|186678_187152_-\|integrase	tyrosine-type recombinase/integrase	A0A097PAS9	Streptococcus_pyogenes_phage	2.3e-13	44.2
192960:192977	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP011830

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 7930

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_193394793.1\|0_261_-	hypothetical protein	E4ZFP3	Streptococcus_phage	1.3e-34	100.0
WP_072387101.1\|371_779_-	WYL domain-containing protein	A0A1B0RXM3	Streptococcus_phage	1.1e-59	98.3
WP_001079938.1\|751_1324_-	HTH domain-containing protein	A0A1B0RXM1	Streptococcus_phage	5.5e-102	99.5
WP_061573581.1\|1599_2394_-	aminoglycoside O-phosphotransferase APH(3')-IIIa	E4ZFP6	Streptococcus_phage	8.6e-154	99.6
WP_000627290.1\|2486_3029_-	streptothricin N-acetyltransferase Sat4	A0A1B0RXL7	Streptococcus_phage	8.9e-94	100.0
WP_001255866.1\|3025_3934_-	aminoglycoside nucleotidyltransferase ANT(6)-Ia	E4ZFP8	Streptococcus_phage	2.8e-177	100.0
WP_000662263.1\|3966_4701_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.5e-141	100.0
WP_000228166.1\|4681_5551_-	nucleotidyltransferase domain-containing protein	A0A1X9I6C9	Streptococcus_phage	4.3e-159	95.8
WP_000567888.1\|5653_5899_-	single-stranded DNA-binding protein	NA	NA	NA	NA
WP_002292226.1\|7192_7930_-	23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	1.4e-134	99.6

DBSCAN-SWA_2

23327 : 33260

Bacillus_phage(37.5%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000222573.1\|23327_24287_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.0e-32	36.1
WP_000053907.1\|24310_24607_-	replication control protein PrgN	NA	NA	NA	NA
WP_000947691.1\|24741_26235_-	primase C-terminal domain-containing protein	NA	NA	NA	NA
WP_000429439.1\|26846_27800_+	ParA family protein	F0PIG8	Enterococcus_phage	7.7e-16	26.1
WP_001196543.1\|27771_28047_+	hypothetical protein	NA	NA	NA	NA
WP_000199136.1\|28239_28494_+\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	2.1e-13	47.6
WP_002322130.1\|28604_28859_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	4.1e-09	50.0
WP_086953888.1\|28899_30061_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_073120187.1\|30162_30735_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	5.0e-55	57.1
WP_000170424.1\|31207_31780_-	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	6.8e-36	46.0
WP_000599739.1\|31795_32401_-	cell filamentation protein	NA	NA	NA	NA
WP_001015311.1\|32579_33260_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP011828

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP011828_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011828_1

530234-530343

Orphan

Consensus_repeat	Method
TGATGAACAATACTGGTTGAGCAAAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP011828_1

>merge|NZ_CP011828|1|530234-530343|CRISPRCasFinder
TGATGAACAATACTGGTTGAGCAAAGCGAAAGGAGTTTCCTTTCGAGCAAAGCGAGTAGAATCACTATGAACGAAGTGAATAGGTGATGAATAATACTGGTTGAGCAAAG

>NZ_CP011828|1|1|530234-530343|CRISPRCasFinder
TGATGAACAATACTGGTTGAGCAAAG	CGAAAGGAGTTTCCTTTCGAGCAAAGCGAGTAGAATCACTATGAACGAAGTGAATAGG
TGATGAATAATACTGGTTGAGCAAAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011828.1\|WP_002294583.1\|525784_526804_+\|alpha-hydroxy-acid-oxidizing-protein	unknown	unknown	gnl\|CDD\|240088
NZ_CP011828.1\|WP_002287788.1\|537378_538092_+\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NZ_CP011828.1\|WP_002294580.1\|524102_524648_+\|transcription-termination/antitermination-protein-NusG	unknown	unknown	gnl\|CDD\|180161
NZ_CP011828.1\|WP_002287787.1\|536423_537125_+\|glucosamine-6-phosphate-deaminase	unknown	unknown	gnl\|CDD\|238693
NZ_CP011828.1\|WP_002294588.1\|530971_531340_+\|50S-ribosomal-protein-L7/L12	unknown	unknown	gnl\|CDD\|234671
NZ_CP011828.1\|WP_002287791.1\|538400_539540_+\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NZ_CP011828.1\|WP_002294585.1\|527779_528448_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	unknown	unknown	gnl\|CDD\|224674
NZ_CP011828.1\|WP_002290558.1\|534657_536190_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP011828.1\|WP_002294579.1\|523831_524002_+\|preprotein-translocase-subunit-SecE	unknown	unknown	gnl\|CDD\|376355
NZ_CP011828.1\|WP_002294584.1\|526894_527767_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	unknown	unknown	gnl\|CDD\|129801
NZ_CP011828.1\|WP_002294578.1\|523655_523808_+\|50S-ribosomal-protein-L33	unknown	unknown	gnl\|CDD\|234783
NZ_CP011828.1\|WP_002287792.1\|539628_540594_-\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	unknown	unknown	gnl\|CDD\|275027
NZ_CP011828.1\|WP_002294577.1\|522849_523494_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341358
NZ_CP011828.1\|WP_002320938.1\|532216_533266_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
NZ_CP011828.1\|WP_002291634.1\|530415_530919_+\|50S-ribosomal-protein-L10	unknown	unknown	gnl\|CDD\|234632
NZ_CP011828.1\|WP_002291638.1\|528790_529213_+\|50S-ribosomal-protein-L11	unknown	unknown	gnl\|CDD\|234661
NZ_CP011828.1\|WP_002289897.1\|524706_525612_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|283645
NZ_CP011828.1\|WP_002295743.1\|533359_534268_+\|IS982-like-element-ISEfm1-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_CP011828.1\|WP_002294587.1\|529316_530006_+\|50S-ribosomal-protein-L1	unknown	unknown	gnl\|CDD\|180071
NZ_CP011828.1\|WP_002296327.1\|531445_532135_+\|TVP38/TMEM64-family-protein	unknown	unknown	gnl\|CDD\|223475

Protein	Function_ID	Function_description	E-value
NZ_CP011828.1\|WP_002294583.1\|525784_526804_+\|alpha-hydroxy-acid-oxidizing-protein	gnl\|CDD\|240088	cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-binding domain. LOX is a member of the family of FMN-containing alpha-hydroxyacid oxidases and catalyzes the oxidation of l-lactate using molecular oxygen to generate pyruvate and H2O2. This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO).	0
NZ_CP011828.1\|WP_002287788.1\|537378_538092_+\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	6.15701e-49
NZ_CP011828.1\|WP_002294580.1\|524102_524648_+\|transcription-termination/antitermination-protein-NusG	gnl\|CDD\|180161	PRK05609, nusG, transcription antitermination protein NusG; Validated.	1.97252e-86
NZ_CP011828.1\|WP_002287787.1\|536423_537125_+\|glucosamine-6-phosphate-deaminase	gnl\|CDD\|238693	cd01399, GlcN6P_deaminase, GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium. The reaction is an aldo-keto isomerization coupled with an amination or deamination. It is the last step of the metabolic pathway of N-acetyl-D-glucosamine-6-phosphate (GlcNAc6P). GlcN6P deaminase is a hexameric enzyme that is allosterically activated by GlcNAc6P.	8.8122e-119
NZ_CP011828.1\|WP_002294588.1\|530971_531340_+\|50S-ribosomal-protein-L7/L12	gnl\|CDD\|234671	PRK00157, rplL, 50S ribosomal protein L7/L12; Reviewed.	5.30333e-45
NZ_CP011828.1\|WP_002287791.1\|538400_539540_+\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	2.06838e-61
NZ_CP011828.1\|WP_002294585.1\|527779_528448_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	gnl\|CDD\|224674	COG1760, SdaA, L-serine deaminase [Amino acid transport and metabolism].	1.41351e-73
NZ_CP011828.1\|WP_002290558.1\|534657_536190_-\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	5.56109e-170
NZ_CP011828.1\|WP_002294579.1\|523831_524002_+\|preprotein-translocase-subunit-SecE	gnl\|CDD\|376355	pfam00584, SecE, SecE/Sec61-gamma subunits of protein translocation complex. SecE is part of the SecYEG complex in bacteria which translocates proteins from the cytoplasm. In eukaryotes the complex, made from Sec61-gamma and Sec61-alpha translocates protein from the cytoplasm to the ER. Archaea have a similar complex.	1.48e-13
NZ_CP011828.1\|WP_002294584.1\|526894_527767_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	gnl\|CDD\|129801	TIGR00718, Probable_L-serine_dehydratase_alpha_chain, L-serine dehydratase, iron-sulfur-dependent, alpha subunit. This enzyme is also called serine deaminase. L-serine dehydratase converts serine into pyruvate in the gluconeogenesis pathway from serine. This model describes the alpha chain of an iron-sulfur-dependent L-serine dehydratase, found in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of alpha chains from the homologous region of single chain forms such as found in Escherichia coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	2.63238e-103
NZ_CP011828.1\|WP_002294578.1\|523655_523808_+\|50S-ribosomal-protein-L33	gnl\|CDD\|234783	PRK00504, rpmG, 50S ribosomal protein L33; Validated.	3.12722e-17
NZ_CP011828.1\|WP_002287792.1\|539628_540594_-\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	gnl\|CDD\|275027	TIGR04171, ribonucleotide-diphosphate_reductase_subunit_beta, ribonucleoside-diphosphate reductase, class 1b, beta subunit. Members of this family are NrdF, the beta subunit of class 1b ribonucleotide reductase. This form uses a dimanganese moiety associated with a tyrosine radical to reduce the cellular requirement for iron. [Purines, pyrimidines, nucleosides, and nucleotides, 2'-Deoxyribonucleotide metabolism].	0
NZ_CP011828.1\|WP_002294577.1\|522849_523494_-\|CBS-domain-containing-protein	gnl\|CDD\|341358	cd02205, CBS_pair_SF, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains superfamily. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	5.69774e-14
NZ_CP011828.1\|WP_002320938.1\|532216_533266_+\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.96069e-56
NZ_CP011828.1\|WP_002291634.1\|530415_530919_+\|50S-ribosomal-protein-L10	gnl\|CDD\|234632	PRK00099, rplJ, 50S ribosomal protein L10; Reviewed.	3.03735e-67
NZ_CP011828.1\|WP_002291638.1\|528790_529213_+\|50S-ribosomal-protein-L11	gnl\|CDD\|234661	PRK00140, rplK, 50S ribosomal protein L11; Validated.	9.059e-96
NZ_CP011828.1\|WP_002289897.1\|524706_525612_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|283645	pfam06028, DUF915, Alpha/beta hydrolase of unknown function (DUF915). This family consists of several bacterial proteins of unknown function. Members of this family have an alpha/beta hydrolase fold.	9.73807e-81
NZ_CP011828.1\|WP_002295743.1\|533359_534268_+\|IS982-like-element-ISEfm1-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	2.39418e-18
NZ_CP011828.1\|WP_002294587.1\|529316_530006_+\|50S-ribosomal-protein-L1	gnl\|CDD\|180071	PRK05424, rplA, 50S ribosomal protein L1; Validated.	1.66496e-146
NZ_CP011828.1\|WP_002296327.1\|531445_532135_+\|TVP38/TMEM64-family-protein	gnl\|CDD\|223475	COG0398, COG0398, Uncharacterized conserved protein [Function unknown].	2.9371e-19

>NZ_CP011828.1|WP_002294587.1|529316_530006_+|50S-ribosomal-protein-L1
MAKKSKKMQDALKKVDSSKVYPVAEAVALAKETNIAKFDATVEVAYRLNVDPKKADQQIRGAVVLPNGTGKTQTVLVFAKGDKAKEAEAAGADFVGDDDMVQKIQNGWFDFDVVVATPDMMATVGRLGRVLGPKGLMPNPKTGTVTMDVTKAVNEVKAGKVTYRVDKAGNIHVPIGKVSFDDEKLVENFAAIHDVLLKAKPSAAKGQYMKNVTITTTFGPGIHVDQASF
>NZ_CP011828.1|WP_002291638.1|528790_529213_+|50S-ribosomal-protein-L11
MAKKVEKIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGLIIPVVISVYEDRSFTFVTKTPPAAVLLKKAAKIEKGSGEPNKNKVAKVSSDQVREIAELKMEDLNAANVEAAMRMVEGTARSMGITVE
>NZ_CP011828.1|WP_002294585.1|527779_528448_-|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta
MKDLRYRSVFDIIGPVMIGPSSSHTAGAARIGKIIRSIFGEQPDSVDIYLYESFAKTYRGHGTDIALVGGLLGMEPDDERLADSLKLAYEAGMEVLFVPKSEKAEHPNSVKMLLKKGTRKLSVTGISIGGGNIQISELNGFKISLSMGTPTLIVVHQDVPGMIAKVTSILSETNTNIGTMTVTRESKGENAIMIIEVDDPQVEETVKRLKQLPNIDSVNYFD
>NZ_CP011828.1|WP_002294584.1|526894_527767_-|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha
MFLSIEELVDQAKAYPSVAELMIAVEMEMSGRSRSHIIEIMEKNLSVMEQSINEGKEGVTSVTGITGGDAKKLDDYLNEADFLSGETILKAVRNAVAVNEVNAKMGLICATPTAGSAGVVPGVLMAVRDRLDLTHEQQLEFLFTAGAFGLVIANNASISGAEGGCQAEVGSASAMAAAALVCAKNGTPHQAAQAVAITLKNMMGLICDPVAGLVEVPCVKRNALGSSQAFISADMALAGIESVIPPDEVVAAMYQVGRQMPSIFKETAEGGLAVTPTAKRLAEEILNKRA
>NZ_CP011828.1|WP_002294583.1|525784_526804_+|alpha-hydroxy-acid-oxidizing-protein
MEAGAFGYIRGGSEDEWTMKENTTSFNTKKIMPRILRGIDSADLHTSVFGIELDTPIIQAPSAAQGLAHEKGEADTAKGVAAAGSIFSISTYANTTIKDAADAAPGAPQFFQLYMSKDDRFNEFILNKAVEAGAKAIILTADSTLGGYREEDVINQFQFPLPMPNLAAYSEQSASGNGEGKGIAEIYAAAKQGLTPDDIKTIKEITHLPVIVKGIQSPEDAVIAISAGADGIWVSNHGGRQLDGGPASFEVLPKIAEVVNKRVPVIFDSGVRRGEHVFKALASGADLVAIGRPVIYGLNLGGAEGVTSVFEHLNKELSITMQLAGTKTIDEVKNTKLMD
>NZ_CP011828.1|WP_002289897.1|524706_525612_+|alpha/beta-fold-hydrolase
MERKRCMTEPIKNLCKRATAAALVLISLFALSGCQTTKINTTEVSDKEKTAESSKVIEKTTIPTLFFHGYSGTENSFKGMLRRLEKNQQAVKELVLTVGTDGQIQATGDLSGKADNPMVQVLFEDNKNNEWNQAEWIKTCLLYLKENYGIDKVNIVGHSMGGVSALRYLGTYGQDTSLPQVQTLTAIGAPFNDFVDDSAQSLTDELAKGPAVVSNRYQDYQQMIGNIPITTRFFLIAGQLDETDLSDGTVPLNSALAVYALLKQRGNEIEEKVVTGENASHSMLHENQEVDQLVSRFIWKE
>NZ_CP011828.1|WP_002294580.1|524102_524648_+|transcription-termination/antitermination-protein-NusG
MESFEKNWYVLHTYSGYENKVKANIESRAQSMKMADFIFRVVVPEEKETEVKNGKEKEIVHKTFPGYVLVEMIMTDASWYVVRNTPGVTGFVGSHGAGSKPAPLLPEEVNHILRSIGMSLRQNDLEVEVGEVVKIIEGAFAGLEGQVTEVDGEKEKLKVNIDMFGRETSTELDFDQVDKID
>NZ_CP011828.1|WP_002294579.1|523831_524002_+|preprotein-translocase-subunit-SecE
MKFLKSVKDEIKQVTWPSRKQLRKDTLVVIETSIIFGLMFYVMDTAIQSLFGWILK
>NZ_CP011828.1|WP_002294578.1|523655_523808_+|50S-ribosomal-protein-L33
MAKKKAALACSVCGSRNYTKSVSEGKSGERLEINKFCKYCNQYTLHKETK
>NZ_CP011828.1|WP_002294577.1|522849_523494_-|CBS-domain-containing-protein
MLLKTLVYKKKDLTTVTETSTLEEALKILETSGYRCVPILDSSGNIFRGNIYKMHIYRHKANGGDMTLPVTHLLKNATKFIYLDTSFFKVFFTIKELPYIAVLDSENHFYGILTHSTLLNMLSQSWSVEQGSYVLTIASTGKQGDLAAIAKIISKHSSIASCITLDIEKDEYIRRTLITLPANTEAKVCETIVNHLEKKNYKVVEIENLQNQEA
>NZ_CP011828.1|WP_002291634.1|530415_530919_+|50S-ribosomal-protein-L10
MSEAIIAKKAAIVDEVSEKFTAAASVVVVDYRGLTVDEVTRLRKQLRDANVEMKVIKNSILSRAAKKAGLEGMDEVFTGPTAVAFSNEDVVAPAKIMDEFAKEAKALEIKGGIIEGKVSSLEEITALAKLPNREGLLSMLLSVLQAPVRNVAYAVKAVADKEDGDAA
>NZ_CP011828.1|WP_002294588.1|530971_531340_+|50S-ribosomal-protein-L7/L12
MALNIENIVAELKEATILELNDLVKAIEEEFGVSAAAPVAVAAAGGAAAAEEQTEFTVELTAAGDQKVKVIKAVREATGLGLKEAKAVVDGAPAPVKEGVSKEEAEELKAKLEEVGASVTVK
>NZ_CP011828.1|WP_002296327.1|531445_532135_+|TVP38/TMEM64-family-protein
MKKKIIRLMLISLGIILILVVGYRLYLEYQTDIQLFLNPRASKAELLAHIRSHGTFASILLIVLTAVMCAVPGIPTSVVGVIAGLSFGPLTGAIINILGNALGNITAIFLMHRLKFLDKKTETNHWVQAIRQMKHPKIGVMLGYMIPVIPSSMVNFAADAMKLPLQQIILSIVIGVIPSSVLYACGGEALFHGYNKTAVTLVASVTVLVGLVVFIYKDRKKKQGKQKHK
>NZ_CP011828.1|WP_002320938.1|532216_533266_+|MFS-transporter
MKSNEKTPLTTSLILLLSITCGVVVANMYYIQPIGTKVAASLSVSTSAVGILTMLTQLGYALGLLFLVPLGDVVDRPKLIIRMVALSAVSLLAAFFAPSFTLFACASFLIGLLSIVPQIIIPYGAVLAGPKARGKVMGTLLSGLLVGILLSRTVSGIVASLFSWRMIYLFALCAVGILTLLLYWKMPRSVQQSSTAVSYLDSLKSLPHLVASQRLLREAAVSGFFMFGTFSIFWSTLIFYISSPAYNWGTFEAGILAIFGLSGAVAAPIVGRLADSYSERKIVYMGLVMQTISFIALLVGGSHLAILLLAIILLDVGNQFGQVANQTRVQGLGEAASNRNNTVFTRGAS
>NZ_CP011828.1|WP_002295743.1|533359_534268_+|IS982-like-element-ISEfm1-family-transposase
MRSSKYTEHYTDTFITFKEIMRTVSNIYHNCVPDKIKNRRNTDQLKQRDTVIIACVIWGIINGYTSQRATYRAVCSVLFPNGDFPSRSRFTRLSSNLAYTIKIIRYFFIKKLTKGELVGIIDSFPSPLCKPVRNRQAKLLNQIAKVGYNSTKKSYFYGLKIHMIVTKTGFPITYSITNPGVHDVKVLETLSEEANLPNILGDKGYISHKIHEKLALKGITISVPPRKNMDKSEKLDHSLLGKQRKTVETVFSSLEKLGCQNFNSRSVKGLESRFESILLAYSVLLSRAQRRFEGTLRYSLGY
>NZ_CP011828.1|WP_002290558.1|534657_536190_-|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MSILTLNNITQQFGDKILYEGVDLQLNAGEHLGLIGQNGAGKSTLIKIITGEILPDDGQIHWQKNIHKGYLDQYVEVDETLTIEEFLKTAYAKEYEKEEKIAFLYQTYSETFDDSLLEKAGKLQTELDQGVFYQIDTLVAEMSSGLGIDVLGLDSLLKNLSGGQRSKVILAKLLLENPDVLILDEPTNHLDDQHIQWLTQFLQDFDGAYIVISHDQEFLDQITTHIADIEFGKITKYTGHLKQALKQKEQNRESYLRQYHAQQKQIEKTEAYIRKYKAGSRSTMAKSRQKQLDKIERLTPPASASKAVFDFPFSPIVTTLAVETTDLVIGYDRPLLAPINLTIRFGENIAIRGFNGIGKSTLLKTLIGEIEKISGDFHFPDNTKINYFSQDLYWENPLETPLQYLSSQFPKATIKELRRQLAKAGLVNQLASEPLTTLSGGEQTKVKLAQLTMNQGNLLILDEPTNHIDQETKESLQDGIQKFPGTVIIVSHEQEFYQDLVQRVIEIEPK
>NZ_CP011828.1|WP_002287787.1|536423_537125_+|glucosamine-6-phosphate-deaminase
MEIIRVKNAEEGGKKAFEIIKEGMNKGAKVLGLATGSTPVTLYKEMTSSDLDFSEMTSVNLDEYVGLGGSDEQSYRHFMDVQLFDKKPFKETFVPDGKAEDLEAACKKYDQIIDAHPIDIQILGIGQNGHIGFNEPGASFDGTTSVVDLTESTINANKRFFDKAEDVPTKAVSMGIGSIMKSKEIVLMAFGESKADAIKGMIEGPVTNHLPASVLQNHDNVVVIIDEEAASKL
>NZ_CP011828.1|WP_002287788.1|537378_538092_+|MgtC/SapB-family-protein
MNDMVLTIPEIILRLGIAMLFGGAIGFERQYKNRPAGMRTHILVCMGACIIALIQVEIASGALRDALEYPQLAGTIRSDEARLIAQVVSGVGFLGAGTIIVTKQSVTGLTTAASLWAIAGLGIAIGMGYYSIAIISFIGIAIALTVVKRVIHVPTTKKLEIQFIHRKETKDFLTDYFEEKNIVIEDVNFDVKFVDDYRVYKNIYTIDLPKGLTYADVIEELSVHKNITKLHLVSIAQ
>NZ_CP011828.1|WP_002287791.1|538400_539540_+|AI-2E-family-transporter
MQSRFKQSKLFFWTVELVLTIIGVYFILQMPNIFSPILKMLSAIFLPLLVAGFIYYMFDPIVVFLEKHRIPRVFGFLLTFLVVIILVVLTVMNVVPQLMEQTIQLTQSLPMYADETSKWLNELAQREEFKNFNLEEQLASANLSLSNLFNIILVSLSASVSKIISFMMQFFILLFTVPFILLFMFKDGHKFIDALSHFFPKAIRKELRQTVKELNETLSAYISSTILDALIIGVMSFLAMRIFDQPYSLLLAVICGITNIIPYVGPFIGAVPAIIVGLFISPFQALYMALSILVIQQLDGNLIKPLLFGKSMNIHPLTIILVLIGAGSVAGILGMLICIPVYAVIKTIILNIRKIYLLRRMEHVSEKLDSPKVLEETSE
>NZ_CP011828.1|WP_002287792.1|539628_540594_-|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta
MSETYYEAINWNEIEDIIDKSTWEKLTEQFWLDTRIPLSNDLDDWRTLSQLEKDTVGHVFGGLTLLDTVQSESGMDQLRKDVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKKEIEEIFDWTNTNPYLQKKAERINEIYKHGTPLEKKIASVFLETFLFYSGFYTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEAEQETLKDWMYNLLYELYENEERYTEELYDPIGWTEEVKTFLRYNANKALMNLGMDPLFPDTANDVNPIVMNGISTGTSNHDFFSQVGNGYLLGHVEAMKDDDYLIGLE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 5176

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289280.1\|1002_1269_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_061573545.1\|1778_3905_-	polyribonucleotide nucleotidyltransferase	NA	NA	NA	NA
WP_002289282.1\|4092_4362_-	30S ribosomal protein S15	NA	NA	NA	NA
WP_002289284.1\|4612_5176_+	peptide deformylase	E3SLL2	Synechococcus_phage	2.3e-12	37.1

DBSCAN-SWA_2

10157 : 10898

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002294240.1\|10157_10898_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.5e-30	39.7

DBSCAN-SWA_3

17063 : 27734

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289812.1\|17063_18065_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	2.3e-07	25.8
WP_002290528.1\|18077_18680_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_002294252.1\|18849_19296_-	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_002294254.1\|19371_20085_-	trehalose operon repressor	A0A291LID1	Streptomyces_phage	1.2e-05	39.7
WP_002297133.1\|20307_22296_+	PTS system trehalose-specific EIIBC component	NA	NA	NA	NA
WP_002294256.1\|22380_22941_-	septum formation inhibitor Maf	NA	NA	NA	NA
WP_061573432.1\|22962_25071_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	1.8e-57	41.1
WP_002297135.1\|25088_27734_-	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	3.6e-39	26.1

DBSCAN-SWA_4

33122 : 34992

Pneumococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002294268.1\|33122_33632_-	QueT transporter family protein	E7DN70	Pneumococcus_phage	7.5e-10	31.8
WP_002297929.1\|34012_34774_-	3-oxoacyl-ACP reductase	F2NZ40	Diadromus_pulchellus_ascovirus	1.2e-16	31.7
WP_002290506.1\|34770_34992_-	DUF2829 domain-containing protein	A0A0S2MV93	Bacillus_phage	1.1e-05	33.3

DBSCAN-SWA_5

38024 : 38759

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002290500.1\|38024_38759_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	1.4e-25	31.4

DBSCAN-SWA_6

48667 : 51322

Brazilian_cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297790.1\|48667_49423_-	ATP-binding cassette domain-containing protein	A0A2R8FG22	Brazilian_cedratvirus	2.2e-13	28.1
WP_002297789.1\|49419_50379_-	iron chelate uptake ABC transporter family permease subunit	NA	NA	NA	NA
WP_002297787.1\|50371_51322_-	iron chelate uptake ABC transporter family permease subunit	A0A2H4IY97	uncultured_Caudovirales_phage	5.6e-67	40.5

DBSCAN-SWA_7

59895 : 60582

Megavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287896.1\|59895_60582_-	ribonuclease III	K7YH73	Megavirus	9.1e-27	32.3

DBSCAN-SWA_8

64639 : 70307

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297777.1\|64639_65584_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.9e-20	35.1
WP_002287889.1\|65584_66589_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.1e-18	32.2
WP_002294295.1\|66856_67099_-	acyl carrier protein	NA	NA	NA	NA
WP_002289721.1\|67220_68222_-	phosphate acyltransferase PlsX	NA	NA	NA	NA
WP_061573438.1\|68270_70307_-	ATP-dependent DNA helicase RecG	A0A2H4JBQ0	uncultured_Caudovirales_phage	3.1e-06	23.1

DBSCAN-SWA_9

81993 : 83678

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002298564.1\|81993_82863_-	energy-coupling factor ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	5.0e-14	28.8
WP_002317038.1\|82838_83678_-	energy-coupling factor ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-19	32.3

DBSCAN-SWA_10

98451 : 107373

Klosneuvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002290442.1\|98451_99639_-	elongation factor Tu	A0A1V0SLW6	Klosneuvirus	6.4e-12	24.4
WP_002294317.1\|99810_101898_-	elongation factor G	E4ZFJ7	Streptococcus_phage	2.6e-64	28.9
WP_002290440.1\|101991_102462_-	30S ribosomal protein S7	NA	NA	NA	NA
WP_002294318.1\|102545_102959_-	30S ribosomal protein S12	NA	NA	NA	NA
WP_002294319.1\|103277_103961_+	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_002294320.1\|104093_104675_+	recombinase family protein	A0A219Y9V9	Aeromonas_phage	2.2e-18	34.6
WP_002294321.1\|104846_105533_+	2,3-diphosphoglycerate-dependent phosphoglycerate mutase	NA	NA	NA	NA
WP_002324276.1\|105830_106538_-	purine-nucleoside phosphorylase	NA	NA	NA	NA
WP_002289198.1\|106554_107373_-	purine-nucleoside phosphorylase	Q5YBA4	Grouper_iridovirus	6.9e-58	45.8

DBSCAN-SWA_11

110743 : 116094

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289202.1\|110743_112306_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.7e-20	32.4
WP_002289203.1\|112517_113600_-	BMP family ABC transporter substrate-binding protein	A0A0A7DN02	Lactobacillus_phage	9.2e-58	41.5
WP_002298572.1\|113665_114064_-	cytidine deaminase	NA	NA	NA	NA
WP_061573440.1\|114084_114747_-	deoxyribose-phosphate aldolase	NA	NA	NA	NA
WP_002298573.1\|114792_116094_-	pyrimidine-nucleoside phosphorylase	A0A0H3UZD4	Geobacillus_virus	2.3e-124	58.2

DBSCAN-SWA_12

119345 : 120911

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002298578.1\|119345_120911_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	3.5e-18	30.6

DBSCAN-SWA_13

125074 : 130583

Pandoravirus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297376.1\|125074_126475_-	6-phospho-beta-galactosidase	A0A0B5JD41	Pandoravirus	1.0e-45	30.5
WP_002288637.1\|126711_127497_+	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_002288638.1\|127499_128192_+	HAD family phosphatase	NA	NA	NA	NA
WP_002288640.1\|128465_128837_-	hypothetical protein	NA	NA	NA	NA
WP_061573442.1\|129263_130583_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	5.9e-208	82.2

DBSCAN-SWA_14

141935 : 150219

Tupanvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297801.1\|141935_143558_+	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	1.5e-48	26.5
WP_002297799.1\|143686_144550_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	8.8e-11	29.9
WP_002288375.1\|146778_148071_-	adenylosuccinate synthase	G5CQQ4	Megavirus	8.1e-69	36.0
WP_002288373.1\|148851_150219_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	3.0e-130	54.8

DBSCAN-SWA_15

153327 : 161571

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002299768.1\|153327_153840_-	single-stranded DNA-binding protein	Q938M7	Temperate_phage	1.3e-46	60.0
WP_002288366.1\|153889_154189_-	30S ribosomal protein S6	NA	NA	NA	NA
WP_002288365.1\|154424_156896_-	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	9.9e-100	33.5
WP_002288364.1\|156915_158862_-	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	2.7e-140	43.6
WP_002288363.1\|158858_159983_-	DNA replication/repair protein RecF	NA	NA	NA	NA
WP_002295251.1\|159969_160212_-	S4 domain-containing protein YaaA	NA	NA	NA	NA
WP_002288361.1\|160440_161571_-	DNA polymerase III subunit beta	A0A0A8IL17	Aurantimonas_phage	1.9e-29	25.3

DBSCAN-SWA_16

170948 : 180806

Bacillus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288805.1\|170948_171716_+	ParA family protein	Q8JL10	Natrialba_phage	2.8e-29	33.6
WP_002299776.1\|171702_172593_+	ParB/RepB/Spo0J family partition protein	I3NLC2	Bifidobacterium_phage	1.1e-16	33.5
WP_002293106.1\|172613_172805_+	DUF951 domain-containing protein	NA	NA	NA	NA
WP_002325956.1\|172813_173914_+	redox-regulated ATPase YchF	NA	NA	NA	NA
WP_002299780.1\|174003_174699_+	DUF1129 domain-containing protein	NA	NA	NA	NA
WP_002295264.1\|175202_176687_+	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	5.6e-98	41.8
WP_002307286.1\|177356_178628_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.5e-88	53.4
WP_002295267.1\|178921_180130_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	2.7e-26	27.3
WP_002295268.1\|180116_180806_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.8e-38	38.1

DBSCAN-SWA_17

188020 : 192916

Klebsiella_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002299386.1\|188020_190513_+\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A0A8J958	Klebsiella_phage	9.0e-125	38.3
WP_002289033.1\|190733_191657_+	U32 family peptidase	NA	NA	NA	NA
WP_002318037.1\|191662_192916_+	U32 family peptidase	Q6DW11	Phage_TP	7.4e-43	32.9

DBSCAN-SWA_18

207464 : 218236

Anomala_cuprea_entomopoxvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002318033.1\|207464_208271_-	ATP-binding cassette domain-containing protein	W6JKT0	Anomala_cuprea_entomopoxvirus	3.8e-08	25.1
WP_002289390.1\|208267_209173_-	ABC transporter permease	NA	NA	NA	NA
WP_002324442.1\|209190_210159_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002295964.1\|210886_214504_+	DNA-directed RNA polymerase subunit beta	A0A1B1ISA9	uncultured_Mediterranean_phage	1.5e-48	24.7
WP_002288141.1\|214561_218236_+	DNA-directed RNA polymerase subunit beta'	R4TQM7	Phaeocystis_globosa_virus	6.5e-63	24.9

DBSCAN-SWA_19

230048 : 231853

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002318025.1\|230048_231179_+	glycerate kinase	W6LM47	Streptococcus_phage	1.4e-69	49.5
WP_002331266.1\|231175_231853_+	beta-phosphoglucomutase	A0A1D8KNV9	Synechococcus_phage	2.1e-07	23.2

DBSCAN-SWA_20

237873 : 244510

Staphylococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287502.1\|237873_238791_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	4.6e-42	43.8
WP_002324451.1\|238783_239566_+	ABC transporter permease	NA	NA	NA	NA
WP_061573447.1\|239566_240247_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.7e-25	30.5
WP_002326086.1\|240239_241136_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_061573448.1\|241331_242981_+	DNA mismatch repair protein MutS	F2QAF9	Pyramimonas_orientalis_virus	4.9e-18	25.7
WP_002287494.1\|243574_244510_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	6.1e-26	35.1

DBSCAN-SWA_21

251425 : 252289

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061573450.1\|251425_252289_+	AraC family transcriptional regulator	D0R0F8	Streptococcus_phage	1.0e-22	26.5

DBSCAN-SWA_22

260692 : 265540

Brevibacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287463.1\|260692_261961_+	glycoside hydrolase family 73 protein	A0A0K2CP65	Brevibacillus_phage	1.6e-16	37.6
WP_002287461.1\|262630_263095_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_002287459.1\|263078_263708_+	nitroreductase family protein	NA	NA	NA	NA
WP_002326097.1\|264061_265540_+	Msr family ABC-F type ribosomal protection protein	A0A1B0RXA0	Streptococcus_phage	5.8e-87	41.8

DBSCAN-SWA_23

269553 : 272361

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002298218.1\|269553_270801_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	9.4e-115	57.7
WP_002287451.1\|270797_271604_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	3.0e-45	40.4
WP_002287450.1\|271833_272361_+	dUTP diphosphatase	J9PV85	Bacillus_phage	2.1e-44	55.2

DBSCAN-SWA_24

277469 : 278882

Catovirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002322772.1\|277469_278882_+\|tRNA	cysteine--tRNA ligase	A0A1V0SAQ2	Catovirus	2.0e-52	31.7

DBSCAN-SWA_25

282987 : 285535

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287428.1\|282987_284256_+	insulinase family protein	A0A1X9I714	Streptococcus_phage	1.8e-65	37.6
WP_002287425.1\|284248_285535_+	insulinase family protein	A0A2H4UVM3	Bodo_saltans_virus	3.9e-07	27.5

DBSCAN-SWA_26

289570 : 293469

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002298208.1\|289570_290617_+	recombinase RecA	A0A0S2MVG1	Bacillus_phage	2.6e-126	67.3
WP_002287336.1\|291027_292584_+	ribonuclease Y	NA	NA	NA	NA
WP_002298207.1\|292662_293469_-	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	1.5e-33	34.1

DBSCAN-SWA_27

298393 : 303797

Anomala_cuprea_entomopoxvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287343.1\|298393_299074_+	metal ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	5.1e-14	30.4
WP_002287344.1\|299046_299871_+	metal ABC transporter permease	NA	NA	NA	NA
WP_002287345.1\|300037_300856_+	pur operon repressor	A0A1V0SKE5	Klosneuvirus	2.1e-06	27.1
WP_002298200.1\|301358_302732_+	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A2K9L277	Tupanvirus	3.4e-33	35.8
WP_002287347.1\|302825_303797_+	ribose-phosphate diphosphokinase	A0A1V0SHF7	Hokovirus	4.9e-42	32.6

DBSCAN-SWA_28

309369 : 318569

Abalone_herpesvirus(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287358.1\|309369_309984_+	guanylate kinase	A0A143DIC6	Abalone_herpesvirus	2.2e-24	34.6
WP_002287365.1\|309988_310294_+	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_061573454.1\|310546_312955_+	primosomal protein N'	NA	NA	NA	NA
WP_061573455.1\|312969_313461_+	peptide deformylase	E3SLL2	Synechococcus_phage	2.3e-16	42.4
WP_002298189.1\|313453_314392_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	1.8e-09	30.3
WP_002298188.1\|314391_315750_+	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
WP_002287376.1\|315762_316503_+	Stp1/IreP family PP2C-type Ser/Thr phosphatase	NA	NA	NA	NA
WP_002287377.1\|316499_318569_+	Stk1 family PASTA domain-containing Ser/Thr kinase	A0A1V0SDC3	Indivirus	3.5e-21	30.3

DBSCAN-SWA_29

322711 : 324286

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061573456.1\|322711_324286_+	C40 family peptidase	B5LJD6	Mycobacterium_phage	2.3e-17	50.5

DBSCAN-SWA_30

337673 : 345581

Cafeteria_roenbergensis_virus(25.0%)

tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287414.1\|337673_339119_+\|tRNA	tRNA lysidine(34) synthetase TilS	E3T4I1	Cafeteria_roenbergensis_virus	6.8e-08	24.5
WP_002287415.1\|339118_339664_+	hypoxanthine phosphoribosyltransferase	A0A1V0SEQ1	Hokovirus	4.1e-06	25.3
WP_002287418.1\|339753_341865_+\|protease	ATP-dependent zinc metalloprotease FtsH	C7U047	Ostreococcus_tauri_virus	9.1e-110	50.3
WP_002296053.1\|342081_342969_+	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_002290055.1\|342969_343974_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_002296055.1\|344084_345581_+\|tRNA	lysine--tRNA ligase	A0A2K9KZX5	Tupanvirus	8.7e-91	40.9

DBSCAN-SWA_31

353891 : 355085

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289731.1\|353891_355085_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.3e-150	72.0

DBSCAN-SWA_32

358407 : 375306

Bacillus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002285883.1\|358407_360120_+	ABC transporter ATP-binding protein	F2Y302	Organic_Lake_phycodnavirus	1.2e-14	25.4
WP_002285885.1\|360122_361892_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.2e-54	29.4
WP_002285906.1\|362096_362663_-	methyltransferase domain-containing protein	A0A2H4PQV0	Staphylococcus_phage	2.2e-34	42.8
WP_002285909.1\|362662_363619_-	TIGR01212 family radical SAM protein	A0A2H4PQV5	Staphylococcus_phage	3.3e-43	57.4
WP_002285911.1\|363618_364275_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_002285913.1\|364644_366663_+	LysM peptidoglycan-binding domain-containing protein	Q9ZXE4	Bacillus_phage	7.5e-13	39.6
WP_002285916.1\|367089_369504_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	72.8
WP_002285917.1\|369851_371405_+	glycosyl hydrolase	NA	NA	NA	NA
WP_002285918.1\|371785_373570_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.7e-46	28.2
WP_002285920.1\|373584_375306_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.7e-37	28.0

DBSCAN-SWA_33

414746 : 417118

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002285994.1\|414746_415088_+	YlbF family regulator	A0A1X9I5Y8	Streptococcus_phage	1.3e-10	34.9
WP_061573459.1\|415363_417118_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.1e-39	26.9

DBSCAN-SWA_34

423214 : 424207

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286006.1\|423214_424207_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	4.5e-27	30.2

DBSCAN-SWA_35

454158 : 455468

Streptomyces_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286201.1\|454158_454593_-	HIT family protein	D7NW73	Streptomyces_phage	1.2e-08	34.1
WP_002286199.1\|454730_455468_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.8e-25	27.7

DBSCAN-SWA_36

466891 : 471885

Tupanvirus(50.0%)

portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286153.1\|466891_468475_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	6.5e-52	30.9
WP_002293650.1\|469052_469196_-\|portal	portal protein	NA	NA	NA	NA
WP_002293649.1\|469418_469898_-	universal stress protein	NA	NA	NA	NA
WP_002293648.1\|469970_470255_-	hypothetical protein	NA	NA	NA	NA
WP_002289088.1\|470598_471885_-	replication-associated recombination protein A	A0A127AWE7	Bacillus_phage	9.4e-110	50.0

DBSCAN-SWA_37

475105 : 477319

Orpheovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289096.1\|475105_477319_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2I2L310	Orpheovirus	2.3e-10	35.8

DBSCAN-SWA_38

480635 : 486845

Orpheovirus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289103.1\|480635_481928_+\|tRNA	histidine--tRNA ligase	A0A2I2L577	Orpheovirus	7.2e-25	25.8
WP_002289105.1\|481942_483712_+\|tRNA	aspartate--tRNA ligase	A0A1V0SJ84	Klosneuvirus	1.1e-12	25.3
WP_002293644.1\|483820_484696_+	YitT family protein	NA	NA	NA	NA
WP_002303199.1\|484961_486845_+	acetyltransferase	B5WZU0	Pseudomonas_phage	4.5e-28	29.9

DBSCAN-SWA_39

489999 : 496341

Listeria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288954.1\|489999_493128_+	SMC family ATPase	A0A059T7I2	Listeria_phage	1.9e-07	25.8
WP_002288952.1\|493146_496341_+	SNF2 helicase associated domain-containing protein	A0A2L1IWL4	Gordonia_phage	4.1e-37	28.4

DBSCAN-SWA_40

502754 : 560094

Bacillus_phage(21.43%)

transposase,tRNA,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296623.1\|502754_504050_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
WP_002289850.1\|504139_504817_-	DsbA family protein	NA	NA	NA	NA
WP_002289849.1\|504934_505510_-	CYTH domain-containing protein	NA	NA	NA	NA
WP_002289848.1\|505640_506345_+	GTP pyrophosphokinase family protein	NA	NA	NA	NA
WP_002289847.1\|506322_507120_+	NAD kinase	NA	NA	NA	NA
WP_002294562.1\|507121_508021_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_002294561.1\|508038_509400_+	magnesium transporter	NA	NA	NA	NA
WP_002294560.1\|509461_510103_-	copper homeostasis protein CutC	NA	NA	NA	NA
WP_002294559.1\|510211_511078_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_002289592.1\|511298_511802_+\|tRNA	tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL	NA	NA	NA	NA
WP_002289593.1\|511850_512510_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_002289594.1\|512529_515118_+	ATP-dependent RecD-like DNA helicase	A0A218KCE8	Bacillus_phage	8.6e-62	29.2
WP_002289596.1\|515220_515448_+	hypothetical protein	NA	NA	NA	NA
WP_002289597.1\|515557_516187_-	response regulator transcription factor	NA	NA	NA	NA
WP_002289599.1\|516183_517263_-	GHKL domain-containing protein	NA	NA	NA	NA
WP_002324227.1\|517379_518312_+	ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	5.9e-21	33.2
WP_002294551.1\|518325_519471_+	ABC transporter permease	NA	NA	NA	NA
WP_002296167.1\|519457_520630_+	ABC transporter permease	NA	NA	NA	NA
WP_002294549.1\|520728_521694_-	diacylglycerol kinase	NA	NA	NA	NA
WP_002294548.1\|522290_522794_+	QueT transporter family protein	E7DN70	Pneumococcus_phage	3.4e-07	34.3
WP_002294577.1\|522849_523494_-	CBS domain-containing protein	NA	NA	NA	NA
WP_002294578.1\|523655_523808_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_002294579.1\|523831_524002_+	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_002294580.1\|524102_524648_+	transcription termination/antitermination protein NusG	NA	NA	NA	NA
WP_002289897.1\|524706_525612_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_002294583.1\|525784_526804_+	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
WP_002294584.1\|526894_527767_-	L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha	NA	NA	NA	NA
WP_002294585.1\|527779_528448_-	L-serine ammonia-lyase, iron-sulfur-dependent, subunit beta	NA	NA	NA	NA
WP_002291638.1\|528790_529213_+	50S ribosomal protein L11	NA	NA	NA	NA
WP_002294587.1\|529316_530006_+	50S ribosomal protein L1	NA	NA	NA	NA
WP_002291634.1\|530415_530919_+	50S ribosomal protein L10	NA	NA	NA	NA
WP_002294588.1\|530971_531340_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_002296327.1\|531445_532135_+	TVP38/TMEM64 family protein	NA	NA	NA	NA
WP_002320938.1\|532216_533266_+	MFS transporter	NA	NA	NA	NA
WP_002295743.1\|533359_534268_+\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002290558.1\|534657_536190_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	3.3e-45	28.0
WP_002287787.1\|536423_537125_+	glucosamine-6-phosphate deaminase	NA	NA	NA	NA
WP_002287788.1\|537378_538092_+	MgtC/SapB family protein	G3MA03	Bacillus_virus	6.5e-20	43.7
WP_002287791.1\|538400_539540_+	AI-2E family transporter	NA	NA	NA	NA
WP_002287792.1\|539628_540594_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	3.4e-128	70.4
WP_002287793.1\|540643_542803_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	3.8e-265	63.2
WP_002287795.1\|542961_543186_-	glutaredoxin-like protein NrdH	A0A0M7REK7	Lactobacillus_phage	1.7e-11	42.7
WP_002287797.1\|543586_544060_+	ferrous iron transport protein A	NA	NA	NA	NA
WP_002287799.1\|544056_546189_+	ferrous iron transport protein B	NA	NA	NA	NA
WP_002290587.1\|546190_546325_+	hypothetical protein	NA	NA	NA	NA
WP_002287801.1\|546418_547063_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002287805.1\|547249_548443_+	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-29	37.0
WP_002287807.1\|548435_550163_+	ABC transporter permease/substrate binding protein	NA	NA	NA	NA
WP_002304799.1\|550556_550754_+\|bacteriocin	leucocin A/sakacin P family class II bacteriocin	NA	NA	NA	NA
WP_002287810.1\|550755_551067_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_002321654.1\|551170_551317_+\|bacteriocin	EntF family bacteriocin induction factor	NA	NA	NA	NA
WP_000222572.1\|551313_552267_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002322652.1\|552896_553466_+	DUF1836 domain-containing protein	NA	NA	NA	NA
WP_002288847.1\|553452_554313_+	DegV family protein	A0A1X9I5J4	Streptococcus_phage	2.7e-12	24.4
WP_002288850.1\|554502_555207_+	response regulator transcription factor	W8CYM9	Bacillus_phage	5.8e-45	41.6
WP_061573460.1\|555211_557047_+	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	1.2e-36	37.4
WP_002288852.1\|557043_558360_+	hypothetical protein	NA	NA	NA	NA
WP_002288853.1\|558360_559230_+	two-component system regulatory protein YycI	NA	NA	NA	NA
WP_002288854.1\|559284_560094_+	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	3.1e-34	33.6

DBSCAN-SWA_41

563250 : 566811

uncultured_virus(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288862.1\|563250_563535_+	co-chaperone GroES	A0A221S4M3	uncultured_virus	2.0e-12	40.2
WP_002288864.1\|563585_565211_+	chaperonin GroEL	A0A219YK78	uncultured_virus	2.2e-156	56.8
WP_002296840.1\|565623_566811_+\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3

DBSCAN-SWA_42

570478 : 572787

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287304.1\|570478_571951_+	nicotinate phosphoribosyltransferase	G3MA18	Bacillus_virus	1.2e-108	45.0
WP_002287302.1\|571962_572787_+	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	6.1e-78	56.8

DBSCAN-SWA_43

588832 : 589993

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287280.1\|588832_589993_+	D-3-phosphoglycerate dehydrogenase	M1NSB9	Streptococcus_phage	1.9e-61	36.1

DBSCAN-SWA_44

597703 : 604127

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287267.1\|597703_599431_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	5.6e-49	26.4
WP_002287265.1\|599427_601320_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.6e-60	31.5
WP_002287264.1\|602023_602893_+	extradiol dioxygenase	NA	NA	NA	NA
WP_002346760.1\|603101_604127_+	serine hydrolase	A0A076YS03	Mycobacterium_phage	2.2e-05	28.0

DBSCAN-SWA_45

613900 : 615052

Micromonas_sp._RCC1109_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287246.1\|613900_615052_+	mannitol-1-phosphate 5-dehydrogenase	E5EQS6	Micromonas_sp._RCC1109_virus	1.1e-16	30.0

DBSCAN-SWA_46

623231 : 629462

Lactococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289675.1\|623231_623816_+	thymidine kinase	A0A1W6JJU6	Lactococcus_phage	1.0e-47	52.1
WP_002289676.1\|623818_624892_+	peptide chain release factor 1	NA	NA	NA	NA
WP_002303629.1\|624884_625724_+	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_002300130.1\|625716_625896_+	hypothetical protein	NA	NA	NA	NA
WP_002294101.1\|625917_626943_+	threonylcarbamoyl-AMP synthase	S4VW33	Pandoravirus	1.3e-58	42.7
WP_002294099.1\|627117_628362_+	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	6.7e-105	55.1
WP_002303627.1\|628514_629462_+	alpha/beta hydrolase	A0A2P1EM31	Moumouvirus	3.6e-66	42.0

DBSCAN-SWA_47

637517 : 643377

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289241.1\|637517_638153_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.4e-27	36.4
WP_002289242.1\|638170_638986_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002289243.1\|639304_640741_+	glycoside hydrolase family 1 protein	A0A0B5JD41	Pandoravirus	1.4e-48	29.4
WP_002289244.1\|640929_643377_+	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	8.1e-86	50.7

DBSCAN-SWA_48

651769 : 658563

Bacillus_virus(40.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289332.1\|651769_652840_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.5e-20	31.0
WP_002289330.1\|652829_653783_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	2.2e-18	33.7
WP_002289328.1\|653794_654805_+	helix-turn-helix domain-containing protein	A0A288TXV8	Enterococcus_phage	2.8e-56	40.8
WP_061573462.1\|655089_655911_-	NUDIX hydrolase	G3MA14	Bacillus_virus	2.7e-25	32.8
WP_002289337.1\|656007_656286_-	hypothetical protein	NA	NA	NA	NA
WP_002289325.1\|656553_658563_+\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	1.4e-96	38.3

DBSCAN-SWA_49

664699 : 670820

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289507.1\|664699_665809_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	Q6GZ03	Mycoplasma_phage	1.2e-20	33.0
WP_002289508.1\|666017_666440_+	methylglyoxal synthase	NA	NA	NA	NA
WP_002289509.1\|666762_667299_+	folate family ECF transporter S component	NA	NA	NA	NA
WP_002289511.1\|667338_669102_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.5e-44	30.2
WP_002294013.1\|669104_670820_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.7e-50	28.3

DBSCAN-SWA_50

681154 : 682036

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287122.1\|681154_682036_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.3e-73	50.3

DBSCAN-SWA_51

688200 : 688863

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287128.1\|688200_688863_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.5e-21	34.7

DBSCAN-SWA_52

707378 : 709783

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287163.1\|707378_707888_-	phosphatidylglycerophosphatase A	G3MBC5	Bacillus_virus	1.5e-39	56.1
WP_002287165.1\|707999_708998_-	NAD(P)/FAD-dependent oxidoreductase	Q9JRK7	Streptococcus_phage	2.6e-30	54.1
WP_002287167.1\|709198_709783_+	peptidylprolyl isomerase	A0A1V0S9I2	Catovirus	2.0e-27	43.4

DBSCAN-SWA_53

718094 : 723001

Paenibacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086953888.1\|718094_719257_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002287966.1\|719465_719840_+	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_002287965.1\|719953_720583_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_002296289.1\|721213_721378_-	hypothetical protein	NA	NA	NA	NA
WP_002294080.1\|721672_723001_+	C1 family peptidase	R4TV59	Phaeocystis_globosa_virus	7.3e-73	38.1

DBSCAN-SWA_54

727875 : 728436

Geobacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287958.1\|727875_728436_+	haloacid dehalogenase	A0A0H3UZF4	Geobacillus_virus	2.3e-28	45.1

DBSCAN-SWA_55

731678 : 790316

Staphylococcus_phage(18.75%)

transposase,tRNA,head,terminase,integrase,portal,tail,capsid

attL 776577:776603|attR 791385:791411

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287955.1\|731678_732890_+\|tRNA	tRNA 4-thiouridine(8) synthase ThiI	NA	NA	NA	NA
WP_061573463.1\|733462_734110_+	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_002287953.1\|734502_737148_+\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	4.0e-163	42.9
WP_002294071.1\|737457_738771_+	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_002287951.1\|738760_739414_+	HAD family phosphatase	NA	NA	NA	NA
WP_002294069.1\|739468_740161_+	DNA repair protein RadC	NA	NA	NA	NA
WP_002294067.1\|740310_740511_+	cold-shock protein	Q9AZD3	Lactococcus_phage	3.7e-21	71.2
WP_002287948.1\|740764_742444_-	ribonuclease J	NA	NA	NA	NA
WP_002287947.1\|742445_742658_-	DNA-dependent RNA polymerase auxiliary subunit epsilon family protein	NA	NA	NA	NA
WP_002296290.1\|743050_744781_+	multidrug efflux ABC transporter subunit EfrA	W8CYL7	Bacillus_phage	2.1e-43	27.6
WP_002289400.1\|744777_746538_+	multidrug efflux ABC transporter subunit EfrB	W8CYL7	Bacillus_phage	2.5e-52	28.6
WP_002296291.1\|746632_746830_+	hypothetical protein	NA	NA	NA	NA
WP_002289401.1\|746982_747468_+	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_002289402.1\|747571_748165_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	8.9e-55	55.6
WP_002289403.1\|748344_748872_+	hypothetical protein	NA	NA	NA	NA
WP_002289404.1\|748962_749700_+	glycerophosphodiester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	2.3e-12	40.0
WP_002289405.1\|749703_750621_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_002289406.1\|750622_751852_+	GTPase HflX	NA	NA	NA	NA
WP_000222572.1\|751885_752839_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002287759.1\|753489_755103_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_002296511.1\|755243_756152_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002287757.1\|756334_757459_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_002287755.1\|757685_758603_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_002287754.1\|758595_759429_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002287753.1\|759511_760630_+	glycoside hydrolase family 88 protein	NA	NA	NA	NA
WP_002321415.1\|760623_762522_+	DUF2264 domain-containing protein	NA	NA	NA	NA
WP_002321414.1\|762515_763739_+	glycoside hydrolase family 88 protein	NA	NA	NA	NA
WP_002287747.1\|763824_765759_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	1.1e-58	31.9
WP_002287746.1\|765984_766641_+	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_002287745.1\|766714_767068_-	thioredoxin family protein	NA	NA	NA	NA
WP_002287744.1\|767259_768189_+	permease	NA	NA	NA	NA
WP_002287743.1\|768199_769036_+	TIGR03943 family protein	NA	NA	NA	NA
WP_002287742.1\|769283_770060_+	response regulator transcription factor	NA	NA	NA	NA
WP_002287741.1\|770235_770979_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.6e-29	30.9
WP_002296509.1\|770971_772552_+	ABC transporter	NA	NA	NA	NA
WP_002289868.1\|772802_773282_-	threonine/serine exporter family protein	NA	NA	NA	NA
WP_002289867.1\|773297_774050_-	threonine/serine exporter family protein	NA	NA	NA	NA
WP_002296505.1\|774597_775323_+	DNA/RNA non-specific endonuclease	NA	NA	NA	NA
WP_002290885.1\|775577_775844_+	IreB family regulatory phosphoprotein	NA	NA	NA	NA
WP_002296503.1\|775840_776272_+	Holliday junction resolvase RuvX	NA	NA	NA	NA
WP_002290887.1\|776296_776602_+	DUF1292 domain-containing protein	NA	NA	NA	NA
776577:776603	attL	NA	NA	NA	NA
WP_002296502.1\|776682_777828_-\|integrase	site-specific integrase	A0A1S5S7K9	Streptococcus_phage	2.0e-50	33.3
WP_002296501.1\|777888_778536_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002296500.1\|778729_779023_+	hypothetical protein	NA	NA	NA	NA
WP_002296499.1\|779066_779378_+	hypothetical protein	NA	NA	NA	NA
WP_002296496.1\|780139_780298_+	hypothetical protein	NA	NA	NA	NA
WP_002296495.1\|780298_780661_+	hypothetical protein	NA	NA	NA	NA
WP_002296494.1\|780697_781546_+	bifunctional DNA primase/polymerase	A0A222ZGI2	Arthrobacter_phage	5.2e-08	28.3
WP_002296493.1\|781535_783011_+	helicase	Q4ZD27	Staphylococcus_phage	7.3e-66	34.9
WP_002296492.1\|783276_783684_+	DUF3206 domain-containing protein	NA	NA	NA	NA
WP_002296491.1\|783686_783902_+	hypothetical protein	NA	NA	NA	NA
WP_002304527.1\|783905_784286_+	HNH endonuclease	A0A2I7S865	Vibrio_phage	1.7e-11	47.9
WP_002296489.1\|784419_784575_+	DUF2292 domain-containing protein	NA	NA	NA	NA
WP_002296488.1\|784643_785117_+\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_002296487.1\|785113_786808_+\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	9.1e-129	43.8
WP_002317249.1\|786773_786959_+	hypothetical protein	NA	NA	NA	NA
WP_002296486.1\|786962_788138_+\|portal	phage portal protein	A0A2H4J5A4	uncultured_Caudovirales_phage	3.2e-64	35.6
WP_002296485.1\|788130_789654_+\|capsid	phage major capsid protein	A0A1W6JPR8	Staphylococcus_phage	1.4e-48	37.4
WP_002296484.1\|789709_789994_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_002296483.1\|789980_790316_+\|head	phage head closure protein	V5UQC7	Enterococcus_phage	4.7e-13	35.6
791385:791411	attR	NA	NA	NA	NA

DBSCAN-SWA_56

805542 : 819041

Erysipelothrix_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296465.1\|805542_806907_+	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	9.3e-07	25.7
WP_002296464.1\|807077_808148_+	ABC transporter permease	NA	NA	NA	NA
WP_002296462.1\|808162_808831_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.8e-35	41.4
WP_002295080.1\|808850_809429_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002295084.1\|809831_810743_+	N-acetylmuramoyl-L-alanine amidase	C8CHK8	Thermus_virus	5.3e-06	41.1
WP_002296459.1\|810998_811916_-	ribonuclease HIII	NA	NA	NA	NA
WP_002295087.1\|812117_812555_+	cell division protein ZapA	NA	NA	NA	NA
WP_002295088.1\|812612_813161_+	CvpA family protein	NA	NA	NA	NA
WP_002296458.1\|813275_815636_+	endonuclease MutS2	Q94M10	Lactobacillus_phage	1.7e-24	50.4
WP_002290803.1\|815722_816037_+	thioredoxin	A0A1J0GW78	Streptomyces_phage	3.6e-15	40.8
WP_002296457.1\|816218_817997_+	excinuclease ABC subunit UvrC	NA	NA	NA	NA
WP_061573464.1\|818141_819041_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.7e-23	29.3

DBSCAN-SWA_57

839044 : 840412

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002295121.1\|839044_840412_-	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	1.5e-25	32.3

DBSCAN-SWA_58

851317 : 852616

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002292812.1\|851317_852616_+	phosphopyruvate hydratase	W6LP63	Streptococcus_phage	3.6e-194	81.5

DBSCAN-SWA_59

858631 : 861475

Lactococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002323818.1\|858631_860989_+	ribonuclease R	Q0GXV6	Lactococcus_phage	8.9e-98	41.7
WP_002326296.1\|861010_861475_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	7.7e-46	59.2

DBSCAN-SWA_60

870688 : 870985

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289000.1\|870688_870985_+	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	3.0e-19	58.0

DBSCAN-SWA_61

874361 : 877242

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002303217.1\|874361_875006_-	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	6.0e-49	50.2
WP_002294988.1\|875132_875420_+	hypothetical protein	NA	NA	NA	NA
WP_002292778.1\|875527_875848_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002303218.1\|875928_877242_+	DEAD/DEAH box helicase family protein	A0A1X9I5S6	Streptococcus_phage	1.8e-63	37.9

DBSCAN-SWA_62

882724 : 883411

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002292768.1\|882724_883411_+	cell division ATP-binding protein FtsE	G3M9Y6	Bacillus_virus	5.5e-16	25.0

DBSCAN-SWA_63

889015 : 890596

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289486.1\|889015_889822_+	phosphate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.2e-15	28.9
WP_002289489.1\|889837_890596_+	phosphate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.9e-15	27.8

DBSCAN-SWA_64

898972 : 899911

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289574.1\|898972_899911_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	4.2e-75	51.2

DBSCAN-SWA_65

906417 : 907320

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296136.1\|906417_907320_+	deoxyribonuclease IV	A0A2H4UU70	Bodo_saltans_virus	1.5e-21	30.0

DBSCAN-SWA_66

911576 : 915112

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002304603.1\|911576_913328_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	4.8e-56	31.2
WP_002322632.1\|913327_915112_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.6e-46	27.4

DBSCAN-SWA_67

922518 : 931250

Bacillus_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002291688.1\|922518_923445_+	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	2.3e-89	52.8
WP_002305596.1\|923658_925386_+	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	1.4e-209	63.0
WP_002316410.1\|925401_925752_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002291694.1\|925846_926707_-	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_002287322.1\|926798_927227_+	transcriptional repressor	NA	NA	NA	NA
WP_002287321.1\|927388_927565_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_002291695.1\|927591_928038_+	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	1.6e-19	38.8
WP_002303427.1\|928193_929573_-	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_002291698.1\|930278_931250_+	PhoH family protein	W8D063	Erwinia_phage	3.5e-48	49.8

DBSCAN-SWA_68

939882 : 941202

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002323333.1\|939882_941202_-\|transposase	IS1380-like element IS1678 family transposase	A0A1X9I6F6	Streptococcus_phage	4.8e-210	82.7

DBSCAN-SWA_69

944242 : 944941

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002323214.1\|944242_944941_+	CpsD/CapB family tyrosine-protein kinase	A0A1X9I5D6	Streptococcus_phage	1.3e-25	38.2

DBSCAN-SWA_70

948346 : 952306

Acanthocystis_turfacea_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002305610.1\|948346_949597_+	nucleotide sugar dehydrogenase	M1IB49	Acanthocystis_turfacea_Chlorella_virus	9.8e-104	49.9
WP_002323215.1\|949615_950626_+	kinase	NA	NA	NA	NA
WP_002305613.1\|950635_951289_+	SIS domain-containing protein	NA	NA	NA	NA
WP_002305614.1\|951307_952306_+	NAD-dependent epimerase/dehydratase family protein	E3SJ77	Synechococcus_phage	7.7e-35	29.1

DBSCAN-SWA_71

960858 : 973955

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002305623.1\|960858_962496_+	hypothetical protein	B2ZYD9	Ralstonia_phage	1.2e-19	26.8
WP_002305624.1\|962597_962993_+	hypothetical protein	M4QRS4	Synechococcus_phage	4.7e-20	46.2
WP_002323221.1\|963010_963742_+	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	A0A222YX14	Synechococcus_phage	3.7e-26	33.2
WP_002305626.1\|963765_965217_+	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_002305628.1\|965242_965854_+	VanZ family protein	NA	NA	NA	NA
WP_002305629.1\|966035_966551_+	dTDP-4-dehydrorhamnose 3,5-epimerase family protein	H9NC63	Sphingomonas_phage	1.6e-15	30.5
WP_002305661.1\|966810_967857_+	GDP-mannose 4,6-dehydratase	M4QRT5	Synechococcus_phage	1.8e-122	63.1
WP_002323224.1\|967936_968950_+	hypothetical protein	NA	NA	NA	NA
WP_002305663.1\|968986_969931_+	GDP-L-fucose synthase	A0A1D8KU05	Synechococcus_phage	1.5e-93	53.4
WP_002305664.1\|969998_971312_+	cupin domain-containing protein	A0A1V0SH58	Hokovirus	2.6e-38	26.9
WP_002323227.1\|971395_972298_+	hypothetical protein	NA	NA	NA	NA
WP_002305666.1\|972302_973955_+	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	2.6e-104	40.5

DBSCAN-SWA_72

977070 : 977265

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002349152.1\|977070_977265_+	hypothetical protein	M1PSF2	Streptococcus_phage	1.1e-14	72.0

DBSCAN-SWA_73

982672 : 986548

Rhodococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002305673.1\|982672_983437_+	RNA methyltransferase	A0A2D1A6G0	Rhodococcus_phage	1.7e-05	26.1
WP_002289559.1\|983558_984062_+	HD domain-containing protein	NA	NA	NA	NA
WP_002319779.1\|984469_985117_+	elongation factor G-binding protein	NA	NA	NA	NA
WP_002323328.1\|985279_986548_+	voltage-gated chloride channel family protein	A0A1X9I5Z9	Streptococcus_phage	2.6e-43	31.6

DBSCAN-SWA_74

991854 : 1011094

Streptococcus_phage(28.57%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002294871.1\|991854_992055_+	cold-shock protein	Q9AZD3	Lactococcus_phage	2.5e-22	74.2
WP_002323394.1\|992201_994991_+	DEAD/DEAH box helicase family protein	A0A1X9I5C8	Streptococcus_phage	8.1e-90	31.0
WP_002348809.1\|995037_995565_+	DUF5590 domain-containing protein	NA	NA	NA	NA
WP_002296294.1\|995585_996776_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_002301945.1\|996815_998114_+\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	6.9e-60	30.5
WP_002301946.1\|999042_999717_+	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_002319756.1\|999713_1000055_+	hypothetical protein	NA	NA	NA	NA
WP_002288776.1\|1000084_1000444_+	YccF domain-containing protein	NA	NA	NA	NA
WP_002323533.1\|1000968_1003050_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	8.3e-116	35.7
WP_002288779.1\|1003360_1004827_+	amino acid permease	NA	NA	NA	NA
WP_002289037.1\|1005441_1005981_+	transcriptional regulator	A0A097BYE2	Leuconostoc_phage	3.8e-20	34.5
WP_002294855.1\|1006054_1006495_+	CopY/TcrY family copper transport repressor	NA	NA	NA	NA
WP_002337817.1\|1006507_1006717_+	copper chaperone CopZ	NA	NA	NA	NA
WP_061573465.1\|1006716_1008903_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	4.1e-121	38.6
WP_002327341.1\|1008922_1011094_+	copper/silver-translocating P-type ATPase CopB	A0A218MNH6	uncultured_virus	5.0e-71	32.3

DBSCAN-SWA_75

1021159 : 1031912

Bacillus_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002319273.1\|1021159_1023631_+	cation-translocating P-type ATPase	M1HBF8	Paramecium_bursaria_Chlorella_virus	5.4e-45	29.2
WP_061573469.1\|1023733_1025470_-	sensor histidine kinase	W8CYF6	Bacillus_phage	1.2e-27	34.1
WP_002293705.1\|1025466_1026171_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.4e-38	36.2
WP_002297194.1\|1026301_1026805_+	DUF523 domain-containing protein	NA	NA	NA	NA
WP_002293708.1\|1026764_1027103_+	putative DNA-binding protein	NA	NA	NA	NA
WP_002293709.1\|1027123_1028542_+	signal recognition particle protein	NA	NA	NA	NA
WP_002297218.1\|1028659_1029955_-\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002293710.1\|1030175_1030754_+	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_002297192.1\|1030757_1031279_+	dihydrofolate reductase	NA	NA	NA	NA
WP_002293714.1\|1031357_1031912_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	2.3e-12	29.3

DBSCAN-SWA_76

1057826 : 1067642

Streptococcus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061573477.1\|1057826_1058543_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.0e-33	35.7
WP_002322837.1\|1058542_1059991_+	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	1.7e-19	29.3
WP_002288586.1\|1060060_1060570_-	hypothetical protein	NA	NA	NA	NA
WP_061573478.1\|1060559_1061285_-	hypothetical protein	NA	NA	NA	NA
WP_002325787.1\|1061507_1063628_-	LTA synthase family protein	W6LM83	Streptococcus_phage	4.8e-220	58.1
WP_002322842.1\|1063857_1065036_+	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	5.1e-102	48.9
WP_002293935.1\|1065051_1065810_+	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	8.5e-26	36.9
WP_002288577.1\|1065832_1066318_+\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_002288576.1\|1066388_1067642_-	NAD(P)/FAD-dependent oxidoreductase	A0A2H4PQX1	Staphylococcus_phage	7.7e-24	55.3

DBSCAN-SWA_77

1070668 : 1080257

Listeria_phage(42.86%)

integrase,transposase

attL 1068833:1068846|attR 1078936:1078949

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1068833:1068846	attL	NA	NA	NA	NA
WP_061573479.1\|1070668_1071892_-\|integrase	site-specific integrase	A0A0P0I3D2	Lactobacillus_phage	1.1e-80	43.0
WP_061573480.1\|1072070_1073018_-	hypothetical protein	NA	NA	NA	NA
WP_010728285.1\|1073140_1073707_-	DUF5067 domain-containing protein	NA	NA	NA	NA
WP_061573481.1\|1073843_1074533_-	SHOCT domain-containing protein	X5JB37	Clostridium_phage	5.0e-25	47.3
WP_010732289.1\|1074592_1075060_-	ImmA/IrrE family metallo-endopeptidase	R4IBK9	Listeria_phage	3.5e-22	38.0
WP_061573482.1\|1075070_1075397_-	helix-turn-helix transcriptional regulator	A8ATJ9	Listeria_phage	1.3e-18	58.2
WP_038398690.1\|1075568_1075793_+	helix-turn-helix transcriptional regulator	A8ATK0	Listeria_phage	4.6e-12	62.7
WP_162846314.1\|1075789_1075942_+	hypothetical protein	NA	NA	NA	NA
WP_038398692.1\|1076004_1076559_+	hypothetical protein	NA	NA	NA	NA
WP_086956687.1\|1076765_1077927_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002305693.1\|1078199_1078631_+	DUF4231 domain-containing protein	NA	NA	NA	NA
WP_002295273.1\|1078862_1079120_-	hypothetical protein	NA	NA	NA	NA
1078936:1078949	attR	NA	NA	NA	NA
WP_002287105.1\|1079282_1080257_+	choloylglycine hydrolase family protein	M1HVK5	Paramecium_bursaria_Chlorella_virus	5.4e-25	31.8

DBSCAN-SWA_78

1085095 : 1087615

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287775.1\|1085095_1086895_-	glycerophosphoryl diester phosphodiesterase membrane domain-containing protein	I6XE30	Staphylococcus_phage	5.3e-10	26.5
WP_002287776.1\|1087018_1087615_-	TVP38/TMEM64 family protein	M1Q152	Streptococcus_phage	8.7e-34	41.7

DBSCAN-SWA_79

1091855 : 1098679

Paramecium_bursaria_Chlorella_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002317802.1\|1091855_1092830_+	choloylglycine hydrolase family protein	M1H001	Paramecium_bursaria_Chlorella_virus	6.6e-23	29.7
WP_002323439.1\|1093154_1095050_+	asparagine synthase (glutamine-hydrolyzing)	F2Y2L7	Organic_Lake_phycodnavirus	6.0e-20	26.2
WP_002288531.1\|1095244_1095691_-	DUF2188 domain-containing protein	NA	NA	NA	NA
WP_002296119.1\|1095918_1096068_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_002296121.1\|1096155_1096674_+	dihydrofolate reductase	G3MBI7	Bacillus_virus	7.1e-24	39.1
WP_002293906.1\|1096750_1097707_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002293905.1\|1097872_1098679_+	ABC transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	1.0e-13	32.1

DBSCAN-SWA_80

1106480 : 1112893

Hokovirus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061573486.1\|1106480_1107470_+	UDP-glucose 4-epimerase GalE	A0A1V0SG19	Hokovirus	3.5e-48	36.8
WP_061573487.1\|1107481_1108966_+	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_061573488.1\|1108989_1109970_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	7.6e-19	28.9
WP_002318999.1\|1110058_1110883_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_061573489.1\|1110866_1111409_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_002293888.1\|1111415_1111880_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_061573490.1\|1111876_1112893_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	7.1e-60	41.4

DBSCAN-SWA_81

1118483 : 1120175

Orpheovirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002326914.1\|1118483_1120175_+\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	1.3e-74	32.8

DBSCAN-SWA_82

1126821 : 1127634

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002294134.1\|1126821_1127634_+	isoprenyl transferase	R9W0U9	Flavobacterium_phage	2.0e-25	46.8

DBSCAN-SWA_83

1131848 : 1140958

Clostridium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061573491.1\|1131848_1136201_+	PolC-type DNA polymerase III	A0A0K2SUJ2	Clostridium_phage	3.9e-22	41.4
WP_002326917.1\|1136344_1136818_+	ribosome maturation factor RimP	NA	NA	NA	NA
WP_002319370.1\|1136840_1138016_+	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_002288501.1\|1138037_1138331_+	YlxR family protein	NA	NA	NA	NA
WP_002288509.1\|1138327_1138639_+	YlxQ-related RNA-binding protein	NA	NA	NA	NA
WP_002294141.1\|1138651_1140958_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	3.6e-19	23.7

DBSCAN-SWA_84

1155980 : 1166246

Chrysochromulina_ericina_virus(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_148654932.1\|1155980_1157143_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_061573496.1\|1157213_1157615_+	HNH endonuclease	NA	NA	NA	NA
WP_061573497.1\|1158600_1158828_+	hypothetical protein	NA	NA	NA	NA
WP_002326924.1\|1158843_1160010_+	oxygen-independent coproporphyrinogen III oxidase	A0A0N7G7K6	Chrysochromulina_ericina_virus	5.0e-09	33.6
WP_002326925.1\|1160244_1161288_+	heat-inducible transcriptional repressor HrcA	NA	NA	NA	NA
WP_061573498.1\|1161381_1161945_+	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_002292134.1\|1161995_1163825_+	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	2.2e-136	48.8
WP_002289374.1\|1163975_1165142_+	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	1.9e-24	25.7
WP_002292113.1\|1165508_1166246_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.8e-34	44.7

DBSCAN-SWA_85

1170012 : 1178075

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002326928.1\|1170012_1172829_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	1.0e-311	57.5
WP_061573499.1\|1173091_1174357_+	D-aspartate ligase	NA	NA	NA	NA
WP_061573500.1\|1174360_1175083_+	aspartate racemase	NA	NA	NA	NA
WP_002289695.1\|1175226_1176111_+	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	5.4e-08	31.4
WP_002306471.1\|1176107_1177106_+	YvcK family protein	A1IMD5	Streptococcus_phage	4.4e-115	62.9
WP_002289698.1\|1177139_1178075_+	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	2.0e-53	39.1

DBSCAN-SWA_86

1188847 : 1192390

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002326936.1\|1188847_1190653_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	1.3e-96	38.7
WP_002326937.1\|1191061_1191352_+	hypothetical protein	NA	NA	NA	NA
WP_002324980.1\|1191364_1192390_+	signal peptide peptidase SppA	A0A2I6UH21	Salinibacter_virus	3.2e-20	33.1

DBSCAN-SWA_87

1195830 : 1197081

Bacillus_virus(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002294425.1\|1195830_1197081_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	5.5e-147	62.5

DBSCAN-SWA_88

1205258 : 1209546

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002319708.1\|1205258_1207493_+	DNA helicase PcrA	A7KV33	Bacillus_phage	9.5e-126	40.1
WP_002323115.1\|1207509_1209546_+	NAD-dependent DNA ligase LigA	A0A289ZTZ3	Serratia_phage	4.8e-100	37.1

DBSCAN-SWA_89

1212865 : 1217255

Catovirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002326946.1\|1212865_1213921_+	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	8.5e-16	27.7
WP_002323988.1\|1214031_1215405_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	D0R096	Streptococcus_phage	2.5e-140	55.9
WP_061573548.1\|1215978_1216164_+	hypothetical protein	A0A218MNE0	uncultured_virus	2.8e-07	50.9
WP_002296415.1\|1216241_1217255_+	alpha/beta hydrolase	M1PGN2	Moumouvirus	7.9e-11	23.3

DBSCAN-SWA_90

1220713 : 1222597

Herpes_simplex_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061573507.1\|1220713_1222597_+	beta-galactosidase	L0N6M2	Herpes_simplex_virus	1.4e-98	34.5

DBSCAN-SWA_91

1226331 : 1227498

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002323995.1\|1226331_1227498_+	chorismate synthase	A0A291AU41	Pandoravirus	2.1e-39	35.3

DBSCAN-SWA_92

1231311 : 1233048

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289136.1\|1231311_1233048_-	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	5.0e-21	30.6

DBSCAN-SWA_93

1246952 : 1247684

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296404.1\|1246952_1247684_+	serine/threonine protein phosphatase	A7KV25	Bacillus_phage	1.7e-15	30.8

DBSCAN-SWA_94

1254345 : 1257872

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296395.1\|1254345_1256991_+	DNA polymerase I	F8WQ35	Bacillus_phage	3.0e-54	35.7
WP_002288323.1\|1257035_1257872_+	DNA-formamidopyrimidine glycosylase	A0A127AWE5	Bacillus_phage	1.8e-24	30.2

DBSCAN-SWA_95

1261047 : 1293727

Streptococcus_phage(20.0%)

integrase,transposase,tRNA,protease

attL 1262561:1262578|attR 1297252:1297269

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288331.1\|1261047_1261974_+	primosomal protein DnaI	S5MU12	Brevibacillus_phage	5.1e-33	41.3
WP_002288333.1\|1262102_1262543_+	lipoprotein	NA	NA	NA	NA
1262561:1262578	attL	NA	NA	NA	NA
WP_002297185.1\|1262708_1264004_-\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
WP_002288335.1\|1264209_1264911_+\|tRNA	tRNA (adenine-N(1))-methyltransferase	NA	NA	NA	NA
WP_002288338.1\|1264907_1266029_+	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
WP_002288340.1\|1266043_1267276_+	peptidase T	NA	NA	NA	NA
WP_002288343.1\|1267407_1268316_+	YegS/Rv2252/BmrU family lipid kinase	NA	NA	NA	NA
WP_002288344.1\|1268350_1268623_+	DUF1294 domain-containing protein	NA	NA	NA	NA
WP_002288347.1\|1268633_1269680_+	flippase-like domain-containing protein	NA	NA	NA	NA
WP_002288348.1\|1269930_1272540_+	ATP-dependent chaperone ClpB	A0A2I7SAX5	Vibrio_phage	1.6e-132	35.0
WP_002321495.1\|1272690_1273377_-	hypothetical protein	NA	NA	NA	NA
WP_002288352.1\|1273354_1273849_-	nucleoside deoxyribosyltransferase	A0A1W6JK28	Lactococcus_phage	7.2e-42	56.5
WP_061573509.1\|1273868_1275089_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002288355.1\|1275235_1277071_+	elongation factor 4	E4ZFJ7	Streptococcus_phage	3.4e-20	24.4
WP_002288357.1\|1277164_1278292_-\|integrase	site-specific integrase	A0A2I7SCV1	Paenibacillus_phage	1.8e-109	55.5
WP_000222572.1\|1278348_1279302_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_000997695.1\|1279457_1280636_-\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002289415.1\|1281686_1282100_-	Hsp20/alpha crystallin family protein	A0A1B2LRT2	Wolbachia_phage	2.1e-07	31.5
WP_002303864.1\|1282555_1283041_-	hypothetical protein	NA	NA	NA	NA
WP_002289418.1\|1283179_1283395_-	DUF378 domain-containing protein	NA	NA	NA	NA
WP_002289420.1\|1283618_1284419_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.6e-09	26.2
WP_002289421.1\|1284437_1286306_+	HTH domain-containing protein	NA	NA	NA	NA
WP_002289422.1\|1286298_1286790_+	DeoR family transcriptional regulator	NA	NA	NA	NA
WP_002289423.1\|1286777_1287332_+	PTS glucitol/sorbitol transporter subunit IIC	NA	NA	NA	NA
WP_002287107.1\|1288485_1289736_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3
WP_002296624.1\|1290144_1290543_+	PTS glucitol/sorbitol transporter subunit IIA	NA	NA	NA	NA
WP_002311093.1\|1290526_1291222_+	fructose-6-phosphate aldolase	E3SKN5	Synechococcus_phage	1.0e-22	31.5
WP_002296627.1\|1291815_1292703_-	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_061573510.1\|1292887_1293727_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
1297252:1297269	attR	NA	NA	NA	NA

DBSCAN-SWA_96

1300993 : 1305966

Moumouvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296637.1\|1300993_1301995_+	alpha/beta hydrolase	M1PGN2	Moumouvirus	2.5e-09	31.8
WP_002296638.1\|1302196_1302403_-	DUF3955 domain-containing protein	NA	NA	NA	NA
WP_002296639.1\|1303048_1303897_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002321675.1\|1303895_1304963_+	decarboxylating 6-phosphogluconate dehydrogenase	A0A1D8KGX1	Synechococcus_phage	3.9e-53	35.3
WP_002296641.1\|1304964_1305966_+	2-hydroxyacid dehydrogenase	M1H9J0	Paramecium_bursaria_Chlorella_virus	2.8e-24	29.0

DBSCAN-SWA_97

1311804 : 1313470

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296656.1\|1311804_1312518_+	HAD family phosphatase	A0A1D8KPI1	Synechococcus_phage	5.4e-06	23.0
WP_002296658.1\|1312724_1312874_-	hypothetical protein	NA	NA	NA	NA
WP_002293303.1\|1313269_1313470_+	cold-shock protein	Q9AZD3	Lactococcus_phage	3.9e-23	77.3

DBSCAN-SWA_98

1318483 : 1322562

Archaeal_BJ1_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296670.1\|1318483_1319341_+	glycosyltransferase family 8 protein	A0ZYL4	Archaeal_BJ1_virus	1.3e-19	27.1
WP_002296671.1\|1319333_1320236_+	glycosyltransferase family 8 protein	NA	NA	NA	NA
WP_002296672.1\|1320268_1320619_+	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_002303839.1\|1320667_1321591_+	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_002296675.1\|1321668_1322562_+	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	8.9e-59	46.0

DBSCAN-SWA_99

1346470 : 1348000

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288179.1\|1346470_1348000_-	alkyl hydroperoxide reductase subunit F	A0A249XZT7	Enterococcus_phage	3.9e-38	33.0

DBSCAN-SWA_100

1365960 : 1369032

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002295921.1\|1365960_1367127_+	class I SAM-dependent methyltransferase	A0A2K9L4K8	Tupanvirus	1.6e-47	39.3
WP_002295919.1\|1367356_1368004_+	PepSY domain-containing protein	NA	NA	NA	NA
WP_002295918.1\|1368087_1369032_+	dihydroorotate oxidase	A0A1V0SH91	Hokovirus	5.2e-65	44.4

DBSCAN-SWA_101

1372259 : 1375271

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002303824.1\|1372259_1372949_+	hypothetical protein	U5PU21	Bacillus_phage	3.7e-20	36.5
WP_002295913.1\|1372954_1373911_+	sce7725 family protein	NA	NA	NA	NA
WP_002295912.1\|1373954_1374467_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002295911.1\|1374722_1375271_-	AAA family ATPase	S4W1R9	Pandoravirus	3.3e-11	29.4

DBSCAN-SWA_102

1386103 : 1388366

Staphylococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286075.1\|1386103_1386952_+	DegV family protein	A0A0N9SI50	Staphylococcus_phage	9.8e-15	37.4
WP_002296623.1\|1387070_1388366_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5

DBSCAN-SWA_103

1401148 : 1403810

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002311113.1\|1401148_1401823_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.9e-29	35.3
WP_002311114.1\|1402044_1403118_+	ABC transporter permease	NA	NA	NA	NA
WP_002286060.1\|1403123_1403810_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.9e-29	37.0

DBSCAN-SWA_104

1427996 : 1430225

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002322737.1\|1427996_1430225_-	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	1.6e-128	52.6

DBSCAN-SWA_105

1433399 : 1434170

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289629.1\|1433399_1434170_-	ATP-binding cassette domain-containing protein	W6JKT0	Anomala_cuprea_entomopoxvirus	9.6e-09	27.3

DBSCAN-SWA_106

1449206 : 1455508

Halovirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288877.1\|1449206_1450283_-	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	5.2e-61	36.4
WP_002288875.1\|1450287_1451568_-	dihydroorotase	NA	NA	NA	NA
WP_002288872.1\|1451586_1452513_-	aspartate carbamoyltransferase catalytic subunit	M1HWF9	Paramecium_bursaria_Chlorella_virus	3.6e-26	33.0
WP_002288870.1\|1452525_1453809_-	uracil transporter	Q9KX94	Enterobacteria_phage	3.2e-65	37.3
WP_002295862.1\|1453822_1454362_-	bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR	NA	NA	NA	NA
WP_002295861.1\|1454596_1455508_-	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	2.4e-11	29.1

DBSCAN-SWA_107

1459044 : 1459278

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002303804.1\|1459044_1459278_+	cold shock domain-containing protein	Q9AZD3	Lactococcus_phage	5.6e-13	49.2

DBSCAN-SWA_108

1462403 : 1467259

Tupanvirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296111.1\|1462403_1465046_-\|tRNA	alanine--tRNA ligase	A0A2K9L3D8	Tupanvirus	9.7e-69	34.4
WP_002289191.1\|1465433_1465865_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002377999.1\|1465909_1467259_-	DEAD/DEAH box helicase	A0A1V0SIR5	Klosneuvirus	1.4e-50	31.7

DBSCAN-SWA_109

1471599 : 1474118

Emiliania_huxleyi_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289186.1\|1471599_1472790_-	glycine C-acetyltransferase	D2TEZ5	Emiliania_huxleyi_virus	3.7e-52	33.3
WP_002289185.1\|1473434_1474118_-	HD domain-containing protein	A0A1D6Y7U0	Golden_Marseillevirus	2.5e-13	29.9

DBSCAN-SWA_110

1478616 : 1479264

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289604.1\|1478616_1479264_+	Holliday junction resolvase RecU	A0A2H4J3A4	uncultured_Caudovirales_phage	1.7e-22	37.5

DBSCAN-SWA_111

1483274 : 1483973

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289610.1\|1483274_1483973_-	DnaD domain protein	A0A0N7AE27	Bacillus_phage	4.9e-12	42.5

DBSCAN-SWA_112

1488864 : 1490818

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296093.1\|1488864_1489791_-	cysteine synthase A	A0A1X9I5K7	Streptococcus_phage	2.7e-98	57.2
WP_002295819.1\|1489930_1490818_-	glucosaminidase domain-containing protein	A0A0K2CP65	Brevibacillus_phage	4.5e-18	43.2

DBSCAN-SWA_113

1494627 : 1498761

Phage_Wrath(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296572.1\|1494627_1495251_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	2.2e-16	59.4
WP_002297436.1\|1495430_1495649_+	hypothetical protein	NA	NA	NA	NA
WP_002295813.1\|1495937_1496450_-	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	2.4e-32	43.6
WP_002296571.1\|1496463_1498761_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	1.3e-80	33.9

DBSCAN-SWA_114

1504753 : 1508964

Pithovirus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289735.1\|1504753_1505689_-	alpha/beta hydrolase	W5S4D8	Pithovirus	2.0e-05	25.4
WP_002303791.1\|1505874_1506834_+\|transposase	IS30-like element IS6770 family transposase	NA	NA	NA	NA
WP_002295800.1\|1506919_1508014_-	DUF871 domain-containing protein	NA	NA	NA	NA
WP_002296283.1\|1508202_1508964_+	peptidylprolyl isomerase	A0A1V0S9I2	Catovirus	6.7e-23	38.0

DBSCAN-SWA_115

1512839 : 1516985

Lysinibacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297185.1\|1512839_1514135_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4
WP_002295789.1\|1514503_1515004_-	CBS domain-containing protein	NA	NA	NA	NA
WP_002288030.1\|1515110_1515629_-	metallophosphoesterase	NA	NA	NA	NA
WP_061573514.1\|1515629_1516985_-	ribonuclease PH	A0A0P0A2M4	Ugandan_cassava_brown_streak_virus	1.6e-14	30.4

DBSCAN-SWA_116

1520131 : 1520869

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296877.1\|1520131_1520869_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.7e-32	38.6

DBSCAN-SWA_117

1524727 : 1530212

Orpheovirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002295783.1\|1524727_1525771_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2I2L4E3	Orpheovirus	1.9e-31	33.6
WP_002303789.1\|1526079_1526421_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002296885.1\|1526489_1530212_-	helicase-exonuclease AddAB subunit AddA	S5MMD7	Bacillus_phage	2.7e-24	23.3

DBSCAN-SWA_118

1534006 : 1536941

Lysinibacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297218.1\|1534006_1535302_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002288052.1\|1535474_1536941_-	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	3.4e-87	38.6

DBSCAN-SWA_119

1543834 : 1547516

Enterococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289111.1\|1543834_1544473_+	LysM peptidoglycan-binding domain-containing protein	A0A249XZV3	Enterococcus_phage	4.9e-35	53.6
WP_002297227.1\|1545407_1545908_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002289113.1\|1546097_1546442_-	metal-sulfur cluster assembly factor	NA	NA	NA	NA
WP_002289114.1\|1546595_1547516_-	YitT family protein	M1Q1P6	Streptococcus_phage	1.3e-23	30.0

DBSCAN-SWA_120

1550918 : 1555422

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289118.1\|1550918_1551545_+	MBL fold metallo-hydrolase	A0A1X9I5D3	Streptococcus_phage	5.3e-50	50.5
WP_002289120.1\|1551567_1552272_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_002289121.1\|1552463_1553297_+	undecaprenyl-diphosphate phosphatase	NA	NA	NA	NA
WP_002289122.1\|1553493_1555422_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	4.2e-106	38.5

DBSCAN-SWA_121

1558580 : 1561386

Clostridium_botulinum_C_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002322120.1\|1558580_1560854_-	DNA internalization-related competence protein ComEC/Rec2	Q332C0	Clostridium_botulinum_C_phage	1.3e-32	31.3
WP_002295503.1\|1560846_1561386_-	ComE operon protein 2	A7KUY9	Bacillus_phage	5.4e-35	58.3

DBSCAN-SWA_122

1572113 : 1573886

Acanthamoeba_polyphaga_mimivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288736.1\|1572113_1573886_-	DNA helicase RecQ	A0A0G2Y8K9	Acanthamoeba_polyphaga_mimivirus	3.6e-83	37.3

DBSCAN-SWA_123

1577353 : 1578760

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289686.1\|1577353_1578760_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	2.8e-46	28.5

DBSCAN-SWA_124

1582985 : 1610233

Prochlorococcus_phage(15.38%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297114.1\|1582985_1584410_-	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	1.1e-18	24.1
WP_002287992.1\|1584673_1585651_-	GMP reductase	G3MBI2	Bacillus_virus	2.7e-149	80.4
WP_002287993.1\|1585907_1587113_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_002287995.1\|1587114_1588641_-	sugar ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	8.2e-12	30.1
WP_002287997.1\|1588694_1589783_-	sugar-binding protein	NA	NA	NA	NA
WP_002287999.1\|1590002_1591019_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002288002.1\|1591032_1592484_+	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	4.1e-21	29.1
WP_002288004.1\|1592476_1594042_+	response regulator	NA	NA	NA	NA
WP_002297218.1\|1594236_1595532_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A2D1GQC1	Lysinibacillus_phage	2.1e-08	20.9
WP_002288005.1\|1595696_1596611_-	aldo/keto reductase	NA	NA	NA	NA
WP_002288007.1\|1596732_1598007_-	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
WP_002288009.1\|1598022_1599558_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	1.2e-74	48.9
WP_002288010.1\|1599554_1600133_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-26	37.4
WP_002288011.1\|1600129_1601182_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SE90	Cyanophage	2.7e-62	43.7
WP_002288013.1\|1601204_1602644_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.3e-53	33.1
WP_002288015.1\|1602628_1604851_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.9e-150	41.3
WP_002288017.1\|1604851_1605523_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_002295474.1\|1605524_1605779_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_002288021.1\|1605778_1606507_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	E3SPA9	Prochlorococcus_phage	4.6e-45	41.4
WP_002297115.1\|1606762_1607140_+	hypothetical protein	NA	NA	NA	NA
WP_002288023.1\|1607319_1608615_-	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	4.5e-19	33.1
WP_002288025.1\|1608627_1609752_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_002303771.1\|1609744_1610233_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	1.9e-23	42.7

DBSCAN-SWA_125

1619449 : 1620067

Clostridium_botulinum_C_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002295461.1\|1619449_1620067_-	glycoside hydrolase family 73 protein	Q332B8	Clostridium_botulinum_C_phage	3.4e-25	41.1

DBSCAN-SWA_126

1629287 : 1630322

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002321171.1\|1629287_1630322_-	lactate dehydrogenase	A0A2R8FDS8	Brazilian_cedratvirus	1.1e-23	34.3

DBSCAN-SWA_127

1640786 : 1641410

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002326685.1\|1640786_1641410_+	LysM peptidoglycan-binding domain-containing protein	A0A249XZV3	Enterococcus_phage	3.9e-37	56.4

DBSCAN-SWA_128

1646254 : 1647220

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289763.1\|1646254_1647220_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.0e-27	36.9

DBSCAN-SWA_129

1658594 : 1665610

Bacillus_virus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289265.1\|1658594_1660826_-	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	2.4e-169	42.5
WP_002296998.1\|1661102_1663553_-	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	7.1e-98	31.6
WP_002303746.1\|1663564_1665610_-	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	2.4e-115	41.3

DBSCAN-SWA_130

1668872 : 1677200

Erwinia_phage(25.0%)

protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288421.1\|1668872_1670273_-\|protease	ATP-dependent protease ATPase subunit HslU	A0A173GFL6	Erwinia_phage	1.7e-43	28.8
WP_002288419.1\|1670286_1670835_-	HslU--HslV peptidase proteolytic subunit	NA	NA	NA	NA
WP_002288415.1\|1670871_1671777_-	tyrosine recombinase XerC	A0A0K2CP59	Brevibacillus_phage	9.4e-32	29.4
WP_002320953.1\|1671974_1673351_-\|tRNA	FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO	NA	NA	NA	NA
WP_002288411.1\|1673319_1675398_-	type I DNA topoisomerase	A0A167R9A0	Powai_lake_megavirus	1.2e-101	38.5
WP_002303743.1\|1675519_1676377_-	DNA-protecting protein DprA	NA	NA	NA	NA
WP_002296990.1\|1676432_1677200_-	ribonuclease HII	D2TEQ2	Emiliania_huxleyi_virus	2.7e-27	39.5

DBSCAN-SWA_131

1682807 : 1687890

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288394.1\|1682807_1683650_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	6.5e-19	40.2
WP_002288393.1\|1683781_1684435_+	hemolysin III family protein	NA	NA	NA	NA
WP_002288392.1\|1684497_1685025_-	dihydrofolate reductase	A0A1D6X864	Bacillus_phage	6.7e-22	37.1
WP_002294416.1\|1685044_1685992_-	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	7.1e-123	64.6
WP_002288390.1\|1686003_1687890_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	2.6e-52	29.8

DBSCAN-SWA_132

1691386 : 1694062

unidentified_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002294414.1\|1691386_1692595_-\|tRNA	CCA tRNA nucleotidyltransferase	H7BUW3	unidentified_phage	1.5e-45	51.7
WP_002290045.1\|1692706_1693039_-	nucleotide pyrophosphohydrolase	NA	NA	NA	NA
WP_002294412.1\|1693186_1694062_+	YitT family protein	M1Q1P6	Streptococcus_phage	5.9e-63	45.3

DBSCAN-SWA_133

1697272 : 1697548

Geobacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002290178.1\|1697272_1697548_-	HU family DNA-binding protein	A0A0H3UZA0	Geobacillus_virus	1.8e-26	69.7

DBSCAN-SWA_134

1702076 : 1703480

Acanthamoeba_polyphaga_mimivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002311164.1\|1702076_1703480_-	ATP-dependent DNA helicase RecQ	A0A0G2Y8K9	Acanthamoeba_polyphaga_mimivirus	6.5e-64	35.5

DBSCAN-SWA_135

1710945 : 1713543

uncultured_Mediterranean_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296975.1\|1710945_1711515_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	1.5e-14	32.7
WP_002296973.1\|1711498_1712296_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.1e-07	25.0
WP_002294387.1\|1712265_1712637_-	protein RibT	NA	NA	NA	NA
WP_002294386.1\|1712655_1713543_-	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	1.2e-31	29.7

DBSCAN-SWA_136

1717594 : 1723066

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289498.1\|1717594_1718704_-	RNA polymerase sigma factor RpoD	F4YCU2	Synechococcus_phage	9.8e-39	38.9
WP_002289497.1\|1718727_1720569_-	DNA primase	A0A1S5RH70	Helicobacter_phage	1.2e-49	32.1
WP_002303731.1\|1720750_1723066_-	cation-translocating P-type ATPase	M1HBF8	Paramecium_bursaria_Chlorella_virus	9.2e-39	26.2

DBSCAN-SWA_137

1728534 : 1732708

Aureococcus_anophage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289463.1\|1728534_1729722_-	elongation factor Tu	A0A076FFS6	Aureococcus_anophage	1.3e-33	28.5
WP_002289464.1\|1730089_1730446_+	YxeA family protein	NA	NA	NA	NA
WP_002294378.1\|1730686_1731691_-	nucleoid-associated protein	NA	NA	NA	NA
WP_002289273.1\|1731856_1732708_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	1.4e-53	41.4

DBSCAN-SWA_138

1739108 : 1741775

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002294372.1\|1739108_1741775_-	cation-translocating P-type ATPase	M1HJQ2	Paramecium_bursaria_Chlorella_virus	1.6e-82	30.1

DBSCAN-SWA_139

1757233 : 1758025

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288287.1\|1757233_1758025_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.4e-18	29.4

DBSCAN-SWA_140

1762403 : 1762826

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288294.1\|1762403_1762826_+	arsenate reductase (thioredoxin)	A0A2H4PQT9	Staphylococcus_phage	2.0e-29	48.9

DBSCAN-SWA_141

1772929 : 1774180

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287107.1\|1772929_1774180_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.0e-113	63.3

DBSCAN-SWA_142

1797203 : 1798499

Lysinibacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297185.1\|1797203_1798499_+\|transposase	ISL3-like element ISEfa5 family transposase	A0A2D1GQC1	Lysinibacillus_phage	3.8e-10	21.4

DBSCAN-SWA_143

1805876 : 1809679

Ectocarpus_siliculosus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002298265.1\|1805876_1807382_-	HAMP domain-containing histidine kinase	Q8QNA2	Ectocarpus_siliculosus_virus	3.9e-06	25.1
WP_002290973.1\|1807378_1808065_-	response regulator transcription factor	W8CYM9	Bacillus_phage	4.8e-28	31.2
WP_002295350.1\|1808257_1809679_-	NADP-dependent phosphogluconate dehydrogenase	A0A1D8KPW3	Synechococcus_phage	4.2e-34	31.1

DBSCAN-SWA_144

1814765 : 1823937

Streptomyces_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002311576.1\|1814765_1818080_-	DNA polymerase III subunit alpha	R4TB75	Streptomyces_phage	1.8e-149	33.0
WP_002295359.1\|1818310_1818496_+	YjzD family protein	NA	NA	NA	NA
WP_002290958.1\|1818557_1819754_-	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_002295362.1\|1819923_1821360_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	3.8e-43	29.0
WP_002296740.1\|1821652_1822462_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_061573519.1\|1822641_1823937_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	2.5e-54	37.2

DBSCAN-SWA_145

1827677 : 1832004

Tupanvirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287651.1\|1827677_1829618_-\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	3.3e-114	35.2
WP_002287649.1\|1829954_1830134_-	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_002287647.1\|1830180_1832004_-	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	6.5e-64	29.1

DBSCAN-SWA_146

1839398 : 1840049

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287632.1\|1839398_1840049_-	nicotinate-nucleotide adenylyltransferase	G3MA22	Bacillus_virus	4.9e-22	33.2

DBSCAN-SWA_147

1847410 : 1848148

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287617.1\|1847410_1848148_-	3-oxoacyl-[acyl-carrier-protein] reductase	Q06VL0	Trichoplusia_ni_ascovirus	4.1e-17	29.7

DBSCAN-SWA_148

1855942 : 1863324

Hokovirus(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287603.1\|1855942_1857670_-	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	9.3e-20	35.9
WP_002287602.1\|1857669_1857936_-	phosphocarrier protein HPr	NA	NA	NA	NA
WP_002287598.1\|1858414_1860649_+\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A223W0B1	Agrobacterium_phage	5.1e-127	39.1
WP_002290825.1\|1860796_1861117_+	DUF1827 family protein	NA	NA	NA	NA
WP_002287661.1\|1861321_1861546_-	hypothetical protein	NA	NA	NA	NA
WP_002295394.1\|1861743_1863324_-	peptide chain release factor 3	A0A1B0RXH7	Streptococcus_phage	5.1e-33	28.4

DBSCAN-SWA_149

1869702 : 1965433

112

Enterococcus_phage(22.22%)

transposase,head,terminase,integrase,holin,protease,portal,tail,capsid

attL 1912168:1912183|attR 1969692:1969707

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002295399.1\|1869702_1871085_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	3.5e-86	37.4
WP_002292856.1\|1871258_1871837_-	lytic polysaccharide monooxygenase	A0A0K1Y848	Apis_mellifera_filamentous_virus	9.7e-14	34.4
WP_061573520.1\|1872829_1874125_+\|transposase	ISL3 family transposase	A0A2D1GQC1	Lysinibacillus_phage	9.4e-09	20.9
WP_002295400.1\|1874258_1875485_-	LCP family protein	NA	NA	NA	NA
WP_002292860.1\|1876238_1876439_-	cold-shock protein	Q9AZD3	Lactococcus_phage	7.6e-19	67.7
WP_002295401.1\|1876572_1877181_-	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	7.7e-70	60.1
WP_002292862.1\|1877265_1877736_-	GtrA family protein	NA	NA	NA	NA
WP_002317368.1\|1877783_1878698_-	cation transporter	A0A1V0SED0	Indivirus	2.1e-10	31.5
WP_002289147.1\|1878843_1879647_+	DUF1189 domain-containing protein	NA	NA	NA	NA
WP_002289148.1\|1879824_1880772_+	phosphoglycerate dehydrogenase	NA	NA	NA	NA
WP_002296127.1\|1880880_1882428_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_002287659.1\|1882529_1882883_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_002285758.1\|1882872_1883067_-	hypothetical protein	NA	NA	NA	NA
WP_002289149.1\|1883322_1883616_-	iron-sulfur cluster biosynthesis protein	NA	NA	NA	NA
WP_002289151.1\|1883643_1884309_-	TrkA family potassium uptake protein	NA	NA	NA	NA
WP_002295404.1\|1884448_1885081_-	response regulator transcription factor	NA	NA	NA	NA
WP_002312578.1\|1885087_1886155_-	sensor histidine kinase	NA	NA	NA	NA
WP_002295408.1\|1886151_1886883_-	cell wall-active antibiotics response protein	NA	NA	NA	NA
WP_002295409.1\|1887050_1887530_-	transcription elongation factor GreA	NA	NA	NA	NA
WP_002295410.1\|1887665_1888841_-	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_002297066.1\|1889005_1890166_+	serine hydrolase	A0A2R4AS58	Mycobacterium_phage	3.2e-08	25.2
WP_002297065.1\|1890205_1891153_-	NAD-dependent epimerase/dehydratase family protein	A0A1V0SKV4	Klosneuvirus	2.3e-52	38.2
WP_002297064.1\|1891185_1892601_-	O-antigen ligase family protein	NA	NA	NA	NA
WP_002321507.1\|1892597_1893713_-	glycosyltransferase	NA	NA	NA	NA
WP_002297062.1\|1893769_1895305_-	hypothetical protein	NA	NA	NA	NA
WP_002297061.1\|1895327_1896302_-	glycosyltransferase family 2 protein	A0A0F7L2F7	uncultured_marine_virus	2.5e-06	35.2
WP_002297060.1\|1896346_1897312_-	glycosyltransferase	A0A0F7L2F7	uncultured_marine_virus	2.5e-06	34.6
WP_002321509.1\|1897304_1898372_-	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_002297058.1\|1898379_1899081_-	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	NA	NA	NA	NA
WP_002312566.1\|1899077_1899932_-	LicD family protein	NA	NA	NA	NA
WP_002321510.1\|1899964_1900768_-	glycosyltransferase	F2Y1U7	Organic_Lake_phycodnavirus	5.1e-13	31.5
WP_002295430.1\|1900826_1902218_-	sugar transferase	NA	NA	NA	NA
WP_002297271.1\|1902552_1903512_+\|transposase	IS30-like element IS6770 family transposase	NA	NA	NA	NA
WP_002296538.1\|1903579_1905718_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_002296539.1\|1905756_1907343_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_002296541.1\|1907332_1908553_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.3e-11	26.4
WP_002289081.1\|1908564_1909371_-	ABC transporter permease	NA	NA	NA	NA
WP_002296542.1\|1909580_1910861_-	EpaQ family protein	NA	NA	NA	NA
WP_002296543.1\|1910904_1912938_-	hypothetical protein	NA	NA	NA	NA
1912168:1912183	attL	NA	NA	NA	NA
WP_002294531.1\|1912972_1913824_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.3e-38	39.0
WP_002296544.1\|1913921_1914950_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	2.2e-69	43.2
WP_002286442.1\|1914971_1915544_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	8.3e-42	49.2
WP_002286449.1\|1915557_1916424_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	3.7e-102	62.5
WP_002321540.1\|1916523_1917258_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_002286453.1\|1917235_1918063_-	glycosyltransferase	NA	NA	NA	NA
WP_002286455.1\|1918062_1918863_-	glycosyltransferase	NA	NA	NA	NA
WP_002286457.1\|1918855_1919995_-	undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase	NA	NA	NA	NA
WP_002286461.1\|1920070_1920994_-	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_002294533.1\|1921025_1921790_-	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_002286465.1\|1921947_1922388_+	flavodoxin	NA	NA	NA	NA
WP_002286467.1\|1922565_1923135_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002286469.1\|1923388_1924621_+	aminopeptidase	NA	NA	NA	NA
WP_002286470.1\|1924925_1925126_+\|integrase	tyrosine-type recombinase/integrase	Q9AZR0	Lactococcus_phage	4.6e-08	75.7
WP_002286680.1\|1925374_1925677_+	hypothetical protein	NA	NA	NA	NA
WP_002286473.1\|1925712_1926084_-	hypothetical protein	NA	NA	NA	NA
WP_002296902.1\|1926085_1926487_-	hypothetical protein	NA	NA	NA	NA
WP_002286474.1\|1926500_1926908_-	hypothetical protein	NA	NA	NA	NA
WP_087046766.1\|1927830_1928993_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.1e-80	54.2
WP_002286484.1\|1929932_1930958_-	N-acetylmuramoyl-L-alanine amidase	A0A139ZVY1	Enterococcus_phage	2.1e-64	61.3
WP_002286683.1\|1930954_1931179_-\|holin	phage holin	NA	NA	NA	NA
WP_002286686.1\|1931175_1931469_-	hypothetical protein	NA	NA	NA	NA
WP_002296594.1\|1931506_1931644_-	XkdX family protein	NA	NA	NA	NA
WP_002286491.1\|1931645_1932092_-	hypothetical protein	NA	NA	NA	NA
WP_002290627.1\|1932088_1932238_-	hypothetical protein	NA	NA	NA	NA
WP_002286495.1\|1932254_1934381_-	hypothetical protein	A0A060AI60	Enterococcus_phage	1.4e-62	40.1
WP_002296595.1\|1934404_1936696_-\|tail	phage tail protein	A0A1D3SNL1	Enterococcus_phage	1.6e-88	30.0
WP_002286500.1\|1936705_1937443_-\|tail	phage tail protein	NA	NA	NA	NA
WP_002286502.1\|1937493_1940925_-\|tail	phage tail tape measure protein	A0A1D3SNL5	Enterococcus_phage	3.1e-67	44.4
WP_002286510.1\|1941126_1941489_-	hypothetical protein	NA	NA	NA	NA
WP_002286512.1\|1941508_1942117_-	hypothetical protein	Q8W5Z9	Listeria_phage	3.0e-34	41.1
WP_002286516.1\|1942128_1942533_-	hypothetical protein	R4IBU7	Listeria_phage	6.1e-07	29.5
WP_002296598.1\|1942525_1942927_-	hypothetical protein	A0A1B1P759	Bacillus_phage	1.1e-13	33.3
WP_002286522.1\|1942916_1943270_-\|head	phage head closure protein	NA	NA	NA	NA
WP_002286523.1\|1943259_1943571_-	hypothetical protein	A0A1B1P751	Bacillus_phage	6.3e-12	42.1
WP_002286524.1\|1943567_1944443_-	hypothetical protein	D2IYX3	Enterococcus_phage	5.6e-130	74.2
WP_002286525.1\|1944452_1945613_-\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	1.8e-99	50.1
WP_002286527.1\|1945612_1946299_-\|protease	Clp protease ClpP	A0A2I6PDD0	Staphylococcus_phage	1.0e-30	39.7
WP_002286530.1\|1946261_1947440_-\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	5.4e-80	40.4
WP_002286533.1\|1947459_1949154_-\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	3.0e-148	49.6
WP_002286538.1\|1949131_1949446_-\|terminase	terminase	A0A1S7FYW6	Listeria_phage	3.3e-08	37.9
WP_002296599.1\|1949548_1949830_-	hypothetical protein	NA	NA	NA	NA
WP_002286540.1\|1949834_1950179_-	HNH endonuclease	A0A1B1P757	Bacillus_phage	3.8e-26	57.1
WP_002296600.1\|1950204_1950372_-	thymidylate synthase	NA	NA	NA	NA
WP_002311723.1\|1950567_1950774_-	hypothetical protein	NA	NA	NA	NA
WP_002300143.1\|1951227_1951503_+	hypothetical protein	A0A2H4JEH2	uncultured_Caudovirales_phage	9.9e-17	45.7
WP_002296602.1\|1951499_1951652_-	hypothetical protein	NA	NA	NA	NA
WP_002286542.1\|1951960_1952374_-	autolysin	C9E2P5	Enterococcus_phage	1.5e-56	81.0
WP_002286693.1\|1952450_1952747_-	hypothetical protein	NA	NA	NA	NA
WP_002286545.1\|1952743_1953301_-	DUF1642 domain-containing protein	A0A0C5KKV2	Enterococcus_phage	2.8e-10	36.2
WP_061573521.1\|1953297_1953717_-	YopX family protein	D2IZL0	Enterococcus_phage	4.5e-29	53.6
WP_002322165.1\|1953713_1953932_-	hypothetical protein	NA	NA	NA	NA
WP_002286550.1\|1953918_1954275_-	DUF1140 family protein	A0A2H4JAZ4	uncultured_Caudovirales_phage	3.1e-10	37.4
WP_002286694.1\|1954274_1954580_-	hypothetical protein	NA	NA	NA	NA
WP_002296606.1\|1954576_1954738_-	antitoxin	NA	NA	NA	NA
WP_002286695.1\|1954734_1955037_-	hypothetical protein	NA	NA	NA	NA
WP_002296607.1\|1955029_1955194_-	hypothetical protein	NA	NA	NA	NA
WP_002286696.1\|1955198_1955468_-	hypothetical protein	NA	NA	NA	NA
WP_002286552.1\|1955479_1956229_-	helix-turn-helix domain-containing protein	A0A1L2BY83	Clostridium_phage	1.7e-31	54.0
WP_002286553.1\|1956231_1956918_-	hypothetical protein	C9E2N1	Enterococcus_phage	3.2e-88	69.1
WP_002286557.1\|1956923_1957595_-	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	4.2e-29	47.4
WP_002286559.1\|1957587_1957929_-	hypothetical protein	NA	NA	NA	NA
WP_002286562.1\|1958106_1958805_-	phage regulatory protein	D2IYT0	Enterococcus_phage	1.7e-25	34.6
WP_002286568.1\|1958891_1959362_+	hypothetical protein	NA	NA	NA	NA
WP_002296610.1\|1959404_1959584_-	hypothetical protein	NA	NA	NA	NA
WP_002286573.1\|1959570_1959909_-	DUF771 domain-containing protein	NA	NA	NA	NA
WP_002296611.1\|1959924_1960128_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002296612.1\|1961217_1961538_+	helix-turn-helix transcriptional regulator	A0A1S5SDR1	Streptococcus_phage	2.0e-13	40.2
WP_002296613.1\|1961555_1961987_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_002303013.1\|1962116_1962578_+	SHOCT domain-containing protein	A0A0F6N4L7	Staphylococcus_phage	4.5e-06	34.8
WP_002296616.1\|1962611_1963247_+	hypothetical protein	NA	NA	NA	NA
WP_002296617.1\|1963359_1963995_+	hypothetical protein	NA	NA	NA	NA
WP_002286587.1\|1964293_1965433_+\|integrase	site-specific integrase	Q9AZR0	Lactococcus_phage	2.6e-95	47.1
1969692:1969707	attR	NA	NA	NA	NA

DBSCAN-SWA_150

1973334 : 1974612

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286608.1\|1973334_1974612_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.8e-35	28.8

DBSCAN-SWA_151

1977720 : 1982094

Cyanophage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286618.1\|1977720_1979247_+	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	8.9e-75	35.3
WP_002286621.1\|1979295_1982094_-\|tRNA	isoleucine--tRNA ligase	A0A2H4UVG0	Bodo_saltans_virus	1.6e-74	26.4

DBSCAN-SWA_152

2003103 : 2005296

Acanthamoeba_polyphaga_moumouvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286658.1\|2003103_2004441_-	exodeoxyribonuclease VII large subunit	L7RDW5	Acanthamoeba_polyphaga_moumouvirus	6.7e-26	29.5
WP_002286660.1\|2004441_2005296_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	6.8e-40	38.7

DBSCAN-SWA_153

2024437 : 2025178

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288100.1\|2024437_2025178_-	MBL fold metallo-hydrolase	S4VYV9	Pandoravirus	3.9e-07	26.3

DBSCAN-SWA_154

2028822 : 2046340

Streptococcus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288090.1\|2028822_2030028_-	D-alanyl-lipoteichoic acid biosynthesis protein DltB	A0A125RNP0	Pseudomonas_phage	1.4e-19	30.7
WP_002288089.1\|2030024_2031539_-	D-alanine--poly(phosphoribitol) ligase subunit DltA	A0A2K9KZV5	Tupanvirus	3.4e-42	28.5
WP_002288113.1\|2031549_2031699_-	teichoic acid D-Ala incorporation-associated protein DltX	NA	NA	NA	NA
WP_002288087.1\|2031979_2034022_-	ABC transporter permease	NA	NA	NA	NA
WP_002304285.1\|2034011_2034779_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.0e-32	35.2
WP_002288083.1\|2035104_2037294_+	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	1.8e-286	66.6
WP_002288081.1\|2037608_2038211_+	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	1.7e-53	58.6
WP_002294035.1\|2038264_2039386_-	DNA polymerase IV	NA	NA	NA	NA
WP_002288078.1\|2039494_2040367_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	3.1e-88	60.4
WP_002288076.1\|2040435_2040783_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	5.1e-18	41.1
WP_002288073.1\|2040775_2041600_-	stage 0 sporulation family protein	NA	NA	NA	NA
WP_002288071.1\|2041635_2042574_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	3.3e-35	34.4
WP_002292340.1\|2042587_2042917_-	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_002294039.1\|2042931_2043576_-	dTMP kinase	M1PSC7	Streptococcus_phage	4.2e-58	52.6
WP_002296223.1\|2043639_2044236_-	recombination protein RecR	NA	NA	NA	NA
WP_002292337.1\|2044260_2044575_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_002294042.1\|2044594_2046340_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	1.9e-49	36.3

DBSCAN-SWA_155

2061687 : 2070608

Only_Syngen_Nebraska_virus(25.0%)

integrase,transposase

attL 2057019:2057035|attR 2076779:2076795

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2057019:2057035	attL	NA	NA	NA	NA
WP_002286999.1\|2061687_2063298_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	2.3e-145	48.4
WP_002287001.1\|2064490_2065831_-	type I glutamate--ammonia ligase	A0A1V0SJ53	Klosneuvirus	9.1e-07	25.6
WP_002287002.1\|2065858_2066251_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_000222572.1\|2066559_2067513_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002287014.1\|2067626_2068757_-	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	A0A218MNE0	uncultured_virus	6.0e-84	45.3
WP_002287015.1\|2069405_2070608_-\|integrase	tyrosine-type recombinase/integrase	A0A0S2MV79	Bacillus_phage	1.1e-32	28.5
2076779:2076795	attR	NA	NA	NA	NA

DBSCAN-SWA_156

2086509 : 2095786

Mycoplasma_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287038.1\|2086509_2087316_-	ABC transporter permease	Q6GZ02	Mycoplasma_phage	7.9e-14	27.6
WP_002287039.1\|2087327_2088413_-	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	4.0e-37	45.0
WP_002287040.1\|2088429_2088972_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002287041.1\|2089229_2090219_+	oxidoreductase	NA	NA	NA	NA
WP_002287044.1\|2090215_2090953_+	phosphopantothenate--cysteine ligase	NA	NA	NA	NA
WP_002287045.1\|2090949_2091501_+	phosphopantothenoylcysteine decarboxylase	A0A1V0S7W6	Shearwaterpox_virus	3.2e-30	41.2
WP_002287046.1\|2091516_2092149_+	ECF transporter S component	NA	NA	NA	NA
WP_002296930.1\|2092233_2092881_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_002287048.1\|2092885_2093869_+	NAD(P)H-quinone oxidoreductase	NA	NA	NA	NA
WP_002287050.1\|2094271_2095786_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	8.3e-49	30.3

DBSCAN-SWA_157

2103710 : 2109276

Cafeteria_roenbergensis_virus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002297274.1\|2103710_2104463_+	exodeoxyribonuclease III	E3T4M6	Cafeteria_roenbergensis_virus	2.9e-58	47.1
WP_002291442.1\|2105326_2105860_+	exonuclease	A0A1S5SFA9	Streptococcus_phage	5.9e-26	43.4
WP_002287063.1\|2106349_2106874_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002287066.1\|2106866_2107340_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_002287068.1\|2107462_2108443_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_002287070.1\|2108595_2109276_-	uracil-DNA glycosylase	A0A0B5IW78	Pandoravirus	7.3e-45	43.3

DBSCAN-SWA_158

2113047 : 2113797

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287078.1\|2113047_2113797_+	nicotinamide mononucleotide transporter	A0A2H4PB74	Lactobacillus_phage	5.1e-92	70.7

DBSCAN-SWA_159

2118759 : 2119665

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002287087.1\|2118759_2119665_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	6.8e-38	39.4

DBSCAN-SWA_160

2127522 : 2130404

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296175.1\|2127522_2129025_-	ABC-F type ribosomal protection protein Eat(A)	A0A1B0RXA0	Streptococcus_phage	1.4e-27	26.1
WP_002289891.1\|2129282_2130404_-	glycerate kinase	W6LM47	Streptococcus_phage	5.8e-23	31.3

DBSCAN-SWA_161

2139903 : 2149297

Planktothrix_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296186.1\|2139903_2140977_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	5.8e-28	35.5
WP_002296187.1\|2141623_2142295_-	HAD family phosphatase	NA	NA	NA	NA
WP_002304253.1\|2142381_2145060_-	magnesium-translocating P-type ATPase	M1HXH2	Paramecium_bursaria_Chlorella_virus	1.1e-48	25.6
WP_002293327.1\|2145718_2146156_+	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	4.1e-25	46.2
WP_002296189.1\|2146177_2147044_-	Rgg/GadR/MutR family transcriptional regulator	NA	NA	NA	NA
WP_002293776.1\|2147203_2149297_-	LTA synthase family protein	W6LM83	Streptococcus_phage	4.5e-162	47.1

DBSCAN-SWA_162

2154514 : 2159951

Lactobacillus_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002293834.1\|2154514_2155216_-	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	7.8e-50	48.6
WP_002293607.1\|2155231_2155672_-	nucleoside deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	8.9e-36	50.7
WP_002293608.1\|2155671_2156247_-	TIGR00730 family Rossman fold protein	A0A1D3SNB7	Enterococcus_phage	1.5e-35	44.9
WP_002293839.1\|2157732_2158434_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002293840.1\|2158541_2159951_-	family 1 glycosylhydrolase	A0A0B5JD41	Pandoravirus	6.6e-32	28.0

DBSCAN-SWA_163

2175715 : 2183472

Streptococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002291166.1\|2175715_2176354_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	5.9e-12	28.8
WP_002296200.1\|2176357_2178340_-	DUF1430 domain-containing protein	NA	NA	NA	NA
WP_002288539.1\|2178519_2179185_+	helix-turn-helix domain-containing protein	A0A2I7SCV6	Paenibacillus_phage	1.1e-05	47.8
WP_002296623.1\|2180332_2181628_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.9e-55	37.5
WP_002296918.1\|2182026_2183472_+\|transposase	IS1182-like element ISEfa7 family transposase	A0A1X9I5T2	Streptococcus_phage	1.5e-124	48.0

DBSCAN-SWA_164

2187352 : 2206733

Staphylococcus_phage(22.22%)

integrase

attL 2181891:2181908|attR 2197614:2197631

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2181891:2181908	attL	NA	NA	NA	NA
WP_002287733.1\|2187352_2188597_-	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	3.3e-19	26.9
WP_002287732.1\|2188589_2190182_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	6.8e-126	50.9
WP_002287731.1\|2190690_2191416_-	hypothetical protein	NA	NA	NA	NA
WP_002287730.1\|2191569_2191896_-	hypothetical protein	NA	NA	NA	NA
WP_002287729.1\|2191932_2192298_-	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_002296546.1\|2192334_2192550_-	helix-turn-helix transcriptional regulator	A0A139ZPI6	Marinitoga_camini_virus	4.7e-06	41.8
WP_002287726.1\|2192678_2193014_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002287725.1\|2193089_2195087_-	hypothetical protein	A0A1Z1LZK7	Bacillus_phage	5.2e-22	23.8
WP_002287723.1\|2195184_2195460_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002332746.1\|2195692_2196427_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002287705.1\|2196465_2197608_+\|integrase	site-specific integrase	A0A1S5S7K9	Streptococcus_phage	3.3e-58	34.8
WP_002287686.1\|2197702_2199094_-	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
2197614:2197631	attR	NA	NA	NA	NA
WP_002287684.1\|2199098_2199569_-	SUF system NifU family Fe-S cluster assembly protein	NA	NA	NA	NA
WP_002287683.1\|2199555_2200791_-	cysteine desulfurase	Q2XUY6	environmental_halophage	3.9e-113	47.7
WP_002287681.1\|2200787_2202074_-	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_002287679.1\|2202086_2202860_-	Fe-S cluster assembly ATPase SufC	A0A2R8FG22	Brazilian_cedratvirus	2.1e-08	28.8
WP_002287678.1\|2203056_2203905_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002287674.1\|2203928_2204615_-	ABC transporter permease	NA	NA	NA	NA
WP_002304234.1\|2204607_2205642_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	4.2e-28	35.1
WP_002291179.1\|2206036_2206375_-	glycine cleavage system protein H	NA	NA	NA	NA
WP_002295166.1\|2206376_2206733_-	arsenate reductase family protein	M1PLC0	Streptococcus_phage	2.7e-22	42.3

DBSCAN-SWA_165

2211642 : 2213300

Acanthamoeba_polyphaga_mimivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289775.1\|2211642_2212107_-	methylated-DNA--[protein]-cysteine S-methyltransferase	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	8.8e-18	38.7
WP_002289773.1\|2212352_2213300_+	glycosyltransferase family 2 protein	V5USA4	Oenococcus_phage	5.0e-84	51.0

DBSCAN-SWA_166

2222407 : 2230474

Enterococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286728.1\|2222407_2223007_+	metallophosphoesterase family protein	A0A288TXW7	Enterococcus_phage	1.5e-33	40.5
WP_002291207.1\|2223144_2224431_-	multidrug efflux MFS transporter EfmA	A0A1B0RXG2	Streptococcus_phage	4.0e-68	36.7
WP_002286736.1\|2224701_2225046_-	DUF1831 domain-containing protein	NA	NA	NA	NA
WP_002295158.1\|2225182_2226328_-	cysteine desulfurase	NA	NA	NA	NA
WP_002286741.1\|2226507_2227482_-	ribose-phosphate diphosphokinase	A0A1V0SHF7	Hokovirus	2.0e-40	32.2
WP_002286745.1\|2227561_2228437_-	dihydrolipoamide dehydrogenase	NA	NA	NA	NA
WP_002286747.1\|2228566_2230474_+	peptidase M13	E3T4I7	Cafeteria_roenbergensis_virus	2.7e-81	31.2

DBSCAN-SWA_167

2234563 : 2238902

Bacillus_virus(50.0%)

lysis

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286753.1\|2234563_2235109_-	cysteine hydrolase	G3MA16	Bacillus_virus	2.6e-24	37.4
WP_002286756.1\|2235120_2235813_-	5'-methylthioadenosine/adenosylhomocysteine nucleosidase	NA	NA	NA	NA
WP_002286760.1\|2235831_2236116_-	hypothetical protein	NA	NA	NA	NA
WP_002325125.1\|2236128_2236692_-	NUDIX hydrolase	NA	NA	NA	NA
WP_002286764.1\|2236919_2237582_+\|lysis	5-bromo-4-chloroindolyl phosphate hydrolysis family protein	NA	NA	NA	NA
WP_002286766.1\|2237705_2238902_+	toxic anion resistance protein	A0A2K9VCT6	Lactobacillus_phage	3.9e-33	29.1

DBSCAN-SWA_168

2259774 : 2260116

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286801.1\|2259774_2260116_-	type II toxin-antitoxin system PemK/MazF family toxin	A0A1S5SEX8	Streptococcus_phage	2.2e-18	43.5

DBSCAN-SWA_169

2263881 : 2265213

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286818.1\|2263881_2265213_-	FAD-containing oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	8.2e-141	57.6

DBSCAN-SWA_170

2273503 : 2274112

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286836.1\|2273503_2274112_-	LysM peptidoglycan-binding domain-containing protein	A0A249XZV3	Enterococcus_phage	2.3e-34	53.2

DBSCAN-SWA_171

2278344 : 2279091

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286846.1\|2278344_2279091_-	metal ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.1e-12	24.8

DBSCAN-SWA_172

2287629 : 2289012

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286860.1\|2287629_2289012_+	Y-family DNA polymerase	M1Q231	Streptococcus_phage	3.1e-90	40.2

DBSCAN-SWA_173

2303508 : 2306842

Lactococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289436.1\|2303508_2304426_+	cysteine synthase family protein	A0A1W6JHY1	Lactococcus_phage	8.0e-63	40.9
WP_002289438.1\|2304438_2305584_+	cystathionine gamma-synthase	NA	NA	NA	NA
WP_002289439.1\|2305754_2306213_+	S-ribosylhomocysteine lyase	NA	NA	NA	NA
WP_002289440.1\|2306371_2306842_+	glutathione peroxidase	A0A1S7DM81	Molluscum_contagiosum_virus	2.7e-06	26.8

DBSCAN-SWA_174

2313721 : 2317609

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286261.1\|2313721_2315908_-	ATP-dependent helicase	G3MA40	Bacillus_virus	2.3e-39	26.4
WP_002286265.1\|2316125_2316809_+	DUF1275 domain-containing protein	NA	NA	NA	NA
WP_002321450.1\|2316889_2317609_-	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	1.8e-49	47.7

DBSCAN-SWA_175

2329020 : 2329722

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296067.1\|2329020_2329722_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-34	39.7

DBSCAN-SWA_176

2334778 : 2336923

Clostridium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286297.1\|2334778_2336923_+	C40 family peptidase	A0A0A8WF62	Clostridium_phage	7.5e-19	44.7

DBSCAN-SWA_177

2340107 : 2340860

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286304.1\|2340107_2340860_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.9e-34	38.6

DBSCAN-SWA_178

2346880 : 2351073

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296820.1\|2346880_2347924_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.0e-53	41.1
WP_002286323.1\|2347926_2348595_-	response regulator transcription factor	W8CYM9	Bacillus_phage	6.9e-48	45.0
WP_002286325.1\|2348736_2351073_+	ABC transporter ATP-binding protein/permease	G9BWD6	Planktothrix_phage	1.1e-34	38.8

DBSCAN-SWA_179

2364800 : 2370178

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286368.1\|2364800_2366966_-	PTS transporter subunit EIIC	A0A2I7SAJ6	Vibrio_phage	1.9e-06	32.7
WP_002286373.1\|2367225_2369520_+	glycoside hydrolase family 65 protein	NA	NA	NA	NA
WP_002286375.1\|2369512_2370178_+	beta-phosphoglucomutase	M1H9H9	Acanthocystis_turfacea_Chlorella_virus	2.7e-12	27.9

DBSCAN-SWA_180

2377807 : 2382748

Pectobacterium_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286405.1\|2377807_2379064_-\|tRNA	tyrosine--tRNA ligase	A0A1L2CUL7	Pectobacterium_phage	9.0e-81	42.5
WP_002296829.1\|2379643_2380945_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_002294634.1\|2381013_2381613_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002289288.1\|2381866_2382748_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.5e-21	31.6

DBSCAN-SWA_181

2395625 : 2395940

Ostreococcus_tauri_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002294651.1\|2395625_2395940_-	rhodanese-like domain-containing protein	E4WM79	Ostreococcus_tauri_virus	3.4e-05	39.1

DBSCAN-SWA_182

2400342 : 2401059

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002292560.1\|2400342_2401059_-	aquaporin family protein	M1HVL5	Acanthocystis_turfacea_Chlorella_virus	1.6e-29	36.9

DBSCAN-SWA_183

2415756 : 2420711

Pandoravirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002298167.1\|2415756_2417253_-	glycoside hydrolase family 1 protein	A0A0B5JD41	Pandoravirus	3.4e-26	22.4
WP_002294685.1\|2417446_2419069_-	alpha-glucosidase	NA	NA	NA	NA
WP_002301172.1\|2419397_2420711_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	2.6e-46	32.1

DBSCAN-SWA_184

2442255 : 2444808

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061573530.1\|2442255_2444808_-	HAD-IC family P-type ATPase	M1I547	Acanthocystis_turfacea_Chlorella_virus	2.5e-69	29.8

DBSCAN-SWA_185

2455305 : 2499233

Synechococcus_phage(33.33%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000997695.1\|2455305_2456484_-\|transposase	IS256-like element ISEf1 family transposase	NA	NA	NA	NA
WP_002299903.1\|2456816_2457950_+	alcohol dehydrogenase catalytic domain-containing protein	E3SJ82	Synechococcus_phage	1.5e-13	24.8
WP_002287574.1\|2457980_2458301_+	YrhK family protein	NA	NA	NA	NA
WP_002299899.1\|2458329_2458794_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002287577.1\|2458922_2460176_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002299897.1\|2460204_2460522_-	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_002287582.1\|2460547_2460868_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002324343.1\|2461331_2462747_-	glycoside hydrolase family 1 protein	NA	NA	NA	NA
WP_002326704.1\|2463681_2464590_-\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA
WP_002287585.1\|2465276_2465975_-	FadR family transcriptional regulator	NA	NA	NA	NA
WP_002321245.1\|2466263_2467220_-	aldo/keto reductase	NA	NA	NA	NA
WP_002298838.1\|2467333_2468167_-	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_002319875.1\|2468341_2469976_-	membrane protein	NA	NA	NA	NA
WP_079995562.1\|2470018_2470963_-	cell surface protein	NA	NA	NA	NA
WP_000222577.1\|2471830_2472790_-\|transposase	IS30-like element IS1252 family transposase	NA	NA	NA	NA
WP_002294728.1\|2473798_2474539_-\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_002294730.1\|2474730_2475366_-	DUF998 domain-containing protein	NA	NA	NA	NA
WP_080447705.1\|2475512_2476754_-	serine/threonine transporter SstT	NA	NA	NA	NA
WP_193394790.1\|2476951_2479981_+	sulfatase-like hydrolase/transferase	NA	NA	NA	NA
WP_002324336.1\|2480040_2480757_-	DUF4767 domain-containing protein	NA	NA	NA	NA
WP_002298699.1\|2480998_2481541_-	DNA-binding protein	NA	NA	NA	NA
WP_002294740.1\|2481545_2481773_-	cation transporter	NA	NA	NA	NA
WP_002298700.1\|2481851_2483732_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	9.9e-100	34.2
WP_061573534.1\|2483921_2484536_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002349755.1\|2484677_2485238_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002351320.1\|2487879_2489520_-	membrane protein	NA	NA	NA	NA
WP_086953888.1\|2489879_2491042_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002328694.1\|2491882_2492842_-\|transposase	IS30-like element IS6770 family transposase	NA	NA	NA	NA
WP_002323136.1\|2493072_2494509_+	hypothetical protein	NA	NA	NA	NA
WP_002287852.1\|2494673_2496074_-	glutamate decarboxylase	NA	NA	NA	NA
WP_002323137.1\|2496086_2497598_-	glutamate:gamma-aminobutyrate antiporter	NA	NA	NA	NA
WP_061573536.1\|2498054_2499233_+\|transposase	IS256-like element ISEfm2 family transposase	NA	NA	NA	NA

DBSCAN-SWA_186

2505172 : 2506459

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061573537.1\|2505172_2506459_+	trypsin-like peptidase domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	4.3e-22	30.2

DBSCAN-SWA_187

2520682 : 2523810

Agrobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002293357.1\|2520682_2521207_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	1.4e-14	33.3
WP_002294161.1\|2521526_2522159_+	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_002294163.1\|2522160_2523066_-	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_002307422.1\|2523150_2523810_-	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	1.9e-58	51.8

DBSCAN-SWA_188

2548491 : 2556378

uncultured_Mediterranean_phage(33.33%)

tRNA,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002294183.1\|2548491_2549637_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	2.5e-82	40.9
WP_010777016.1\|2549854_2550553_+	DUF975 family protein	NA	NA	NA	NA
WP_061573540.1\|2550720_2553360_-	cation-translocating P-type ATPase	A0A1J0FA34	Only_Syngen_Nebraska_virus	1.6e-84	31.2
WP_002296565.1\|2553978_2555010_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_002294192.1\|2555202_2556378_+\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	1.0e-17	32.9

DBSCAN-SWA_189

2578410 : 2581912

Lactobacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002289874.1\|2578410_2578773_-	type II toxin-antitoxin system PemK/MazF family toxin	A0A291I9M9	Lactobacillus_phage	7.6e-09	37.8
WP_002294207.1\|2578783_2579905_-	alanine racemase	NA	NA	NA	NA
WP_002296554.1\|2579920_2580271_-	holo-ACP synthase	NA	NA	NA	NA
WP_002294211.1\|2580400_2581912_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	6.6e-62	36.2

DBSCAN-SWA_190

2585010 : 2591396

Ostreococcus_lucimarinus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002317554.1\|2585010_2586756_+	AarF/ABC1/UbiB kinase family protein	M4R0M8	Ostreococcus_lucimarinus_virus	1.3e-40	28.1
WP_002294214.1\|2587004_2587472_-	YaiI/YqxD family protein	NA	NA	NA	NA
WP_002294217.1\|2587455_2588829_-	hypothetical protein	NA	NA	NA	NA
WP_002296548.1\|2589150_2589639_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002294220.1\|2589660_2590263_-	TVP38/TMEM64 family protein	M1Q152	Streptococcus_phage	3.6e-19	30.6
WP_002289751.1\|2590766_2591396_-	uridine kinase	A0A1V0SAA3	Catovirus	3.1e-34	40.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP011829

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP011830

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP011828

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection