CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number
NZ_CP012529	Psychrobacter sp. P2G3 chromosome, complete genome	0 crisprs	DEDDh,csa3,WYL,cas3	0
NZ_CP012531	Psychrobacter sp. P2G3 plasmid pPspP2G3b, complete sequence	0 crisprs	NA	0
NZ_CP012532	Psychrobacter sp. P2G3 plasmid pPspP2G3c, complete sequence	0 crisprs	NA	0
NZ_CP012530	Psychrobacter sp. P2G3 plasmid pPspP2G3a, complete sequence	1 crisprs	NA	2

Cas Category Instructions

Results visualization

1. NZ_CP012530

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP012530_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012530_1

22917-23045

Orphan

Consensus_repeat	Method
GCTAACGATTTGCTAACTTTTAA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP012530_1

>merge|NZ_CP012530|1|22917-23045|CRISPRCasFinder
GCTCATAAATTGCTCATATTTAACTAACGATTTACTACCCTTTTGCTAACGATTTGCTAACTTTTAATCAATCATACAGTAATTGCTCATAATTTGCTCATATCTAGCTAACGATTTGCTAACTTTTAA

>NZ_CP012530|1|1|22917-23045|CRISPRCasFinder
GCTCATAAATTGCTCATATTTAA	CTAACGATTTACTACCCTTTT
GCTAACGATTTGCTAACTTTTAA	TCAATCATACAGTAATTGCTCATAATTTGCTCATATCTA
GCTAACGATTTGCTAACTTTTAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012530.1\|WP_068330387.1\|20731_21241_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012530.1\|WP_068330397.1\|21541_21823_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|367913
NZ_CP012530.1\|WP_068330382.1\|16438_17071_+\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239736
NZ_CP012530.1\|WP_068330384.1\|17283_17775_+\|DUF1643-domain-containing-protein	unknown	unknown	gnl\|CDD\|377919
NZ_CP012530.1\|WP_068330392.1\|21822_22023_-\|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	unknown	unknown	gnl\|CDD\|274102
NZ_CP012530.1\|WP_068039641.1\|23325_23700_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012530.1\|WP_068330394.1\|22113_22389_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012530.1\|WP_068330396.1\|22454_22865_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012530.1\|WP_082785776.1\|21258_21624_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226045
NZ_CP012530.1\|WP_011513686.1\|15710_16073_+\|DUF3817-domain-containing-protein	unknown	unknown	gnl\|CDD\|274878
NZ_CP012530.1\|WP_068330385.1\|17871_20229_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|227038

Protein	Function_ID	Function_description	E-value
NZ_CP012530.1\|WP_068330382.1\|16438_17071_+\|recombinase-family-protein	gnl\|CDD\|239736	cd03767, SR_Res_par, Serine recombinase (SR) family, Partitioning (par)-Resolvase subfamily, catalytic domain; Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. This subgroup is composed of proteins similar to the E. coli resolvase found in the par region of the RP4 plasmid, which encodes a highly efficient partitioning system. This protein is part of a complex stabilization system involved in the resolution of plasmid dimers during cell division. Similar to Tn3 and other resolvases, members of this family may contain a C-terminal DNA binding domain.	5.39791e-67
NZ_CP012530.1\|WP_068330384.1\|17283_17775_+\|DUF1643-domain-containing-protein	gnl\|CDD\|377919	pfam07799, DUF1643, Protein of unknown function (DUF1643). The members of this family are all sequences found within hypothetical proteins expressed by various bacterial species. The region concerned is approximately 150 residues long.	3.5671e-59
NZ_CP012530.1\|WP_068330392.1\|21822_22023_-\|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	gnl\|CDD\|274102	TIGR02384, Putative_antitoxin_RelB, addiction module antitoxin, RelB/DinJ family. Plasmids may be maintained stably in bacterial populations through the action of addiction modules, in which a toxin and antidote are encoded in a cassette on the plasmid. In any daughter cell that lacks the plasmid, the toxin persists and is lethal after the antidote protein is depleted. Toxin/antitoxin pairs are also found on main chromosomes, and likely represent selfish DNA. Sequences in the seed for this alignment all were found adjacent to toxin genes. The resulting model appears to describe a narrower set of proteins than pfam04221, although many in the scope of this model are not obviously paired with toxin proteins. Several toxin/antitoxin pairs may occur in a single species. [Cellular processes, Toxin production and resistance, Mobile and extrachromosomal element functions, Other].	1.5363e-15
NZ_CP012530.1\|WP_068330397.1\|21541_21823_-\|hypothetical-protein	gnl\|CDD\|367913	pfam04365, BrnT_toxin, Ribonuclease toxin, BrnT, of type II toxin-antitoxin system. BrnT is a ribonuclease toxin of a type II toxin-antitoxin system that exhibits a RelE-like fold. The antitoxin that neutralizes this toxin is pfam14384. BrnT is found in bacteria, archaea, bacteriophage, and plasmids. BrnT-BrnA forms a 2:2 tetrameric complex and autoregulates its own expression, which is induced by a number of different environmental stresses. Expression of BrnT alone results in cessation of bacterial growth which can be rescued after subsequent expression of BrnA.	2.4892e-32
NZ_CP012530.1\|WP_082785776.1\|21258_21624_-\|hypothetical-protein	gnl\|CDD\|226045	COG3514, COG3514, Uncharacterized protein conserved in bacteria [Function unknown].	0.000733169
NZ_CP012530.1\|WP_011513686.1\|15710_16073_+\|DUF3817-domain-containing-protein	gnl\|CDD\|274878	TIGR03954, hypothetical_protein, integral membrane protein. This model describes a strictly bacterial integral membrane domain of about 85 residues in length. It occurs in proteins that on rare occasions are fused to transporter domains such as the major facilitator superfamily domain. Of three invariant residues, two occur as a His-Gly dipeptide in the middle of three predicted transmembrane helices. [Unknown function, General].	3.65603e-32
NZ_CP012530.1\|WP_068330385.1\|17871_20229_-\|AAA-family-ATPase	gnl\|CDD\|227038	COG4694, COG4694, Uncharacterized protein conserved in bacteria [Function unknown].	5.4737e-13

>NZ_CP012530.1|WP_068330396.1|22454_22865_-|hypothetical-protein
MAKRTKFSKFRDLYEVIEELAVSYTYEGVVEILAERHDLILTTGTLTNYLYRYRKESKELSVATDNSSGKVEIKHEGAEQTFVDLKGGEPIQESVTDIDDDSKSDNQDDEEIDHDAFLEKMKRKLAIKSNKSLFDK
>NZ_CP012530.1|WP_068330394.1|22113_22389_-|hypothetical-protein
MSMSGVSVASNKSLQLEATQEAYNRAVVKLNLLLIEDKTHEEDVRAKLIEVMKERNKLGKYSFSDLYVMQKSIEKTVDDFLAGLNEQYVSD
>NZ_CP012530.1|WP_068330392.1|21822_22023_-|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin
MSTTNYNIRLDQELKDKAFSVLEGYGLTPSQAIKLFLHQVAETNSIPLSFDYQTMPSTNMLEDGDQ
>NZ_CP012530.1|WP_068330397.1|21541_21823_-|hypothetical-protein
MEFEWDEQKNSSNQRKHGLSFEEAARVFFDPLCLRQQDRYENGEERWQALGAVNGVAVLLVAHTQKDSEGGEVIRIISARPATKIERRFYEQG
>NZ_CP012530.1|WP_082785776.1|21258_21624_-|hypothetical-protein
MVRVVRLFVSYQHDLPLRLKGGFMNRVSYKANELPSLSAEQEANLQRLAVLSDHDIDLSDMPEVTDWSGATRGSVVSSDSMVGASIVSPSIIARFQDKAKKTGGNYQDMINDALEEYLLDH
>NZ_CP012530.1|WP_068330387.1|20731_21241_+|hypothetical-protein
MNISVTKAAKEWGVSRTTIYQKISNGELSRHSDKKIDPSEMLRVFGEPILKKRTERSVNSVQSTPLDSQSVQYNTDIEHQLALEKLKNEHLSQQVSDQKKLIENYQEQIAQLNKTLDKANASIQDFAQVRLLEFKKSEQSYEPPLEQEKEKTDDSTVATVEKKKRWWAF
>NZ_CP012530.1|WP_068330385.1|17871_20229_-|AAA-family-ATPase
MITRVTLIENTGNYQKFSDGNVNFNPVTIIYGENRNGKSTFCDIFHSLALNDPKIIMDRKSINPSNVMSQAQQKIKIQFSTDDDRKKIVAFTNDSWDSHLPDNYQLHVFDQAFIYRNVMAGMTYNRDNSKNISSYILGENSVKFEELEIDNQKLRGVRESIRTLTSKFHSHKIHNIDDFIASPLSLLSLIEIDAEIKNSKESQQRISTQITNTIQVSRRSNLEGMIRHRAIDTELKSINDCLGFNMDNVHEASKEAVANHKMKVDSPNLFDTWAAKGITHLKDDCPFCGQELKREAQFLIENYQTAFDDNFQNFVAQTKSKANSLKRKSLISTNIEDIREKHDRNLAFLDTYIEADIRSELESHDYINQLMSCFQSIELALSDLYHANNSVAKTIENDLNYKYEVPYNSLPPIDFTQLKSKFSIFDDSIAEYNSVKDKINIELDRFKALQNTAVLQNLVDTEVDAEKLLLSQRKRRDMNEDCIEFSGLCSDLQAAEDEYKDRKAKLEEDQEEFLNNYFDEINRIFSSIGTKNFEISRGTNNIGTRTVYELKVSFKGESINKDKFHCIFSESDRRALALSVYFAKINKLPEDERLKAILIMDDPVTSFDSERITSILGILYRLKSRVKQLIVTTHYKGMASSMMMKFSKEASAIKIIQTQNGSILKQATEAEMTETAHNKRYNEIMDFVERRTNEDKIEQLRVFVEAEMRSRYKRQLISLNLNEKSKFNDCLKALKDKDYITESSFLSLDDLRGSLNVPSHNIQHRSLEDSRSYAEDMMKTIYNEI
>NZ_CP012530.1|WP_068330384.1|17283_17775_+|DUF1643-domain-containing-protein
MKTDAKISECGKYRYSLKRIWDEEKSLVAFIALNPSTADEVDNDKTINRCIDFAKSWGAGGMYMFNVFAYRATDPTNMKAQDDPIGSENDNYLAKLSKVDKIIVCWGNDGLHRDRANHVREILKNTGQDKLYCLDINKNGEPKHPLYVRGSTKPTLYEYPPTR
>NZ_CP012530.1|WP_068330382.1|16438_17071_+|recombinase-family-protein
MFIRAYLRASTKEQDAKRAKSELIAFANDYGHKIAAFYVENESGAILVRPKLMQLIEDAHKGDVILVEQIDRLARLNQADWDTLKRMLSEKKLSIVSKELPTSYMALQSESSTEFMSSVLQAINSMMLDMLAAIARKDYEDRRNRQMQGIARAKAEGKYSGRKKDIEKRQIIASLLKSGHSYSDIQKMAKCSRHLIADVAKEISRLITTH
>NZ_CP012530.1|WP_011513686.1|15710_16073_+|DUF3817-domain-containing-protein
MSQAQPTIEKIHSLRKKQETALKSLTLIGYLEGTSFLLLLFIAMPLKYMMDIPEGVKYIGMAHGVLFIVYIVVLVGTAIKVKIPRWAIPAGVLGSLLPFGPFIFDHLLKKNLQKSVSKEA
>NZ_CP012530.1|WP_068039641.1|23325_23700_+|hypothetical-protein
MYTPTVSFRLKPEVYLKLEAIAAEEGLSPGVYLKKKLESDTNSFLEDLKFMKGDISEILYLLQSDDDDIKAVESSSNQNDMVKALMPIVLESLLILREVAAPNKVSNAQKLVNKAGIKAHNSLD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP012530_1	1.1\|22940\|21\|NZ_CP012530\|CRISPRCasFinder	22940-22960	21	NZ_CP012530	Psychrobacter sp. P2G3 plasmid pPspP2G3a, complete sequence	22940-22960	0	1.0
NZ_CP012530_1	1.1\|22940\|21\|NZ_CP012530\|CRISPRCasFinder	22940-22960	21	NZ_CP012535	Psychrobacter sp. P11G5 plasmid pPspP11G5b, complete sequence	13509-13529	0	1.0
NZ_CP012530_1	1.2\|22984\|39\|NZ_CP012530\|CRISPRCasFinder	22984-23022	39	MN657049	Psychrobacter sp. strain ANT_H19 plasmid pA19H3, complete sequence	5652-5690	0	1.0
NZ_CP012530_1	1.2\|22984\|39\|NZ_CP012530\|CRISPRCasFinder	22984-23022	39	NZ_CP012530	Psychrobacter sp. P2G3 plasmid pPspP2G3a, complete sequence	22984-23022	0	1.0
NZ_CP012530_1	1.1\|22940\|21\|NZ_CP012530\|CRISPRCasFinder	22940-22960	21	NZ_CP012535	Psychrobacter sp. P11G5 plasmid pPspP11G5b, complete sequence	13593-13613	1	0.952
NZ_CP012530_1	1.1\|22940\|21\|NZ_CP012530\|CRISPRCasFinder	22940-22960	21	MN657049	Psychrobacter sp. strain ANT_H19 plasmid pA19H3, complete sequence	5630-5650	1	0.952
NZ_CP012530_1	1.1\|22940\|21\|NZ_CP012530\|CRISPRCasFinder	22940-22960	21	MN657049	Psychrobacter sp. strain ANT_H19 plasmid pA19H3, complete sequence	5714-5734	1	0.952
NZ_CP012530_1	1.2\|22984\|39\|NZ_CP012530\|CRISPRCasFinder	22984-23022	39	NZ_CP012535	Psychrobacter sp. P11G5 plasmid pPspP11G5b, complete sequence	13553-13591	1	0.974

1. spacer 1.1|22940|21|NZ_CP012530|CRISPRCasFinder matches to NZ_CP012530 (Psychrobacter sp. P2G3 plasmid pPspP2G3a, complete sequence) position: , mismatch: 0, identity: 1.0

ctaacgatttactaccctttt	CRISPR spacer
ctaacgatttactaccctttt	Protospacer
*********************

2. spacer 1.1|22940|21|NZ_CP012530|CRISPRCasFinder matches to NZ_CP012535 (Psychrobacter sp. P11G5 plasmid pPspP11G5b, complete sequence) position: , mismatch: 0, identity: 1.0

ctaacgatttactaccctttt	CRISPR spacer
ctaacgatttactaccctttt	Protospacer
*********************

3. spacer 1.2|22984|39|NZ_CP012530|CRISPRCasFinder matches to MN657049 (Psychrobacter sp. strain ANT_H19 plasmid pA19H3, complete sequence) position: , mismatch: 0, identity: 1.0

tcaatcatacagtaattgctcataatttgctcatatcta	CRISPR spacer
tcaatcatacagtaattgctcataatttgctcatatcta	Protospacer
***************************************

4. spacer 1.2|22984|39|NZ_CP012530|CRISPRCasFinder matches to NZ_CP012530 (Psychrobacter sp. P2G3 plasmid pPspP2G3a, complete sequence) position: , mismatch: 0, identity: 1.0

tcaatcatacagtaattgctcataatttgctcatatcta	CRISPR spacer
tcaatcatacagtaattgctcataatttgctcatatcta	Protospacer
***************************************

5. spacer 1.1|22940|21|NZ_CP012530|CRISPRCasFinder matches to NZ_CP012535 (Psychrobacter sp. P11G5 plasmid pPspP11G5b, complete sequence) position: , mismatch: 1, identity: 0.952

ctaacgatttactaccctttt	CRISPR spacer
ctaacgatttgctaccctttt	Protospacer
**********.**********

6. spacer 1.1|22940|21|NZ_CP012530|CRISPRCasFinder matches to MN657049 (Psychrobacter sp. strain ANT_H19 plasmid pA19H3, complete sequence) position: , mismatch: 1, identity: 0.952

ctaacgatttactaccctttt	CRISPR spacer
ctaacgatttactaccttttt	Protospacer
****************.****

7. spacer 1.1|22940|21|NZ_CP012530|CRISPRCasFinder matches to MN657049 (Psychrobacter sp. strain ANT_H19 plasmid pA19H3, complete sequence) position: , mismatch: 1, identity: 0.952

ctaacgatttactaccctttt	CRISPR spacer
ctaatgatttactaccctttt	Protospacer
****.****************

8. spacer 1.2|22984|39|NZ_CP012530|CRISPRCasFinder matches to NZ_CP012535 (Psychrobacter sp. P11G5 plasmid pPspP11G5b, complete sequence) position: , mismatch: 1, identity: 0.974

tcaatcatacagtaattgctcataatttgctcatatcta	CRISPR spacer
tcaatcatacagtaattgctcataaattgctcatatcta	Protospacer
************************* *************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage