CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP014780	Lactiplantibacillus plantarum strain JBE245 chromosome, complete genome	3 crisprs	csa3,DinG,cas3,DEDDh	5	1	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP014780_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP014780_1

1124707-1124933

Orphan

Consensus_repeat	Method
ACCCGTACAAGCAATCAAGAATC	PILER-CR

4 spacers

The CRISPR arrays of NZ_CP014780_1

>merge|NZ_CP014780|1|1124707-1124933|PILER-CR
ACCCGTACAAGCAATCAAGAATCCAGTAGTACGAAAAATACTAGTCAGACAACCAGTACAAGCAATCAAGAAGCTAACAGTGCCAAGAGTATTAATCAAGCGACCCGTACAAGCAATCAAGAATCCAGTAGTGCGAAAAATACTAGTCAGACAACCAGTACAAGCAATCAAGAAGCTAACAGTGCCAAGAGTATTAATCAAGCGACCCGTACAAGCAATCAAGAATC

>NZ_CP014780|1|1|1124707-1124933|PILER-CR
ACCCGTACAAGCAATCAAGAATC	CAGTAGTACGAAAAATACTAGTCAGACA
ACCAGTACAAGCAATCAAGAAGC	TAACAGTGCCAAGAGTATTAATCAAGCG
ACCCGTACAAGCAATCAAGAATC	CAGTAGTGCGAAAAATACTAGTCAGACA
ACCAGTACAAGCAATCAAGAAGC	TAACAGTGCCAAGAGTATTAATCAAGCG
ACCCGTACAAGCAATCAAGAATC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP014780.1\|WP_003643208.1\|1132371_1132599_-\|DUF2922-domain-containing-protein	unknown	unknown	gnl\|CDD\|378571
NZ_CP014780.1\|WP_003644178.1\|1115886_1117020_+\|UDP-galactopyranose-mutase	unknown	unknown	gnl\|CDD\|223636
NZ_CP014780.1\|WP_003644193.1\|1133968_1134727_+\|competence-protein-ComK	unknown	unknown	gnl\|CDD\|368849
NZ_CP014780.1\|WP_046947458.1\|1118165_1118798_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014780.1\|WP_060417605.1\|1117035_1118169_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014780.1\|WP_046947459.1\|1120000_1121110_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377101
NZ_CP014780.1\|WP_046947456.1\|1114441_1115374_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133028
NZ_CP014780.1\|WP_003643204.1\|1127990_1128431_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP014780.1\|WP_061876120.1\|1121093_1122161_+\|acyltransferase-family-protein	unknown	unknown	gnl\|CDD\|226122
NZ_CP014780.1\|WP_027822093.1\|1122296_1123073_+\|DUF4422-domain-containing-protein	unknown	unknown	gnl\|CDD\|379595
NZ_CP014780.1\|WP_003644190.1\|1132628_1132841_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014780.1\|WP_024002857.1\|1131964_1132270_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014780.1\|WP_046947455.1\|1113447_1114359_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133028
NZ_CP014780.1\|WP_027822092.1\|1123197_1123944_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197666
NZ_CP014780.1\|WP_003645955.1\|1134759_1135563_+\|recombination-regulator-RecX	unknown	unknown	gnl\|CDD\|237619
NZ_CP014780.1\|WP_003643211.1\|1133185_1133734_-\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|274357
NZ_CP014780.1\|WP_003643206.1\|1130419_1131088_-\|sugar-transferase	unknown	unknown	gnl\|CDD\|376775
NZ_CP014780.1\|WP_024002858.1\|1132955_1133150_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014780.1\|WP_046947454.1\|1111269_1112808_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227059
NZ_CP014780.1\|WP_061876121.1\|1128560_1129982_-\|flippase	unknown	unknown	gnl\|CDD\|240533

Protein	Function_ID	Function_description	E-value
NZ_CP014780.1\|WP_003644193.1\|1133968_1134727_+\|competence-protein-ComK	gnl\|CDD\|368849	pfam06338, ComK, ComK protein. This family consists of several bacterial ComK proteins. The ComK protein of Bacillus subtilis positively regulates the transcription of several late competence genes as well as comK itself. It has been found that ClpX plays an important role in the regulation of ComK at the post-transcriptional level.	1.74267e-05
NZ_CP014780.1\|WP_003644178.1\|1115886_1117020_+\|UDP-galactopyranose-mutase	gnl\|CDD\|223636	COG0562, Glf, UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane].	4.88338e-180
NZ_CP014780.1\|WP_046947459.1\|1120000_1121110_+\|hypothetical-protein	gnl\|CDD\|377101	pfam03699, UPF0182, Uncharacterized protein family (UPF0182). This family contains uncharacterized integral membrane proteins.	0.00253621
NZ_CP014780.1\|WP_003643208.1\|1132371_1132599_-\|DUF2922-domain-containing-protein	gnl\|CDD\|378571	pfam11148, DUF2922, Protein of unknown function (DUF2922). This bacterial family of proteins has no known function.	7.46609e-13
NZ_CP014780.1\|WP_027822092.1\|1123197_1123944_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197666	smart00342, HTH_ARAC, helix_turn_helix, arabinose operon control protein.	3.68549e-18
NZ_CP014780.1\|WP_046947456.1\|1114441_1115374_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133028	cd04185, GT_2_like_b, Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	1.25828e-82
NZ_CP014780.1\|WP_003643204.1\|1127990_1128431_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	3.5268e-13
NZ_CP014780.1\|WP_061876120.1\|1121093_1122161_+\|acyltransferase-family-protein	gnl\|CDD\|226122	COG3594, NolL, Fucose 4-O-acetylase and related acetyltransferases [Carbohydrate transport and metabolism].	1.81871e-14
NZ_CP014780.1\|WP_027822093.1\|1122296_1123073_+\|DUF4422-domain-containing-protein	gnl\|CDD\|379595	pfam14393, DUF4422, Domain of unknown function (DUF4422). This family of proteins is found in bacteria and archaea. Proteins in this family are typically between 255 and 371 amino acids in length.	1.83501e-121
NZ_CP014780.1\|WP_003645955.1\|1134759_1135563_+\|recombination-regulator-RecX	gnl\|CDD\|237619	PRK14135, recX, recombination regulator RecX; Provisional.	5.53268e-120
NZ_CP014780.1\|WP_046947455.1\|1113447_1114359_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133028	cd04185, GT_2_like_b, Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	6.77895e-77
NZ_CP014780.1\|WP_003643206.1\|1130419_1131088_-\|sugar-transferase	gnl\|CDD\|376775	pfam02397, Bac_transf, Bacterial sugar transferase. This Pfam family represents a conserved region from a number of different bacterial sugar transferases, involved in diverse biosynthesis pathways.	1.56324e-95
NZ_CP014780.1\|WP_003643211.1\|1133185_1133734_-\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|274357	TIGR02937, RNA_polymerase_sigma_factor, RNA polymerase sigma factor, sigma-70 family. This model encompasses all varieties of the sigma-70 type sigma factors including the ECF subfamily. A number of sigma factors have names with a different number than 70 (i.e. sigma-38), but in fact, all except for the Sigma-54 family (TIGR02395) are included within this family. Several Pfam models hit segments of these sequences including Sigma-70 region 2 (pfam04542) and Sigma-70, region 4 (pfam04545), but not always above their respective trusted cutoffs.	1.75371e-08
NZ_CP014780.1\|WP_046947454.1\|1111269_1112808_+\|hypothetical-protein	gnl\|CDD\|227059	COG4715, COG4715, Uncharacterized conserved protein [Function unknown].	8.3379e-07
NZ_CP014780.1\|WP_061876121.1\|1128560_1129982_-\|flippase	gnl\|CDD\|240533	cd13128, MATE_Wzx_like, Wzx, a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Escherichia coli Wzx and related proteins from other gram-negative bacteria are thought to act as flippases, assisting in the membrane translocation of lipopolysaccharides including those containing O-antigens. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	2.77454e-41

>NZ_CP014780.1|WP_027822092.1|1123197_1123944_-|helix-turn-helix-transcriptional-regulator
MNIARFTPLRISSSEQEFILNFSLLEHDLIHFFKIRDFDHAISRINKFKEVHPINWIDAEILNQLLLGLIGSLTAASYTHNLNLNDFLKLRLYFFNFIKKSPCTSSTFWPLSNDIITTYFNLLDNFDFHVSYQNLSKQVALTAYYISAHPQELTNSHGVLHTLNLNNDYTQKLFKKELGFSINAYIQHIKLSEAKRLLLQRQLSVGKIASLLHFYDTPTFSKTFKKAVGLSPLKYRELNYLSLTSQSY
>NZ_CP014780.1|WP_027822093.1|1122296_1123073_+|DUF4422-domain-containing-protein
MKVQIYVAAHKPYQMPQDPTYRPIFVGAAIHGGAPQNYQPDDVGDNISASNPNFNELTAMYWIWKNCHADVKGLNQYRRYLSEAPKRKLAGILSMTEIESLLQQYDVIVPKKRHYYIESNYSHYVHAHHREPLDMMRTVISERHAAYLDDFDQLMHRTSAHMFNMMIMSGPKFDDYAKWVFDILFAVRDRIDIADYDVQEARVFGYLSEFLLDVWINHNQLKYVEVPVMYMEKQQLPAKAYNLLKRKFFPQAAKRTHF
>NZ_CP014780.1|WP_061876120.1|1121093_1122161_+|acyltransferase-family-protein
MRKRIEWIDIAKGIAILAVVVGHTLGPYNGQFFGSLIFAFHMPIFFMLSGYLYHSRPARQECQRGIINLLLPYLATAVVLLVVSAIARLLPNPLLNAYFPSWRQGLIATAYGAGSAVFNPWHWQVQPIGAVWFLLSMFIALQLFNGVMLLTARRHQRWRQAIVRGGVFAIFAILGGWLGQVAYLPWAVNAALLAQLFLYAGYLVKQTALLSRISSAWYLLFTFMWLVSAFQGYFALTVPTSPNLLISVMGGVAGSLCIIRVSDWLSHYPNARPIKWLKRYGQLSLVVLCFHLIDLNVIGMTNHLITHMGPLVTTIIAISYRIGFVTVAMLAIPHLPGIRACFLPRQYLFRRLQRR
>NZ_CP014780.1|WP_046947459.1|1120000_1121110_+|hypothetical-protein
MNHQQAYRVQRLILIIALMLILFGDTGMNAVFSFSHQPQSIWFYPQLVVALITAAGPNLLLMALGAYQLRRTALTVPQLIRRVLWIMGGITLFSLAFYLEDLVTQGSLTSFNIAGFFTALAQAPVGFYDILYELLGFFVTLPLLRVIAHHASVAIQQYLFWAELVFIGMVPILAYFTGLTTISVNPPLAITAGCFFALMGYWLSQTEVLHRITREHLLVAWLLTCGCYAVMVSVTMYQVNLEKNFDLISSQPFAQTFQAIPCLTLWVTIATWMMNRPRSKAVRRHNFVQTVYGDMLVAGLLITPFMVINRLLTPIIGAWWPGWLWSIAVLIVSVELVWLLRHVRWLQRILPDLFGGSQLIGGSVNAQKN
>NZ_CP014780.1|WP_046947458.1|1118165_1118798_+|hypothetical-protein
MRHMKVQPKERFSLAWRWLPLELLIIMLSVGLGWAGNRWLPKPVYQASVDIQIAQTPRSELSTARLKRQRRQDIKAITQFNVMPHQSAVLTQASTYAYAHYGIWQPIQELSESVQAAPVARRPVLRVTATSSSRQVAQQNAQAFNVAIKANLTGLKNYRVKTVKRTVTRETNVIRGALWKLILVVGGGLALLSPYLVKYGQGWGRHDDET
>NZ_CP014780.1|WP_060417605.1|1117035_1118169_+|hypothetical-protein
MKMRKRLAIVWGSLALLALLLGYACYALSIQRGQDTVTRIYQTDQNGTPIISPGPITLVGKVNHRNLFQSGINGYVLTNRDPLSTLLPRRNQTVHLKYRSAQTTAELRKTLRQARYLQAGTQNTATPVFQNRQQRGDATTYGRISTSQDGRIWTKLPISYPHVQLSRPSVWYANGRLTLIDGQDRYWTTNFKDWQHQRLNFNGADFKQGRVQAVFPGTTRSAVVMVRGIDRQSSRAKLYYGQLTKTGRVKAWHALQLGKLPARQIAGMSLIDQHLYLFRQRGTQLAVYRANRLTRPVRLVGRVKLNHAQSQRVTAVNLIPTTKHRYRLIFDLTTAEKVQKQPRYRLLDRRFKAVGQQHLLVTDYLWSQFQISLRGSE
>NZ_CP014780.1|WP_003644178.1|1115886_1117020_+|UDP-galactopyranose-mutase
MNEQYDYLVVGAGLFGAVFAHEAALRGKRVKVIEKRDHIAGNIYTKEVAGIQVHQYGAHIFHTSDREIWDYVNQFAEFNRYTNSPVANYKGHMYNLPFNMNTFSELWGVRTPAEAAAKIAEQRAAANLGDHQPRNLEEQAIALIGTDIYEKLIKGYTEKQWGQKATDLPAFIIRRLPVRYTYDNNYFNDTYQGIPIGGYTQIVEKMLAHPEITVETNTDFFAHKAEYLAQYPKVVFTGMIDQFFDYQLGELAYRSLRFETETVPVDNYQGNAVVNYTDAETPYTRVIEHKHFEFGKGDADQTVITREFPANWQRGDEPYYPVNNQTNNTLYKQYAKLAAAEPQVIFGGRLGQYRYYDMHQVIHAALVTVASEFATTK
>NZ_CP014780.1|WP_046947456.1|1114441_1115374_+|glycosyltransferase-family-2-protein
MQYGAIVVTFNRKQLLIESITALLNQTVPPAKIIIIDNHSTDGTKAELQTADILANPSVDYRYLTKNIGGAGGFARGMQIVAADPNLDWVSMSDDDAIFEPDYFEKLIAYQQDHPNRQILTGSVYIEDGRLQADQRNRFTNWSTFQAQAVPEREYRGNFEFDQYTFCGVFMSVAVIKQVGVADAGYFIWWDDCEYAVRTAKLSRPVNVSAAKLIHKTALPSLDFKSKFVPDWRLYYGQRNRLITIKRWRANSLVSLGWLLGFYARLAIQLCGPFYRGYRKMVIRVYLEALRDASREREGLNPNFMPGQKF
>NZ_CP014780.1|WP_046947455.1|1113447_1114359_+|glycosyltransferase-family-2-protein
MAKIACVIVTYNRKQLLEEALNSVSIQAEAPEYVFVIDNASTDGTEKYINDKFNFDNRHWHYVRCSQNLGGSAGFAQGMRLALQTDCSWISISDDDALFEPGYFAALREGIKQYPEQSVFSGSVLLPDGKHDMMHREVITNSATLTVKPVTEETYKHDFSYDIFSFVGILLSRQVIEAIGLPEQDYFIRFDDFEYAVRALKFGRFMNLSAAKVLHKTTYTRSAIAPWKEYYVMRNRIALLIKHRGNNHTVRWYCRRFLLRKLLAILLFSNRRRQARSLVNAYVKGYQDGWHARLGRQLAFLPS
>NZ_CP014780.1|WP_046947454.1|1111269_1112808_+|hypothetical-protein
MQWQTLFQQQVLTRAFNYYQEGHVKKFSKEHHKLMAIVQGVQDYQVTIFESIGDVTTMICNCPYALSGLHCKHMAAVLYYVENTVSVGSQLKMNSPKNCQGKLFKKSDDRVGNEWNSDLIQDIRSFTLSQSKLLAHEDMLAVNPCPLFTPLADLPMLFKSCEWLVSTELPRMLAANQQQMVFDILTYAYLKLCYTGVDQTNLIDECARLFRKLLTHANGHIRQSIFRWLFIYSLALPIKYSSQFELLLFYSDAFSNPWFLNQKLILVDHKISKLQASHHEMQFQVETTVIEWQRYRIHVMKELKLSPNTVQEFCQLNRDDLVVSDYFVENCREHNDIERAIMYCRTGIQQAAQDDNSTVMYHCYDQLVSLYRDCGLVNEYRHALFEAITKCDALNSNWYIQLREQYSSADWSNVRRQISASIIPQTDFEWDSFQNVSVRPYVLALQRDVKEATTPESQLSIIKQLDYLQKYHGSTGLEVADWLWQDWYRHYPERKVLIDAFDEWIAQIIEKY
>NZ_CP014780.1|WP_003643204.1|1127990_1128431_+|MarR-family-transcriptional-regulator
MLNHQQIKAQFESLETLQSIQKQVHQMSIQGLVTTGISMREWEVLVYLEQHEQASASELAKVFKVTRTLISRNTWHLIQDNLIQPQIDQSDRRIVWLSLTTTGQETIGKVARQIQANLQAFDCNHELATLMKQLRYLKQQLIILNN
>NZ_CP014780.1|WP_061876121.1|1128560_1129982_-|flippase
MRIIRNYFYTAGYNLLILLTPLLTVPYISRVLGPTGVGINATTNSIITYFLLFGTVGITIYGNREIAFIRDNRGQRSQTFWEIEILQLLTISCAYLAFLVFLFFEHQLQIYFFYQSFYIIAGAVDISWYFMGLEDFKKTVLRNMLVKIASVIAIFAFVKTRQDTGIYILILAGSQVLGNLTLWPYLRHSVERPNWRQLNLFRHLRPSLALFVPQLATTVYLALNKTMLWQMDSLTAAGFYDYSDKLIKLVLALVTATGTVMLPHIANLFMKQQLERVKQYLYMSFDFVLAIAIPMALGVAAVATTLAPLFFGRAFWAVDRLLMIEAPVIILIGMSNVLGQQFLLPTKQTKTYTISVTIGALVNIACNIPLIWFWGVAGAMCATLISEVCVTGYQLFITRHVLHAQSLFTGIWKYTLAGGLMFTFVFRLNVTMTASYLNLCLQIGVGVLLYLGLILLLQPPVLRNAIKLRNNLH
>NZ_CP014780.1|WP_003643206.1|1130419_1131088_-|sugar-transferase
MELKEREIRPITIDAGRQHRRYGYRFIKRVFDFVASLLGLIILSPLFLLIAIAIKVEDPKGAVFYSQTRLGRGEVPFKMYKFRSMVSNADELLEKLLKDNEIDGAMFKMQDDPRVTKIGRFIRKYSIDELPQLLNVLQGSMSLVGPRPPLPREVEEYSDYDKQRLAVKPGCTGLWQATVRNSVGFDEMVKLDLTYISKRSVAFDVYILFKTVVIMFKPNGAY
>NZ_CP014780.1|WP_024002857.1|1131964_1132270_+|hypothetical-protein
MNDDWITVFPADYNNSYHLILKRGTAHYAYYYFKVDKLDQRVIFYDDIERSGISIKTQITRTFMRALVKAIDWHPVGNSIIIEIYPVDRQETKAIRLSCDI
>NZ_CP014780.1|WP_003643208.1|1132371_1132599_-|DUF2922-domain-containing-protein
MKTLDLSFKTSTNKVHHLKLHYANDNLSKDVVSKAMADLAATKLFVKDGENLVAEPLAAKYVETIETPIVTAPKA
>NZ_CP014780.1|WP_003644190.1|1132628_1132841_-|hypothetical-protein
MTKTWLKATLTVQTTTELDEQRKQTFNAIAQDATDEQLAAFGKIVEVLTGDQFTAANLANAYRYDPQPIA
>NZ_CP014780.1|WP_024002858.1|1132955_1133150_-|hypothetical-protein
MHIWMHTHVLLTVTDSNQRQFHQHWLAGRELTDSDFTSLITILTPLFAEKIISITVRTITEFAD
>NZ_CP014780.1|WP_003643211.1|1133185_1133734_-|sigma-70-family-RNA-polymerase-sigma-factor
MHADRFDNQMAFDLLARPEHQRLLYGALKAAQVTKYHPQFEDCVTVAHLTWLSAYQNYAPELPANLPDFRKFAFRRIKWRTVDYLRKQTLRTQSQVNLEHALPITIDPMTEQETHWQLTALLTELLVQCRPGERIYLTEFFFEEQTVSSIMRRHQVSRRTVYNWRASLLVKAHKLYQQQTTN
>NZ_CP014780.1|WP_003644193.1|1133968_1134727_+|competence-protein-ComK
MLEINTDFEGDLPSMNQNIDVPHHVNTFWQCHAGTWDTRQPQRLLIIAQRSELATIDVLETLFLLDIKHLTCVENTLIFDRQRGLIKTKLTTRQIMMNYAGRLGLSGTQLIKQLAGELGLSKHKLPVIHGDAILMPLSTAKRGTTSWYNRHYLKHIEAQGFMTALVYDGQITIQVDMSERVATRQLAKAGQLQAALQEHHRRRLVPDQSVPSMADTDHEMMQSYTDQVLKHFGILALPGEISCLTRRFFGKL
>NZ_CP014780.1|WP_003645955.1|1134759_1135563_+|recombination-regulator-RecX
MTKKVTKIVAQKRAGRYNIYLDEQYAFPISESVMIKFRVFKGMEVDEQLQAAMIAADDVSKAYTRALDYLSHQLRTEKEVHDKLRDEEIDESVIDATMQQLRELRLLNDQQYADAFVRTAKRTSDKGPRVIRQNLRQKGVGEQLIDDALAGQFSAEEQIDNASELARKLAKRYHRQAFKTMQQKVRQGMMTKGFDNDTITAAIASLALEPDEDEQWEALVAQGAKLWQRNRKYAFRERMMRTKRSLFQKGFMMDDINRFIDEQVADE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP014780_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP014780_2

2566132-2566357

Orphan

Consensus_repeat	Method
ACTTGTCCAGAACCATCAGCCAACTGACTGACACCACTAGCCAACGCCCCAGTCTTAC	PILER-CR

2 spacers

csa3

The CRISPR arrays of NZ_CP014780_2

>merge|NZ_CP014780|2|2566132-2566357|PILER-CR
ACTTGTCCAGAACCATCAGCCAACTGACTGACACCACTAGCCAACGCCCCAGTCTTACCATTCAATGTTCCAAGCCCATTAGTAACTTGTCCAGAACCATCAGCCAACTGACTGACACCACTAGCCAACGCCCCAGTCTTACCATTCAACGTTCCTAGCCCATTAGTGACTTGCCCGGAACCATCAGCCAACTGACTGACACCACTGGCTAACGCCCCGGTCTTAC

>NZ_CP014780|2|2|2566132-2566357|PILER-CR
ACTTGTCCAGAACCATCAGCCAACTGACTGACACCACTAGCCAACGCCCCAGTCTTAC	CATTCAATGTTCCAAGCCCATTAGTA
ACTTGTCCAGAACCATCAGCCAACTGACTGACACCACTAGCCAACGCCCCAGTCTTAC	CATTCAACGTTCCTAGCCCATTAGTG
ACTTGCCCGGAACCATCAGCCAACTGACTGACACCACTGGCTAACGCCCCGGTCTTAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP014780.1\|WP_061876251.1\|2560459_2561854_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP014780.1\|WP_061876250.1\|2558438_2560190_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|182732
NZ_CP014780.1\|WP_003642171.1\|2554016_2554883_-\|DUF3737-family-protein	unknown	unknown	gnl\|CDD\|378875
NZ_CP014780.1\|WP_003642190.1\|2577648_2580156_+\|excinuclease-ABC-subunit-UvrA	unknown	unknown	gnl\|CDD\|223256
NZ_CP014780.1\|WP_061876253.1\|2568600_2569545_-\|DNA/RNA-non-specific-endonuclease	unknown	unknown	gnl\|CDD\|214889
NZ_CP014780.1\|WP_003644778.1\|2572856_2574479_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|237894
NZ_CP014780.1\|WP_003644779.1\|2574791_2575586_-\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|319820
NZ_CP014780.1\|WP_003642167.1\|2549655_2550339_+\|noncanonical-pyrimidine-nucleotidase,-YjjG-family	unknown	unknown	gnl\|CDD\|162788
NZ_CP014780.1\|WP_061876249.1\|2554985_2556014_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381305
NZ_CP014780.1\|WP_003642174.1\|2556651_2558439_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP014780.1\|WP_003642183.1\|2569621_2570167_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP014780.1\|WP_033617510.1\|2567120_2567675_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP014780.1\|WP_003644777.1\|2571557_2572763_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP014780.1\|WP_033617504.1\|2562343_2562901_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014780.1\|WP_003642169.1\|2552112_2552706_-\|NAD(P)-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|224996
NZ_CP014780.1\|WP_003642184.1\|2570429_2570957_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379112
NZ_CP014780.1\|WP_003642166.1\|2548989_2549559_-\|sugar-O-acetyltransferase	unknown	unknown	gnl\|CDD\|100047
NZ_CP014780.1\|WP_003642170.1\|2552854_2554027_-\|pyridoxal-phosphate-dependent-aminotransferase	unknown	unknown	gnl\|CDD\|224090
NZ_CP014780.1\|WP_003642189.1\|2575672_2577598_-\|DUF2207-domain-containing-protein	unknown	unknown	gnl\|CDD\|378333
NZ_CP014780.1\|WP_003642181.1\|2567773_2568103_-\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042

Protein	Function_ID	Function_description	E-value
NZ_CP014780.1\|WP_061876251.1\|2560459_2561854_+\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.75153e-55
NZ_CP014780.1\|WP_061876250.1\|2558438_2560190_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|182732	PRK10789, PRK10789, SmdA family multidrug ABC transporter permease/ATP-binding protein.	0
NZ_CP014780.1\|WP_003642171.1\|2554016_2554883_-\|DUF3737-family-protein	gnl\|CDD\|378875	pfam12541, DUF3737, Protein of unknown function (DUF3737). This family of proteins is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 281 and 297 amino acids in length.	4.76422e-179
NZ_CP014780.1\|WP_003642190.1\|2577648_2580156_+\|excinuclease-ABC-subunit-UvrA	gnl\|CDD\|223256	COG0178, UvrA, Excinuclease ATPase subunit [DNA replication, recombination, and repair].	0
NZ_CP014780.1\|WP_061876253.1\|2568600_2569545_-\|DNA/RNA-non-specific-endonuclease	gnl\|CDD\|214889	smart00892, Endonuclease_NS, DNA/RNA non-specific endonuclease. A family of bacterial and eukaryotic endonucleases share the following characteristics: they act on both DNA and RNA, cleave double-stranded and single-stranded nucleic acids and require a divalent ion such as magnesium for their activity. An histidine has been shown to be essential for the activity of the Serratia marcescens nuclease. This residue is located in a conserved region which also contains an aspartic acid residue that could be implicated in the binding of the divalent ion.	4.99756e-24
NZ_CP014780.1\|WP_003644778.1\|2572856_2574479_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|237894	PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional.	0
NZ_CP014780.1\|WP_003642167.1\|2549655_2550339_+\|noncanonical-pyrimidine-nucleotidase,-YjjG-family	gnl\|CDD\|162788	TIGR02254, hydrolase_haloacid_dehalogenase-like_family, noncanonical pyrimidine nucleotidase, YjjG family. This HAD superfamily includes including YjjG from E. coli and YfnB from B. subtilis. YjjG has been shown to act as a house-cleaning enzyme, cleaving nucleotides with non-canonical nucleotide bases. This family is a member of the haloacid dehalogenase (HAD) superfamily of hydrolases which are characterized by three conserved sequence motifs. By virtue of an alpha helical domain in-between the first and second conserved motif, this family is a member of subfamily IA (TIGR01549).	5.66325e-49
NZ_CP014780.1\|WP_061876249.1\|2554985_2556014_-\|aldo/keto-reductase	gnl\|CDD\|381305	cd19079, AKR_EcYajO-like, Escherichia coli YajO and similar proteins. Escherichia coli YajO is the prototype of this family. It is an uncharacterized aldo/keto reductase family oxidoreductase.	2.15702e-136
NZ_CP014780.1\|WP_003642174.1\|2556651_2558439_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	3.67348e-168
NZ_CP014780.1\|WP_003642183.1\|2569621_2570167_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	2.1595e-19
NZ_CP014780.1\|WP_033617510.1\|2567120_2567675_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	9.68761e-08
NZ_CP014780.1\|WP_003644777.1\|2571557_2572763_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	3.49703e-09
NZ_CP014780.1\|WP_003644779.1\|2574791_2575586_-\|HAD-family-hydrolase	gnl\|CDD\|319820	cd07518, HAD_YbiV-Like, Escherichia coli YbiV sugar phosphatase/phosphotransferase and related proteins; belongs to the haloacid dehalogenase-like superfamily. Escherichia coli YbiV can act as both a sugar phosphatase and as a phosphotransferase. Members of this family belong to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	2.72048e-48
NZ_CP014780.1\|WP_003642169.1\|2552112_2552706_-\|NAD(P)-binding-domain-containing-protein	gnl\|CDD\|224996	COG2085, COG2085, Predicted dinucleotide-binding enzymes [General function prediction only].	2.73364e-35
NZ_CP014780.1\|WP_003642184.1\|2570429_2570957_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379112	pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	3.41001e-30
NZ_CP014780.1\|WP_003642166.1\|2548989_2549559_-\|sugar-O-acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	2.57208e-83
NZ_CP014780.1\|WP_003642170.1\|2552854_2554027_-\|pyridoxal-phosphate-dependent-aminotransferase	gnl\|CDD\|224090	COG1168, MalY, Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism].	4.46916e-146
NZ_CP014780.1\|WP_003642189.1\|2575672_2577598_-\|DUF2207-domain-containing-protein	gnl\|CDD\|378333	pfam09972, DUF2207, Predicted membrane protein (DUF2207). This domain, found in various hypothetical bacterial proteins, has no known function.	3.33333e-121
NZ_CP014780.1\|WP_003642181.1\|2567773_2568103_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	1.32613e-13

>NZ_CP014780.1|WP_033617504.1|2562343_2562901_+|hypothetical-protein
MNYTSQANIHKFTVSLVIILLSSILISTTITLKISANTTSSSQQAIDCIAQELADVSNSIRYDPQTGLATNLDVNALVSKYGSNNQNQLQHINEIMKYEYKRNLQFNQGKLNSIQTRSFWSCMKNQLLDMIGYQTFQALLRGGIQGLIQRKAWKAAAKLLIRYLGDGIGVGFIAAQLSWYAIRCA
>NZ_CP014780.1|WP_061876251.1|2560459_2561854_+|MFS-transporter
MSQPSTVTLKTKLAILSVGLLSFVGILVETSMNVTFPTLIKTMRVSLDTVQWLTTGYLLLTTIVMSTTAYVLKRFNPKPLFLFAALVCLLGGILCWLAPNFPILLTGRLLQAVATGISIPLMFQLIFTYVPRNQLGTYTGLASVIVSLAPALGPTYGGILTSVWSWRAIFVGIVPLLALLAILGAFNISGKALGVGDKKFDYLGAILLAITFTSLLFTFNNAGTHGWLSPNFGLWCLWSIVMIGAMVTYAIKGRRQLIDYSILKLPILRLRLFNYFGLQFINIGLSFVLPLFAQTVLEASAMTAGLMMLPGAIVGAITGPIAGRIYDKQGPTTLLTFSAIMASAALLLFWLTTDYFTVIIMAVIYALLRVGFNTGFGTAISDGSTRVPLPQKSDQNSMFSMMQQYAGSIGTSIMSAVIAGYEIHHPTVTGTIMGSKLDFLLLFVLAIAILISVLHVKRLEIGQN
>NZ_CP014780.1|WP_061876250.1|2558438_2560190_-|ATP-binding-cassette-domain-containing-protein
MSIFLKLGWYFRREWKLYLAGVLGLVLTAIIGIVPPRIIGDVVDGINQHSLTAHTLTVYLVIIGVAAVGQYLARYLWRNAIWGGAAGLERTLRERLFWHFMKMDATFYQQYRTGDLMAHATNDLTAVERVAGGGILQFADSIITGGTTLIAMMTLIDWRLTLIAVVPFPLLAIVSRYLGKKIHVAFRASQAAFSRLNNKAQESISGIKVIKALGQEKADVADFNQQIDQTIKINRHVNVLDSLFDPAITMIIALSYGATIILGGLYVTHGVITIGNLVSFVTYLGMMVWPMFAVGMLFNTMERGNASYDRVMELLNQQSAIIDAKRGIEQRPHGDIQYQIKQFNYPNDAGTSLSNVDFTLKAGQTLGIVGRVGAGKSTIMKLILREFDQYEGHITYGGHDIKQYALDSYLPALGYVPQDSFLFSNTIRENIRFADPTVSQAVVEAVATKSDLSGQIASMPAGYDTQVGEEGISLSGGQRQRLAIARALLINPELLVLDDALSAVDAETEAEILANLKAERADKTTIIAAHRLSSVMNADEIIVLDAGHVVERGTHAQLMTQHGWYQKMFTRQQLETKVEGAVQ
>NZ_CP014780.1|WP_003642174.1|2556651_2558439_-|ABC-transporter-ATP-binding-protein
MAARQSVWARSMPVKEQLTVIRRLLPYAKPFKCFFIAAIVFSGLISVVNIYLPRVLQTFIDHYLKTGHATVPVMWYFAGLYFFGMVVRALMQFVQNFSSTMGAEYMLENVRRQMFAKLHRMGMRYFDQVPGGSILSRLTNDTMSFSNFWALFNTLFTAFFAVISSFVAMYLTDAQIALWLLVFMPFLAVTIWYYQRYSSRVYRRMRERLSELNTKLSEAITGISVIQQFRQEHRINGEFDHTNDAYFKTRQAMIRTNSLLLSPLIDLFYALGTVMVLGIFGVRGLNGYVAAGVVYAFITYLNNFYNPMTSMMDNLSDFQDGVVAGSRVLRVMDDPTIAPAQHVDPTAKITRGKIEFRHVTFAYDGQHPVLKDVSFVAEPGQTVALVGQTGSGKTSTINVLMRFYEFQSGEVLIDDRDIREYPAEELRQKMGLVLQEPFMFYGDINSNIRMFNDQISDEQVQAAARFVKADDFINDLPENYQSRVIERGASYSSGQRQLISFARTIVTDPKILILDEATANVDTETEEMIQTGLDRIQENRTTIAIAHRLSTIQNADLILVLNQGQIVERGSNDELLQQHGYYYDMIQLQNSAHVD
>NZ_CP014780.1|WP_061876249.1|2554985_2556014_-|aldo/keto-reductase
MQYRQLGTSDLKVSSIALGCMGFGVGTGTALNQRSWAVGQMQANQVLDRAISLGINFFDTAPVYQAGASERVLGQGLKKFQRDQLVLATKFTNRTTQEIENHVSGREHVLRSLDQSLQNLQTDYVDLYIYHIWDWLTPMAEIMAGLNEAVQAGKVRYIGISNAYSWQIAQINALAVRYGYPQFVSIQSHYNLVYREDERELFSYAHENGLATTPYSPLASGRLAHPFGTQTTRRQQDTFADTKYQATSEMDKPIIDRVEELAHQHHVSMAAINLAWLQQRVTAPIIGATKPHHLDAVAEAAGLALTASEIQYLETPYQPHDLEGVMALNRSRTNNWNQYSGQ
>NZ_CP014780.1|WP_003642171.1|2554016_2554883_-|DUF3737-family-protein
MKTITQQYLTGERALFKAHDLEIDTTTFADGESPLKESRNVTLKQPIFKWKYPLWYSQHVTVDQGLFETMSRSGIWYTKDITITNSTLQAPKLFRRASQVKLAHVHFSDAEETLWNCQDITLNDVQAAGDYFGMNSQNIRIDGFSLVGNYAFDGAKNVEIHHATLMTKDALWNCENVTVYDSQIIGEYLGWNSKNIRFVNCTIESDQGLCYMDNVKLENCTLLNTDLAFEYCRNIDADVVSTIDSVKNPLSGRIHAQAIGEIIMDDPEVDPHQTLISVDHESRAPHAV
>NZ_CP014780.1|WP_003642170.1|2552854_2554027_-|pyridoxal-phosphate-dependent-aminotransferase
MPFDFETVLNRRHTNAVKWDVADDELPMWVADMDFETAPVIKQALIKRAQFGVFGYEEVPMAYYEAVADWWATEHNFRPQIEWLMFCTGVVPAISSIVRKMTAAGDNVLVQAPVYNIFYHSIENNGRHTLSSDLVARDASYAIDWDDLTTKLADPLTTMMILCNPQNPIGIVWSRATLQRLGELCLKYHVLVVADEIHCDLTLNGHTYTPFSSLTAPVAHNSISCISPSKTFNVAALHAATLIIPDAHVRALVSRGINNDELAEPNSFAIPASIAAYTEGHDWVAALRTKLAANQRQVQTYLTAELPQVKLVEAQATYLLWLDVRQVTTDSAALAAFIRQRTGLFLSAGDAYRGDGNRFLRLNVACPTTTLTDGLARLKAGITAYQQVQA
>NZ_CP014780.1|WP_003642169.1|2552112_2552706_-|NAD(P)-binding-domain-containing-protein
MKIGIIGAGTVGTVLAKTFARGDHQIKLSRHSGAASLATRRAEFAANVAFVEVAEALQQPLVILAVPFEQAPAVLAQVADYKQRIVVDVTNQFTADFKKIKTAPLTGSEVIARAANNARVIKAFNTIPPEFMDGHVDGPGKRVLFYAGDDVAAKKEFAALVRPLNFRPVNLGKLRHGGSVMQVGGGLGNTHFVQIEE
>NZ_CP014780.1|WP_003642167.1|2549655_2550339_+|noncanonical-pyrimidine-nucleotidase,-YjjG-family
MQYAIFDLDNTILDFDRAEAANLAAVFQHHGVTDIRRAENEYQAYNETVWQQIEQGADRDSLLDQRFQVFLGTLGITVDGPAVQQEYDQLLAHSYQVIPGAHELLRTLTNAGLTLLVGTNGIKHTQLSRLAGAHMTPYFDHIFISESIGYAKPNPHFFSAIHDQYPDMNATNTVMIGDSLRSDIVGATTAHLPSIWYNPQHVHNDTTIAPTYTVDNFKQLQKLLLTV
>NZ_CP014780.1|WP_003642166.1|2548989_2549559_-|sugar-O-acetyltransferase
MEIDNDPAYQQMINGELYLESPILQQRRRDVRTKLMQYNQIADNDERNTKMKSLLRSAGDRFFVEPTFEFSYGVNIRIGNHFYANHGVTLCDEGLITIGNDCKFGPKVGLYTPAHPLDPTVRRTEAERTAPITIGNDVWIGGSAVILPGVTLGNNVIVGAGAVVTHSFPDNVIVVGNPARVLKQNAPQS
>NZ_CP014780.1|WP_033617510.1|2567120_2567675_-|TetR/AcrR-family-transcriptional-regulator
MVISIRTELDLQRAMYQLLEQRSISQITVEQICKQAFIHRSSFYRYYTDKFDLLRQMVMHTLDELLAAERTNTVGSAIMSTFIGAHTQVLRHLLVTNNEGDNTRSQQVINDCFVTVAETGADDRVFAMIRQSQHPDLTAYLVSGVVTSIVQWLNNGHRDGQAASTQAMIQGTLATVFSLEQHTV
>NZ_CP014780.1|WP_003642181.1|2567773_2568103_-|winged-helix-turn-helix-transcriptional-regulator
MVSSEEALQEFRETIPIFEVLADERRQQIMIELSQHAQGMTVGELTERMHISQPAVSHQLKTLKERHFVAVEHQGTRNYYRVTFDAPLTQVEHLIHTLKADLELKPYLH
>NZ_CP014780.1|WP_061876253.1|2568600_2569545_-|DNA/RNA-non-specific-endonuclease
MVKLMRRVGIAGLLSLSLLLGGCSLLTSGTDTTSSTTSQQSESSRNQTTSATGNTQQTYKQLAKMTYQSGSAAAIKVNSGKSTLAASHWKNSKIDYGNLDSLNRTTTDTAYLSKANLGRSEGRTAQTWSPTGWHNQPITVNGKRVYPQNRGHLIAYTLSFNLTSNGQYRAGEDGSLDNPKNLATQTAYSNQKTMQIYEDQVRTALEQGKKVIYRVTTVFRGNELMPRGYWSQAVSTDGSVNFNVYIWNVEPGVSFDYATGRGKADSTMQVAGADKVSSSQNTSASCSSQSTTTSKQVERELVKYGYKYVKKALN
>NZ_CP014780.1|WP_003642183.1|2569621_2570167_-|GNAT-family-N-acetyltransferase
MTATITIRPLQRAELTTLWQLGFSDPNAEWTRWNGPYFHDQLPTQTDFETIIGPRDWLIRPRNWVITRDGVIVGSVNWHFVDGSLKRWLEVGIIIYNQEHWGEHIGRTALTKWLTHLFQEETTLPHIGLTTWSGNMRMMQLAEAVGLKQEAWIPQVRYWQGQYYDSVKYGILRNDWQVQKD
>NZ_CP014780.1|WP_003642184.1|2570429_2570957_-|GNAT-family-N-acetyltransferase
MTQFETERLILRPMTAADHDALADMIFDPQVVAYLRYRRVQSPAAFEQLFTTHFLADTTTVFGIERRRDHQLIGFYEFHGSGATGELTYALSPAAWGHGYVAEAGNCLMHYGFETLNYETIEAHYASANPNSGRVMAKMGMQAAGELHTFTSDKGEVIHVMRYLLTKATWRQLSA
>NZ_CP014780.1|WP_003644777.1|2571557_2572763_-|CPBP-family-intramembrane-metalloprotease
MTPETEQLLRRWYMGQLIVLFGAAFIQLFTFDGGVFFPVGGMQLLIWGLLAWWPAAEEDQAQWRRLRHVNYYVQTVLQFTLLPILLANLVAWLSQLSWLDEQGLIAVGMAYLMVAFVPVAVVVTKPIESVIGRIAVLITAIFSGVVSAQQTFLILPNLQAPSVFEMVSDTGILGALGFVIAVGVLLRGWGLTGPSWRFNRQAQTSLVVGLIVVGTAFSLWNAFSAGGSWATTFTHWDFQLRSATWKMFLSGLEPGIAEEWLYRFAVLTLLLQAFRHRRYQIDWAVWLSGGLFGMWHITNVFAGQPLSATVEQIIFAATLGWFLASTYLYSGSILLPMVIHAAIDILSMMASGSQTMVKPDVFEWQTIGATVIIFVGITIYFLTGSRRQVIQVHVNQRLSAQ
>NZ_CP014780.1|WP_003644778.1|2572856_2574479_-|ATP-binding-cassette-domain-containing-protein
MLTVNNVSMQFSTRKLYEDVNLKFTPGNCYGVIGANGAGKSTFLKILEGKLQPTTGTVSMGPNERMSSLNQNHFAFEDEEVLATVIRGHEKLYEIMTEKDALYAKPDFSDEDGIRAAELEGEFAEMDGWNAESEADQLLQNLGIDESMQHLKMSELTEPQKVKVLLGQALFGSPDVLLLDEPTNGLDVQSISWLEDFLAGYEKTVIVVSHDRHFLNQVCTHMCDVDFGKITLFVGNYDFWMESSQLAAKLQANANAKKADQIKELQEFVARFSANASKSKQATSRKKQLEKITLDDIKPSSRKYPFIKFTPDREIGNDLVKVENVSKSIEGVKILDNISFTLRPNEKTALISRNDLATTTLMQIIAGSMAPDSGTVTWGQTTSRTYLPKDINEEYAGSELPIIDWLRQFASKEESDNTFLRGFLGKMLFSGSDVERPVNVLSGGEKVRGMLSKMMLSRANVLLLDDPTNHLDLESITALNDSLIDFKGAIVFTSHDHEFIQTIADHIVEVSAKGVVDRGDTTYDEYLAHEATQGRVQDLY
>NZ_CP014780.1|WP_003644779.1|2574791_2575586_-|HAD-family-hydrolase
MTIKLIATDMDGTFLNDHGDYDQERFANDYAALQQRGIQFVIASGHQAAELATTFSAYPEMWLIGGNGAELWQREAGLKAATFSPQATQQVLAALAPYPELQVALCGTQTVHVLAHANPQFVANMRDYYYQLETCADLTTVTDPVVKFDVICPAAMTEQLVYELTPKLAGIAVPASGGQGSMDLIQPGMHKGRALKQLGEQLGILPDEMLVFGDGTNDLEMFHYATHAVAMQNAPENVQANATAVTGTNVDNGVLDYIEQHILS
>NZ_CP014780.1|WP_003642189.1|2575672_2577598_-|DUF2207-domain-containing-protein
MPKKAVAVSRAPRPGEYDKLGLTIIGGGDGEMSKKRRLSWLSVLGLLAGFCWWFSLAMRAAADYDIDQYQVNVAIQRDGSANVTQAMTYQFDDDYHGVFNVQDLKGIQGAQLEGVTTQLNGGTTVTAAPSETGANNTYQLTQNADRMRVKLYRQVQEDDKLRVVYRYRLKGVVTNYADTAELNWKVIGSGWDVPLNNVKIVIQLPAKNVSALQAWTHGPLSGQTKVERAAGRVTMTLGHNPANQFVESHLLFPTTVTATNTRTNTAKRKATVQKQEAKLAQEANEKRRRNQLLRRVIFGAAVAGWLLVMIGYLWWLARHPAKPHQQPIPINHSFDVPPVTPAVAESLWAQRSPNTDALTAEILRAAANQEITIETVAGHRKPDVRLTQLKPVTNSFLAHCFDKIAVDGQFMLTDLKKYGKRDKAGRLGKWFSRWQTEVDQDVAVYQDETNYRLRNQWLMAAVVVSVMGMIATGAGLLVSPKVVTLMVIPAVVAAVAFWIGWIIQRRRIAINTDAGLELRNQINGLRRMLKDIGHFNTAQVGDLILWEQILPYAAAFGLANQVTKQLAIDFGTEALATGMLVYYPLFYANGGLDFDLSGAINDSFSGALDASGSASSASGGSGGFSGGSSGGFGGGSGGGAF
>NZ_CP014780.1|WP_003642190.1|2577648_2580156_+|excinuclease-ABC-subunit-UvrA
MPQTTLPTHIQVRGAHVNNLKNIDIDIPLNEFVAITGRSGSGKSSLAMGVLYAEGARRYLNALSTFTRRRINQVGKASVDSVQYLPSALALRQRPQVPGVRSTVGTMSESLNILRLAFSRLSSAVCPNGHRMPPTLDVAENDGYVTCPTCGAKFRAPGAEDFAFNSGGACPTCGGLGQVRQIDPALIIADENQTIEEGAVASWHLPGRNFMPIVAREIGIPIDIPYKDLSEADKARVLHGPKQTVAINIPSAKGKIFHMDNAVYENAFAAVEDSMATTKNERAITRLNRFYKFDTCPDCHGSRFNPQLFNYELNGQNIATVSDMTVAALHDFAATIVPWLPTKMHHLGQSLVDELLLSLQPMEELGLDYLTLSRPGATLSTGELQRIQLGRTLRSATTGVLYVLDEPSVGLHPANVAGLIKAFRGLVAQGNSVVVVDHDTSIISAADDVIEIGPGAGKHGGTVVGQGTVAAIKQDKESLIAPFLTGTATLRERPVLTDDALWKKGALAIEVAHHFNIQDITARIPKNRFTTVTGMSGAGKTTLVLDSLIPALIATAKKRPLPTHVKAFDNGHIRHVVTVDSVPVGKNVRSTVATYTNILDHLRQLFAATPAAQANGWTASQFSYNVAAGACPTCGGTGQISLDVQYLPDITEVCPQCHGKRYNKQTLTVKWHGYSIADILDLAVDEALPIFKAQSAIANTLQILHDMGLGYLLLGESTPALSGGEAQRLKLTSRIGKRQTGTLFVFDEPSVGLHPLDIQQLVKVFDQLIQQGATVIAIEHDLDVIANADYVIDMGPAGGINGGNIVATGTPLAVSQNPTSVTGQYLKTHLALFHV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP014780_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP014780_3

2744127-2744212

Orphan

Consensus_repeat	Method
TAAGAAACTTAAAGTGTCTTATT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP014780_3

>merge|NZ_CP014780|3|2744127-2744212|CRISPRCasFinder
TAAGAAACTTAAAGTGTCTTATTCGCATAACTGGTATAATACGCTATATAAAGAAAAAGTCAATAAGAAACTTAAAGTATCTTATT

>NZ_CP014780|3|1|2744127-2744212|CRISPRCasFinder
TAAGAAACTTAAAGTGTCTTATT	CGCATAACTGGTATAATACGCTATATAAAGAAAAAGTCAA
TAAGAAACTTAAAGTATCTTATT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP014780.1\|WP_003643403.1\|2751584_2752091_-\|acetyltransferase	unknown	unknown	gnl\|CDD\|100047
NZ_CP014780.1\|WP_003643396.1\|2741563_2742517_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381318
NZ_CP014780.1\|WP_003642357.1\|2752349_2753186_+\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|212492
NZ_CP014780.1\|WP_003642340.1\|2736945_2737230_+\|DUF1905-domain-containing-protein	unknown	unknown	gnl\|CDD\|378097
NZ_CP014780.1\|WP_003643392.1\|2737513_2737879_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP014780.1\|WP_003643401.1\|2749141_2749654_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274100
NZ_CP014780.1\|WP_046947557.1\|2744229_2744829_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP014780.1\|WP_003643395.1\|2740777_2741344_-\|DUF1211-domain-containing-protein	unknown	unknown	gnl\|CDD\|226078
NZ_CP014780.1\|WP_003642338.1\|2732394_2733807_+\|NAD-dependent-succinate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143418
NZ_CP014780.1\|WP_003643400.1\|2746906_2747905_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP014780.1\|WP_003643393.1\|2738898_2739465_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP014780.1\|WP_003642355.1\|2750821_2751568_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP014780.1\|WP_003643391.1\|2734077_2736660_-\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|119382
NZ_CP014780.1\|WP_046947556.1\|2738011_2738740_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP014780.1\|WP_003643397.1\|2742633_2744112_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP014780.1\|WP_003643394.1\|2739591_2740629_+\|aldehyde-reductase	unknown	unknown	gnl\|CDD\|187538
NZ_CP014780.1\|WP_003642352.1\|2747901_2748897_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP014780.1\|WP_003643402.1\|2749634_2750528_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187572
NZ_CP014780.1\|WP_046947578.1\|2744949_2745831_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238558
NZ_CP014780.1\|WP_003642350.1\|2746115_2746910_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045

Protein	Function_ID	Function_description	E-value
NZ_CP014780.1\|WP_003643403.1\|2751584_2752091_-\|acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	1.58107e-53
NZ_CP014780.1\|WP_003643396.1\|2741563_2742517_-\|aldo/keto-reductase	gnl\|CDD\|381318	cd19092, AKR_BsYcsN_EcYdhF-like, Bacillus subtilis YcsN, Escherichia coli YdhF and similar proteins. Bacillus subtilis YcsN and Escherichia coli YdhF are prototypes of this family. They are uncharacterized aldo/keto reductase family oxidoreductases.	5.34652e-129
NZ_CP014780.1\|WP_003642357.1\|2752349_2753186_+\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|212492	cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs. Classical SDR subgroup containing retinol-DHs, LPORs, and related proteins. Retinol is processed by a medium chain alcohol dehydrogenase followed by retinol-DHs. Pchlide reductases act in chlorophyll biosynthesis. There are distinct enzymes that catalyze Pchlide reduction in light or dark conditions. Light-dependent reduction is via an NADP-dependent SDR, LPOR. Proteins in this subfamily share the glycine-rich NAD-binding motif of the classical SDRs, have a partial match to the canonical active site tetrad, but lack the typical active site Ser. This subgroup includes the human proteins: retinol dehydrogenase -12, -13 ,and -14, dehydrogenase/reductase SDR family member (DHRS)-12 , -13 and -X (a DHRS on chromosome X), and WWOX (WW domain-containing oxidoreductase), as well as a Neurospora crassa SDR encoded by the blue light inducible bli-4 gene. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	4.07613e-56
NZ_CP014780.1\|WP_003642340.1\|2736945_2737230_+\|DUF1905-domain-containing-protein	gnl\|CDD\|378097	pfam08922, DUF1905, Domain of unknown function (DUF1905). This domain is found in a set of hypothetical bacterial proteins.	1.07383e-22
NZ_CP014780.1\|WP_003643392.1\|2737513_2737879_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.44304e-30
NZ_CP014780.1\|WP_003643401.1\|2749141_2749654_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|274100	TIGR02366, conserved_hypothetical_protein, probable dihydroxyacetone kinase regulator. The seed alignment for this family was built from a set of closely related uncharacterized proteins associated with operons for the type of bacterial dihydroxyacetone kinase that transfers PEP-derived phosphate from a phosphoprotein, as in phosphotransferase system transport, rather than from ATP. Members have a TetR transcriptional regulator domain (pfam00440) at the N-terminus and sequence homology throughout.	3.33884e-08
NZ_CP014780.1\|WP_046947557.1\|2744229_2744829_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.56784e-08
NZ_CP014780.1\|WP_003643395.1\|2740777_2741344_-\|DUF1211-domain-containing-protein	gnl\|CDD\|226078	COG3548, COG3548, Predicted integral membrane protein [Function unknown].	1.18048e-27
NZ_CP014780.1\|WP_003642338.1\|2732394_2733807_+\|NAD-dependent-succinate-semialdehyde-dehydrogenase	gnl\|CDD\|143418	cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like. Succinate-semialdehyde dehydrogenase 1 (SSADH1, GabD1, EC=1.2.1.16) catalyzes the NADP(+)-dependent oxidation of succinate semialdehyde (SSA) to succinate. SSADH activity in Mycobacterium tuberculosis (Mtb) is encoded by both gabD1 (Rv0234c) and gabD2 (Rv1731). The Mtb GabD1 SSADH1 reportedly is an enzyme of the gamma-aminobutyrate shunt, which forms a functional link between two TCA half-cycles by converting alpha-ketoglutarate to succinate.	0
NZ_CP014780.1\|WP_003643400.1\|2746906_2747905_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	2.31826e-81
NZ_CP014780.1\|WP_003643393.1\|2738898_2739465_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	5.97622e-05
NZ_CP014780.1\|WP_003642355.1\|2750821_2751568_-\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	2.40011e-91
NZ_CP014780.1\|WP_003643391.1\|2734077_2736660_-\|SH3-domain-containing-protein	gnl\|CDD\|119382	cd06522, GH25_AtlA-like, AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.	1.48653e-70
NZ_CP014780.1\|WP_046947556.1\|2738011_2738740_+\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	2.25391e-90
NZ_CP014780.1\|WP_003643397.1\|2742633_2744112_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	3.12844e-72
NZ_CP014780.1\|WP_003643394.1\|2739591_2740629_+\|aldehyde-reductase	gnl\|CDD\|187538	cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs. This subgroup contains aldehyde reductase of the extended SDR-type and related proteins. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.78417e-95
NZ_CP014780.1\|WP_003642352.1\|2747901_2748897_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	6.82997e-79
NZ_CP014780.1\|WP_003643402.1\|2749634_2750528_-\|SDR-family-oxidoreductase	gnl\|CDD\|187572	cd05262, SDR_a7, atypical (a) SDRs, subgroup 7. This subgroup contains atypical SDRs of unknown function. Members of this subgroup have a glycine-rich NAD(P)-binding motif consensus that matches the extended SDRs, TGXXGXXG, but lacks the characteristic active site residues of the SDRs. This subgroup has basic residues (HXXXR) in place of the active site motif YXXXK, these may have a catalytic role. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	3.82369e-130
NZ_CP014780.1\|WP_046947578.1\|2744949_2745831_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238558	cd01138, FeuA, Periplasmic binding protein FeuA. These proteins have predicted to function as initial receptors in ABC transport of metal ions in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	2.58356e-56
NZ_CP014780.1\|WP_003642350.1\|2746115_2746910_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	5.60764e-114

>NZ_CP014780.1|WP_003643397.1|2742633_2744112_-|DHA2-family-efflux-MFS-transporter-permease-subunit
MQAKAKISKATMTIAWVVVFGAMAPLLDSTMINIAINNLVTSFHSSVTTVQWAVTGYLLATGVAVPFSSWLLNRFDGKAVFVAGEILFGLGSIFAAVAPNIQLLIIARLVQGFAGGLIMPLLTTLLVQTAGAAVMGQMMATVGLPMILGPLIGPVIGGIIIKFASWHWIFWINVPVVLISIALILWKMPNYPAQNRTAKMDFIGILLLIVSSSAIIYSLVNAAHTDRFNNATSIEMLILGAIALISYVVWAAWQKERAVVPLHLFKFASFDGAGLGLFIAGTVLNGAMLLLPLYFQNVRGMSVINAALALLPQGAGMLVSRTLTGRLTDQIGAKYVVLGSVVITFVGTLPFYWFGQQTSYWILALVLFVRGIGAGGILMPLMADAYTGMQPGQVPAATIGTRIIQNIGSAFGSALITTIVTAYSTHQVNVFERHLKAGTYHVDAAHLQVFTTSHLQAIRLAAFQQGFLVIAIAAIVIILPTLLLTNKLKAAK
>NZ_CP014780.1|WP_003643396.1|2741563_2742517_-|aldo/keto-reductase
MKTIQIGASQLKASAVALGIMRMVRLDTDAAANVLETVHDRGVNFIDSADIYGNGDSERIFGQALKQSSLKREDFFIQSKGGIVLDPEKSSGELVFGQRYDFSKQHLIATIDKILQRMQLDYLDSFLLHRPDPLMDPAEVAAAFDELQAAGKVRHFGVSNFNPMQVEMLQAAISQKLMINQLQFGVMHTGPIQFGLHTNMQDTASLNHDGEIIEYSRLHHMTIQAWSPYQYGMFAGTFIDNPKFPELNAKLQELADQYHVTKNAIATAWILRHPANMQVILGSMNPQHLDESIAGTDMTLTRQEWYDVYFAAGNDLP
>NZ_CP014780.1|WP_003643395.1|2740777_2741344_-|DUF1211-domain-containing-protein
MNKARLEAFTDAIIAIVLTLLVLDLPRPQTPSVRALFAEWQSIYVYIITFTLLISIWLNHHDLFVQVKKIDRVVFGANSFWLLCQSFIPFMASWITKFPHSKWPAVFYILTGFVWMLAYQLLVAAVRRLNPHIHRMSSPALSVVFGGFLVVLTVALINPDVGLFLIPVHAFASVILATKRKWHLRKYF
>NZ_CP014780.1|WP_003643394.1|2739591_2740629_+|aldehyde-reductase
MQKQLVVVTGGSGFIAIHIIRQLLQQGYAVRTTVRSLAKAPVIKEMLTNGGITDLSALEIVVADLAHDEHWSEAMAGATYAIDVASPTPKLNFKNKAEMIRPAVDGVRRVLTASRDAGVKRVVLTSAYGAIFAGHKNRTTPYTEADWSDLNWKAIHPYQESKTRAELAAWDFINHEGRGLELTTVNPVAVMGPVLSAKYSHSNIQIQQFLEGQVKAVPNVDSGYVDVRDVASLHLLAMTAPQANGERFLATTGETLSMLDVANVLRQAFPAFASQLPTKTISNAAVKLAAKARPELRMVASLVGTYAETSNHKAQTLLDWHPRPAAESIIATAQSMIDLGIVTKP
>NZ_CP014780.1|WP_003643393.1|2738898_2739465_-|TetR/AcrR-family-transcriptional-regulator
MAATNHAQAIKKDSQTYLTTALLQLLRTHDLDTITVTQVVKRAGVSRMAFYRNFTTLEDLLTAYFAPAIAARFQDVLQHVPANRKLLAMGQFFSDFAPTLRLAEQRGFENIIQQLFNANMTNYYQATMTNGMLTAVQLKYWTRFMSAGVYAIWREWLLGGQLESLTMIHELLATLQTATMQALTQAQK
>NZ_CP014780.1|WP_046947556.1|2738011_2738740_+|SDR-family-oxidoreductase
MKPLVVITGASSGFGAEIAKLFAADNYPLLLLGRRQAKLAALSANFENAMIDTVDVTNYHQFETAVRKAEAKYGKTDLLVNNAGLMLLGNVQNQDPQEWQTMLNTNVMGVLNGTQIVLNDMRDREHGTILNMSSLAGKKPFVNHAAYVASKFGVHGLSETLREENAPKNVRVMLVAPGAAETELLTHVTSKSALSDYEAWKASMGGLTLDPKHVAATVKFMYDMPQNVNIREVDIAATAQDA
>NZ_CP014780.1|WP_003643392.1|2737513_2737879_-|helix-turn-helix-transcriptional-regulator
MLKERVTAQPRYRNEFDATMQLIRGKWKIMILFELAEVKVSRFADLQHHIQAVSHKTLASQLKKLEQDELIERHDFKTAQPHVEYRLTAKGQSLIPILDAICTWGDQHVDPALIERSLCDE
>NZ_CP014780.1|WP_003642340.1|2736945_2737230_+|DUF1905-domain-containing-protein
MKTYQFDAPIQAATIGKGGAYVACPFDIRDLFGKGRVKVHATFDEVPYNGSIVNMGVKNLDGSICYILGIRKDIRAKLHKSIGDVVAVTVTAID
>NZ_CP014780.1|WP_003643391.1|2734077_2736660_-|SH3-domain-containing-protein
MNFKSQNPIDASQSERFKLYKSGKLWLVAGLTFFSFLGGSVLNNTNVHADVTTATTTSSSAASTASSASVATSSAASDATTKATSVSSSATTQVTSAATTKTTSQAATASSSAATSQSTSTASSSTSQATKTASSAAASTSATATSQATSVASSTATTTQVSRTASSTAASAASSTATVKAVTPASSTVSSAATTAIKATAKVAAVAYTAATTSSTDVWTIGDTTRPRVDVVDVASYQSTMTQSDFNKLKAAGVKTVIVKSTEGTDYTNPAALNQAKMANKAGLNVDFYHYATFSTADAAKSEATNMAGFLVKNNVSTKVLLFADMEDSSSYSVNATANLNAFWSTLDSFGYKNHGVYTSNSYLYRDAVVKTVGQSRVWRAQYPYTPSANNLWNTNDGAWQFSDTALLPSGSDYTGYIDVSIDYNGLTEDSAGTNTFVTTTSSNDTTTSEVTTDTSATTNTSTSSTTKKASGWYTFTKNTAIKSAASDSAKTVGTYSKGNRVYYNAEVTTNGETWLRYLSYSGSEHFVKIAAAKTTTTKPAASTSKTVTKNETGTYKFTKTTAIKGSVSDSAKTLGTYYKGDTVYYNAKVTKNGETWLRYLSYSGAQHYVKISGAATSTTTTKPATSSSKTVTKAETGTYKFTGTTAIKGSVNDSAKTLGTYYKGDTVYYNAKVTKNGQTWLRYLSYSGAQHYVKISGAATTTTTSSKSTATASAKTVAQSGTYKFAKTTAIKSSASDAASTVGTYYKGNTVNYNAKVTTNGQTWLRYTSYSGAQHYVKVSGGAATTTSSSASKTTAAAGTYTFKTTTNIRTAASLNASVVGQYSAGESVYYIGTVSADGYQWLKYLSNSGAYHYVAKIG
>NZ_CP014780.1|WP_003642338.1|2732394_2733807_+|NAD-dependent-succinate-semialdehyde-dehydrogenase
MAYQTINPYTNEVVKTYDNATTDQIEQALTTGDALYHQWRHEPVSSRAASLHKIAALLREHKDELAKIATIDMGKLLSESQGEVELCAMIADYYADHGAELLAPTPISTQATGDAEIEKQATGVLMLVEPWNFPYYQIMRVFAPNYMVGNPMILKHASNTPGSAAAFAKIVEEAGAPAGSLTNLFLNYDQVSDIIADPRIQGVALTGSKRGGQAVAKAAGANLKKSSMELGGSDAFVVLADADIDEAVNLAWRVRLYNAGQVCTSSKRFIVAADVYDDFLAKLKERFAKLVPGDPMDPQTTLAPMNSKRAKEKLQDQVDRAIAGGATVAYGNEPIDLPGQFFQPTILTDIDQDNPLFYEEMFGPVAQVFKVDSEQAAIDLANNSELGLGGIVFAGTAAHGKAVAQQIETGMVFVNTFLSSLPELPFGGVKGSGYGRELSSLGLMAFVNEKLVVTAQKPDYDNGAGGLVVL
>NZ_CP014780.1|WP_046947557.1|2744229_2744829_+|TetR/AcrR-family-transcriptional-regulator
MTKTRRRGAELENAIYQAVRDILNQDGLEQLTFANVAEQAGTSKPVIYRRWRSPLELAIAAIQDQIITENHGQLDEVSLTGQTLSEDLFQVLKRFTVSINTFNQALVITWFHHLDQQANPEVKDLLNAVKKIDAHAIERVCQRAQQRGELRTGTLSCDLQLMPFDWLRYRAFANEPITDATLHLLVDDLLVPAYQHALG
>NZ_CP014780.1|WP_046947578.1|2744949_2745831_-|ABC-transporter-substrate-binding-protein
MGSLLLGACGAKQPTSTTVTRTDYLKHKVKVPKHPKRIVASYLEDDLVALGIKPVVQWSVKNGSGTQAYLKEQLKGVPLIDYSLPYEAVTKAKPDLILIGTSSTVANGKYAQYNKIAPTYVVKNGTTVTWRQTFLDVAKVVNRQAKAKKVLAKYDKQVQTTRQALKKSGQHKVAVLWVTNNTAYMVNDNSASGALLYQDLQLGEPSLVKQVSKSATADWSAVSLEKLAKLDADDIFLVNSQKSASLFKDPLWKNIKAVKNNHLYQYGDSSSWQYSGPIAYSQMIDMVKTDLLK
>NZ_CP014780.1|WP_003642350.1|2746115_2746910_+|ABC-transporter-ATP-binding-protein
MNTIEAQNISIGYGDKVIVDQLSITIPHGQITTLIGPNGSGKSTLIRAIAHLLPPTTGVILLDHQNIQQIKSKTFAKKIAVLPQTNQTANDLTVEELVSFGRLPYRRPLSGLTTTDHQKIEWALTQASLQDLRQRPLSTLSGGQRQRAWIAMAVAQDTDTIILDEPTTYLDLTHQLEVMQLVKKLNEQAHRTIIMALHDLNHAARISDQLIALKDGHVLAHGPVSTVMTAANLKTIFNIDATLVDYHGTPLILTYNGCQEVAPA
>NZ_CP014780.1|WP_003643400.1|2746906_2747905_+|iron-ABC-transporter-permease
MKSTSRYWGWLALSTGVLILVMGLSLRFGADQMRTATVWHALTTTHTGNLDQQIIRHIRVPRVLGAALIGAALAGSGALMQAVTRNPLADSGLLGINAGAGLMLTLCLAFFPKLSTLQTTGWAIIGAAASAGLIFSISTARHVQLDPTILVLAGIAISSLLTALSEGLALVLQLKQDLAFWYFGGLGAVSWTQLKFLGPGLVLGLLLTLLLAPQLNLAYLTDDNAQSLGKSLPLLRGLALICAVILSGISVALVGTITFVGLMIPHMARWLVGANYRNSMPLTLILGATLTVGADLIARLVNPPHETPFGIIISLIGVPCFIYLARKEPMKA
>NZ_CP014780.1|WP_003642352.1|2747901_2748897_+|iron-ABC-transporter-permease
MSPNRRLIIWSLLLTASMLGLAILNLSTGTMTISWPALLGILTGRGNATDMLVLVNFRLPRIVLAIMVGWALALSGNVLQTVTNNPMADPSLLGINNGAGLAVMLLIIGAGTNASLTLSLPIVALAGAWLSTALIFLLANQRQRGISSKRLLLVGVALSGCFSALMVLMTLKLSPDNYQFVMNWLAGSLWGTDWSYIGWALPWLAVGSGILFIQLPVLDAFTLGTTTAQTLGINLKRQQLGLISVAAMLAGVSVAISGGISFIGLITPNLARRIVGSRQRYQLPLAGLLGSTLLLAADTLGKLITTTTELPAGVLVALIGAPYFIYLLVRR
>NZ_CP014780.1|WP_003643401.1|2749141_2749654_+|TetR/AcrR-family-transcriptional-regulator
MANQRNQRMQATILLAYENLLSDKPFRKITVQDISDAALVHRSTFYKHFQDQYDLLEALFEQKRQQSKLTIDQIFTHPFETLNSFGNARFQETLRHQFNDDAFRDAFLNYLIHLCKDTVDDDQRLVRFLAVGRIKGLTLWITVGNAPYNIFTDTATLDNIFSNPLNTVNY
>NZ_CP014780.1|WP_003643402.1|2749634_2750528_-|SDR-family-oxidoreductase
MKVFITGGTGFVGSAVVQELVANGFEVVGLARSETSAQKLISWGAQPVRGSLTSLSTLATAAAQADAIIHLGFNNDFRHFFQAGAMDRRAIETMGRAISGTNKPLVVTYGTTGIRKHVETEHEVADTGLLKWLTPRKSEIVARQLMAQNINAFVVRLSPAVHGAGDKGFTRTVIERAKKSHRAEYFGLGTHAWSAVHRLDAAHLFYLVTMYGLEHPTTNERVFNAVAEESITTAAIARTISRKLNVPLKAKYNPLSFGDTAMLYLINCPTSSQLTRQILGWVPVQPDLLTDISSSRY
>NZ_CP014780.1|WP_003642355.1|2750821_2751568_-|SDR-family-oxidoreductase
MSIKGKVVVITGASSGIGAATAKLLAAKGAKVVLGARREERLQALSQAIGDNAVYQVTDVTDRQQVRALIDLAVSKFGRVDVLYNNAGTMPQGNLSDREYDKWQMMLNVNIMGVLNGIGEVLPIMQKQHDGLIIATDSVAGHVVYPASAVYNGTKYAVRAIMEGLRQEEKEHGIRSTIVSPGAVRTELVNTIGNTQIQAGISELMNADDRQGLALNPEDIANAVLFAIDQPKHVAISEVLVRPAQQEV
>NZ_CP014780.1|WP_003643403.1|2751584_2752091_-|acetyltransferase
MQTIQPIVDANQRRIQALNVTREPSEIRERLAEITGQTIDISVEIRVPLWTDYGRNLKIGKRVFINDNVQITDLGGIELADDVLIGPGAMLLSVNHPLDPAKRHAVEVQPIHIERNAWIGAGAKVLAGVTVGENAVVGAGAVVTKSVPANTVVAGVPAKVIKTIEQVD
>NZ_CP014780.1|WP_003642357.1|2752349_2753186_+|SDR-family-NAD(P)-dependent-oxidoreductase
MQSKLAVIIGGTSGVGKHTAIDLANQNYHVIIVGSRADKGRQAQADISQATGNQAVQLALADLSTKTGVQQFAHQLAAMTDHIDILLNSIGVMLPERHLSADGYDLNLVLNYLTHFWTIQALLPLLKHSDQARILLVGALPFVINHAKVSLPDFDAPATSKYNAMTVTAQATAARVLLTLALSERLTATNVTINIFHPGYVPDSNFGAGGSWVSRLAGRILGESFSRKNSPIGAWLATAPELTHTSGHFYDDRLRQVRLSKQYTRSKANDLWRLSSQY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP014780_1	1.2\|1124781\|28\|NZ_CP014780\|PILER-CR	1124781-1124808	28	NZ_CP014780.1	1124679-1124706	0	1.0
NZ_CP014780_1	1.3\|1124832\|28\|NZ_CP014780\|PILER-CR	1124832-1124859	28	NZ_CP014780.1	1124934-1124961	0	1.0
NZ_CP014780_1	1.4\|1124883\|28\|NZ_CP014780\|PILER-CR	1124883-1124910	28	NZ_CP014780.1	1124679-1124706	0	1.0
NZ_CP014780_2	2.1\|2566190\|26\|NZ_CP014780\|PILER-CR	2566190-2566215	26	NZ_CP014780.1	2566106-2566131	0	1.0
NZ_CP014780_1	1.1\|1124730\|28\|NZ_CP014780\|PILER-CR	1124730-1124757	28	NZ_CP014780.1	1124934-1124961	1	0.964
NZ_CP014780_1	1.3\|1124832\|28\|NZ_CP014780\|PILER-CR	1124832-1124859	28	NZ_CP014780.1	1124628-1124655	1	0.964
NZ_CP014780_1	1.1\|1124730\|28\|NZ_CP014780\|PILER-CR	1124730-1124757	28	NZ_CP014780.1	1124628-1124655	2	0.929

1. spacer 1.2|1124781|28|NZ_CP014780|PILER-CR matches to position: 1124679-1124706, mismatch: 0, identity: 1.0

taacagtgccaagagtattaatcaagcg	CRISPR spacer
taacagtgccaagagtattaatcaagcg	Protospacer
****************************

2. spacer 1.3|1124832|28|NZ_CP014780|PILER-CR matches to position: 1124934-1124961, mismatch: 0, identity: 1.0

cagtagtgcgaaaaatactagtcagaca	CRISPR spacer
cagtagtgcgaaaaatactagtcagaca	Protospacer
****************************

3. spacer 1.4|1124883|28|NZ_CP014780|PILER-CR matches to position: 1124679-1124706, mismatch: 0, identity: 1.0

taacagtgccaagagtattaatcaagcg	CRISPR spacer
taacagtgccaagagtattaatcaagcg	Protospacer
****************************

4. spacer 2.1|2566190|26|NZ_CP014780|PILER-CR matches to position: 2566106-2566131, mismatch: 0, identity: 1.0

cattcaatgttccaagcccattagta	CRISPR spacer
cattcaatgttccaagcccattagta	Protospacer
**************************

5. spacer 1.1|1124730|28|NZ_CP014780|PILER-CR matches to position: 1124934-1124961, mismatch: 1, identity: 0.964

cagtagtacgaaaaatactagtcagaca	CRISPR spacer
cagtagtgcgaaaaatactagtcagaca	Protospacer
*******.********************

6. spacer 1.3|1124832|28|NZ_CP014780|PILER-CR matches to position: 1124628-1124655, mismatch: 1, identity: 0.964

cagtagtgcgaaaaatactagtcagaca	CRISPR spacer
cagtagtgcgaaaaatactagtcaggca	Protospacer
*************************.**

7. spacer 1.1|1124730|28|NZ_CP014780|PILER-CR matches to position: 1124628-1124655, mismatch: 2, identity: 0.929

cagtagtacgaaaaatactagtcagaca	CRISPR spacer
cagtagtgcgaaaaatactagtcaggca	Protospacer
*******.*****************.**

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP014780_2	2.1\|2566190\|26\|NZ_CP014780\|PILER-CR	2566190-2566215	26	AP014283	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S23-C59, * SEQUENCING IN PROGRESS *	15532-15557	4	0.846

1. spacer 2.1|2566190|26|NZ_CP014780|PILER-CR matches to AP014283 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S23-C59, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.846

cattcaatgttccaagcccattagta	CRISPR spacer
cattaaatgttccatgcccattaaaa	Protospacer
**** ********* ********. *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

37635 : 50176

Staphylococcus_phage(42.86%)

tail,integrase,capsid,head,portal,terminase

attL 37076:37090|attR 44077:44091

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
37076:37090	attL	NA	NA	NA	NA
WP_021336920.1\|37635_38790_-\|integrase	site-specific integrase	A0A172LN96	Lactococcus_phage	1.0e-59	36.7
WP_061876022.1\|38860_39574_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_027822563.1\|39720_39900_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_061876023.1\|40182_40401_+	hypothetical protein	NA	NA	NA	NA
WP_061876024.1\|40397_41198_+	bifunctional DNA primase/polymerase	NA	NA	NA	NA
WP_061876025.1\|41197_42592_+	virulence protein	Q4ZD27	Staphylococcus_phage	2.5e-68	36.3
WP_061876026.1\|42736_43156_+	hypothetical protein	NA	NA	NA	NA
WP_046947484.1\|43179_43362_+	sporulation protein Cse60	NA	NA	NA	NA
WP_061876027.1\|43371_43710_+\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	5.5e-09	35.6
WP_027822995.1\|43702_44092_+	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	3.0e-19	45.2
44077:44091	attR	NA	NA	NA	NA
WP_061876028.1\|44787_45261_+\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_061876029.1\|45257_46961_+\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	2.4e-121	40.3
WP_061876030.1\|47115_48222_+\|portal	phage portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	9.4e-50	33.6
WP_061876031.1\|48211_49792_+\|capsid	phage major capsid protein	A0A1J0MFW8	Staphylococcus_phage	3.7e-39	31.9
WP_061876032.1\|49906_50176_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA

DBSCAN-SWA_2

332269 : 375846

Bacillus_virus(50.0%)

protease,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643762.1\|332269_332833_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_003641929.1\|333026_333695_+	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_003641930.1\|333852_335358_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_003643763.1\|335622_335991_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|336103_336613_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_003643764.1\|336643_337840_-	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003641934.1\|337949_338420_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_003641935.1\|338438_338894_+	hypothetical protein	NA	NA	NA	NA
WP_003641936.1\|338997_339570_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_025015650.1\|339735_340656_-	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_024971424.1\|340792_341704_+	oxidoreductase	NA	NA	NA	NA
WP_003641939.1\|342593_343040_-	hypothetical protein	NA	NA	NA	NA
WP_003641940.1\|343277_344804_+	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_003641941.1\|344804_345776_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_024971425.1\|345853_347185_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003643773.1\|347650_349168_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_003641944.1\|349182_351012_+	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_003641945.1\|351026_351749_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
WP_061876046.1\|352335_356019_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_003641948.1\|357815_358733_+	hypothetical protein	NA	NA	NA	NA
WP_003641949.1\|358776_359040_+	hypothetical protein	NA	NA	NA	NA
WP_003641960.1\|359151_359427_+	hypothetical protein	NA	NA	NA	NA
WP_003641962.1\|359808_360426_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_046947807.1\|360429_361584_-	MFS transporter	NA	NA	NA	NA
WP_011100993.1\|361587_362379_-	HAD family hydrolase	NA	NA	NA	NA
WP_003641965.1\|362449_363322_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_003641966.1\|363481_364297_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_011100994.1\|364822_366199_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_061876047.1\|366243_367428_+	cation:proton antiporter	NA	NA	NA	NA
WP_027821506.1\|367991_368171_+\|bacteriocin	class IIb bacteriocin, lactobin A/cerein 7B family	NA	NA	NA	NA
WP_046947804.1\|369115_369784_-	hypothetical protein	NA	NA	NA	NA
WP_046947768.1\|371044_371191_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_011100998.1\|371381_372710_+	GHKL domain-containing protein	NA	NA	NA	NA
WP_011100999.1\|372710_373454_+	LytTR family transcriptional regulator DNA-binding domain-containing protein	NA	NA	NA	NA
WP_003641982.1\|373572_374316_+	response regulator transcription factor	NA	NA	NA	NA
WP_046947769.1\|374620_375394_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003643811.1\|375492_375651_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
WP_003641985.1\|375675_375846_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA

DBSCAN-SWA_3

552596 : 645059

107

Lactobacillus_phage(34.78%)

tail,integrase,capsid,head,portal,protease,tRNA,terminase,plate

attL 542781:542796|attR 604660:604675

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
542781:542796	attL	NA	NA	NA	NA
WP_003640924.1\|552596_553289_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_003643927.1\|553478_554810_-	C1 family peptidase	R4TV59	Phaeocystis_globosa_virus	5.4e-68	33.3
WP_003640926.1\|554885_555569_-	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_003640927.1\|555577_555874_-	N-acetyltransferase	NA	NA	NA	NA
WP_003640928.1\|556012_556549_+	dUTP diphosphatase	J9PV85	Bacillus_phage	2.4e-35	45.8
WP_061876073.1\|557596_558976_+	DNA repair protein RadA	NA	NA	NA	NA
WP_003640931.1\|558991_560167_+	PIN/TRAM domain-containing protein	NA	NA	NA	NA
WP_003640932.1\|560492_561983_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_024521299.1\|562260_563673_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	8.9e-45	29.8
WP_003640934.1\|563674_564085_+	Mini-ribonuclease 3	NA	NA	NA	NA
WP_003640935.1\|564056_564842_+	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
WP_003644974.1\|564843_565392_+	NYN domain-containing protein	NA	NA	NA	NA
WP_003640938.1\|565898_566501_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_003637768.1\|566562_566712_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_003640939.1\|566723_566909_+	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_003643932.1\|567013_567562_+	transcription termination/antitermination protein NusG	NA	NA	NA	NA
WP_003640941.1\|567589_568477_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003640942.1\|568578_569004_+	50S ribosomal protein L11	NA	NA	NA	NA
WP_003640943.1\|569104_569794_+	50S ribosomal protein L1	NA	NA	NA	NA
WP_003643933.1\|569992_570496_+	50S ribosomal protein L10	NA	NA	NA	NA
WP_003637775.1\|570557_570926_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_061876074.1\|571077_572280_-\|integrase	tyrosine-type recombinase/integrase	A0A126GGK4	Streptococcus_phage	2.0e-37	29.5
WP_061876075.1\|572459_573623_-	DNA/RNA non-specific endonuclease	NA	NA	NA	NA
WP_011101078.1\|574112_574289_-	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	1.2e-07	53.4
WP_011101079.1\|574430_575477_-	Ltp family lipoprotein	V9QJ01	Oenococcus_phage	9.3e-23	44.4
WP_011101080.1\|575506_575875_-	membrane protein	NA	NA	NA	NA
WP_041153536.1\|575947_576364_-	ImmA/IrrE family metallo-endopeptidase	A0A0M4RD70	Bacillus_phage	9.1e-06	29.8
WP_011101082.1\|576375_576738_-	helix-turn-helix domain-containing protein	A0A0U4KKM4	Exiguobacterium_phage	2.6e-09	32.0
WP_011101083.1\|576910_577141_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011101084.1\|577213_577528_-	hypothetical protein	NA	NA	NA	NA
WP_011101085.1\|577565_577802_-	helix-turn-helix transcriptional regulator	A0A0K2CNE2	Brevibacillus_phage	8.5e-09	30.7
WP_011101086.1\|577948_578149_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011101087.1\|578307_578490_+	hypothetical protein	NA	NA	NA	NA
WP_011101088.1\|578550_579105_+	hypothetical protein	O03909	Lactobacillus_phage	3.6e-98	100.0
WP_011101089.1\|579110_579395_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_061876076.1\|579715_580153_+	hypothetical protein	NA	NA	NA	NA
WP_061876077.1\|580149_581037_+	recombinase RecT	E9LUM3	Lactobacillus_phage	2.5e-61	47.0
WP_061876303.1\|581068_581821_+	PD-(D/E)XK nuclease-like domain-containing protein	A0A0P0IZH9	Lactobacillus_phage	6.3e-74	52.6
WP_061876078.1\|581902_582739_+	DUF4373 domain-containing protein	A0A1B1IM03	Lactococcus_phage	2.6e-07	33.3
WP_061876079.1\|582719_583562_+	ATP-binding protein	O03914	Lactobacillus_phage	5.0e-152	96.4
WP_061876080.1\|583718_584237_+	hypothetical protein	O03915	Lactobacillus_phage	1.2e-55	69.1
WP_061876081.1\|584233_584614_+	endodeoxyribonuclease	NA	NA	NA	NA
WP_022638754.1\|584606_584765_+	hypothetical protein	A0A2P0ZLB5	Lactobacillus_phage	3.9e-18	92.3
WP_162838579.1\|584939_585116_+	hypothetical protein	E9LUP2	Lactobacillus_phage	1.3e-25	98.3
WP_061876082.1\|585108_585495_+	hypothetical protein	A0A2P0ZKS9	Lactobacillus_phage	3.9e-11	35.2
WP_061876083.1\|585491_585959_+	DUF1642 domain-containing protein	A0A2P0ZLB8	Lactobacillus_phage	3.3e-36	51.6
WP_080453374.1\|585955_586123_+	hypothetical protein	E9LUP4	Lactobacillus_phage	3.1e-13	87.2
WP_003642805.1\|586250_586712_+	transcriptional regulator	D6PSV8	Lactobacillus_phage	1.1e-39	57.0
WP_033608060.1\|587121_588141_+	hypothetical protein	NA	NA	NA	NA
WP_061876084.1\|588158_588662_+	hypothetical protein	NA	NA	NA	NA
WP_187330873.1\|588740_588911_+	hypothetical protein	E9LUP6	Lactobacillus_phage	3.6e-17	87.2
WP_011101110.1\|589068_589665_+\|terminase	terminase small subunit	O03926	Lactobacillus_phage	5.8e-14	33.3
WP_061876085.1\|589648_590935_+\|terminase	PBSX family phage terminase large subunit	A0A2H4IYR5	uncultured_Caudovirales_phage	8.8e-116	50.6
WP_162786275.1\|590987_592583_+\|portal	phage portal protein	D2IZM0	Enterococcus_phage	1.0e-65	34.2
WP_011101113.1\|592582_593527_+\|capsid	minor capsid protein	NA	NA	NA	NA
WP_011101114.1\|593634_594282_+	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_041153519.1\|594295_595366_+\|capsid	phage capsid protein	A0A0S0N2Q7	Pseudomonas_phage	2.0e-33	30.6
WP_011101116.1\|595380_595746_+\|head,tail	phage head-tail connector protein	H9A0V3	Staphylococcus_phage	3.0e-05	38.2
WP_011101117.1\|595750_596074_+	hypothetical protein	NA	NA	NA	NA
WP_011101118.1\|596063_596618_+\|tail	tail protein	NA	NA	NA	NA
WP_011101119.1\|596618_597005_+	hypothetical protein	NA	NA	NA	NA
WP_011101120.1\|597016_597604_+\|tail	tail protein	NA	NA	NA	NA
WP_011101121.1\|597621_598134_+	hypothetical protein	NA	NA	NA	NA
WP_011101122.1\|598202_598439_+	hypothetical protein	NA	NA	NA	NA
WP_061876086.1\|598438_602443_+	tape measure protein	E9LUR1	Lactobacillus_phage	5.2e-82	44.3
WP_011101124.1\|602436_603174_+	hypothetical protein	A0A1S5SA63	Streptococcus_phage	4.1e-41	36.6
WP_041153515.1\|603173_605048_+\|tail	phage tail protein	A0A1X9IGI5	Lactococcus_phage	7.9e-49	33.2
604660:604675	attR	NA	NA	NA	NA
WP_011101126.1\|605052_606045_+	SGNH/GDSL hydrolase family protein	A0A1J0MFI8	Staphylococcus_phage	4.1e-36	41.0
WP_011101127.1\|606059_606674_+\|plate	phage baseplate upper protein	A0A1J0MFQ3	Staphylococcus_phage	7.3e-44	47.8
WP_011101128.1\|606679_607420_+	hypothetical protein	NA	NA	NA	NA
WP_011101129.1\|607420_607741_+	DUF2977 domain-containing protein	NA	NA	NA	NA
WP_071540930.1\|607740_607917_+	XkdX family protein	NA	NA	NA	NA
WP_011101132.1\|609043_609340_+	hypothetical protein	A0A1I9KK55	Lactobacillus_phage	4.4e-39	76.5
WP_011101134.1\|610210_610417_-	hypothetical protein	NA	NA	NA	NA
WP_071540960.1\|610582_610636_+	hypothetical protein	NA	NA	NA	NA
WP_060417521.1\|611001_611763_+	DUF3800 domain-containing protein	NA	NA	NA	NA
WP_027821466.1\|612427_613405_-	DNA/RNA non-specific endonuclease	NA	NA	NA	NA
WP_046947584.1\|613417_614086_-	hypothetical protein	NA	NA	NA	NA
WP_046947585.1\|614389_616993_+	bifunctional lysylphosphatidylglycerol flippase/synthetase MprF	NA	NA	NA	NA
WP_003643936.1\|617167_617743_-	TIGR00730 family Rossman fold protein	A0A1G5S9X4	Enterococcus_phage	4.9e-26	41.7
WP_003640950.1\|617824_618835_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	3.1e-108	60.5
WP_013355235.1\|618862_621028_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	2.2e-268	63.3
WP_003640952.1\|621166_621397_-	redoxin NrdH	X2KRY7	Enterococcus_phage	2.8e-09	40.0
WP_046947586.1\|621619_622228_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_072536060.1\|622230_622737_+	nucleoside deaminase	NA	NA	NA	NA
WP_003644909.1\|623263_624961_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0
WP_003640956.1\|624982_625291_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003637790.1\|625306_625906_+	recombination protein RecR	NA	NA	NA	NA
WP_003640957.1\|625920_626172_+	YaaL family protein	NA	NA	NA	NA
WP_011101140.1\|626569_627235_+	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
WP_003640965.1\|627231_627561_+	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_003640966.1\|627577_628597_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
WP_003640967.1\|628621_628969_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
WP_013355239.1\|629067_629964_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	4.4e-82	55.7
WP_003640969.1\|629967_630753_+	acyl-ACP thioesterase	NA	NA	NA	NA
WP_013355240.1\|630891_631887_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	2.0e-51	38.5
WP_003640973.1\|633964_634819_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_003640974.1\|634815_635619_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_061876087.1\|635608_636379_-	phosphonate ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.9e-13	31.8
WP_061876088.1\|636416_637469_-	phosphate/phosphite/phosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_061876089.1\|637748_638474_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_011101142.1\|638457_639036_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_003640979.1\|639028_639484_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_003640980.1\|639488_640535_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	3.5e-62	41.7
WP_061876090.1\|641421_643404_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	8.9e-51	28.9
WP_003640983.1\|643572_644250_+	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_003640984.1\|644414_645059_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_4

1249095 : 1319051

Lactobacillus_phage(88.89%)

tail,integrase,capsid,head,portal,protease,tRNA,terminase

attL 1254805:1254821|attR 1297448:1297464

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033608558.1\|1249095_1249782_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003643149.1\|1250453_1250930_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_003643148.1\|1251046_1251559_-	hypothetical protein	NA	NA	NA	NA
WP_003643147.1\|1251673_1251961_+	hypothetical protein	NA	NA	NA	NA
WP_003643146.1\|1252025_1254293_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	3.9e-119	31.6
1254805:1254821	attL	NA	NA	NA	NA
WP_061876132.1\|1254937_1256074_-\|integrase	site-specific integrase	E9LUS1	Lactobacillus_phage	2.2e-211	98.1
WP_061876133.1\|1256183_1256717_-	hypothetical protein	NA	NA	NA	NA
WP_071540938.1\|1256713_1257166_-	hypothetical protein	NA	NA	NA	NA
WP_061876134.1\|1257344_1257872_-	SHOCT domain-containing protein	O48432	Lactobacillus_phage	5.2e-22	38.5
WP_003641360.1\|1258236_1258626_-	ImmA/IrrE family metallo-endopeptidase	D6PSS8	Lactobacillus_phage	4.6e-36	54.3
WP_003641361.1\|1258656_1258983_-	helix-turn-helix transcriptional regulator	A0A1B0Y2R0	Lactobacillus_phage	6.9e-17	44.1
WP_003644552.1\|1259239_1259455_+	hypothetical protein	NA	NA	NA	NA
WP_061876135.1\|1259467_1260220_+	phage antirepressor KilAC domain-containing protein	E9LUT0	Lactobacillus_phage	2.2e-58	96.5
WP_003638300.1\|1260234_1260408_+	hypothetical protein	NA	NA	NA	NA
WP_021336779.1\|1260404_1260596_-	hypothetical protein	NA	NA	NA	NA
WP_061876136.1\|1260688_1261018_+	DUF771 domain-containing protein	E9LUT3	Lactobacillus_phage	6.8e-57	94.5
WP_003641368.1\|1261558_1261849_-	hypothetical protein	NA	NA	NA	NA
WP_003641369.1\|1262014_1262218_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003641370.1\|1262230_1262479_+	hypothetical protein	E9LUT6	Lactobacillus_phage	2.7e-29	76.1
WP_003641371.1\|1262481_1262682_+	hypothetical protein	E9LUT7	Lactobacillus_phage	1.0e-26	89.4
WP_165274443.1\|1262693_1262846_+	hypothetical protein	E9LUT8	Lactobacillus_phage	2.3e-07	63.3
WP_013355644.1\|1262967_1263138_+	hypothetical protein	NA	NA	NA	NA
WP_033098960.1\|1263137_1263395_+	hypothetical protein	NA	NA	NA	NA
WP_061876137.1\|1263470_1264028_+	HNH endonuclease	X2KXT0	Enterococcus_phage	1.1e-22	51.4
WP_047673024.1\|1264817_1265603_+	ATP-binding protein	E9LUN6	Lactobacillus_phage	5.9e-131	90.0
WP_061876138.1\|1265738_1266047_+	hypothetical protein	E9LUN7	Lactobacillus_phage	3.0e-46	92.2
WP_058906845.1\|1266131_1266623_+	methyltransferase domain-containing protein	O03918	Lactobacillus_phage	2.5e-87	93.1
WP_154698893.1\|1266690_1266864_+	hypothetical protein	NA	NA	NA	NA
WP_058906846.1\|1266866_1267085_+	hypothetical protein	A0A2P0ZLC3	Lactobacillus_phage	2.3e-13	87.8
WP_061876139.1\|1267077_1267503_+	hypothetical protein	K4I239	Lactobacillus_phage	1.0e-76	97.1
WP_058906848.1\|1267505_1267886_+	hypothetical protein	NA	NA	NA	NA
WP_058906849.1\|1267882_1268329_+	hypothetical protein	A0A2P0ZLB8	Lactobacillus_phage	9.7e-22	39.4
WP_080396932.1\|1268443_1268611_+	hypothetical protein	E9LUP4	Lactobacillus_phage	4.1e-10	76.6
WP_033608385.1\|1268792_1269218_+	transcriptional regulator	E9LUP5	Lactobacillus_phage	2.1e-66	86.5
WP_061876140.1\|1270067_1270898_+	abortive infection family protein	NA	NA	NA	NA
WP_061876141.1\|1271210_1271837_+	hypothetical protein	NA	NA	NA	NA
WP_080453381.1\|1272000_1272174_+	hypothetical protein	E9LUP6	Lactobacillus_phage	9.9e-07	51.9
WP_080453382.1\|1272148_1272334_+	hypothetical protein	NA	NA	NA	NA
WP_080453383.1\|1272344_1272815_+	HNH endonuclease	E9LUP7	Lactobacillus_phage	1.5e-84	96.2
WP_061876143.1\|1273033_1273489_+\|terminase	phage terminase small subunit P27 family	E9LUP8	Lactobacillus_phage	5.2e-79	96.7
WP_061876144.1\|1273498_1275397_+\|terminase	terminase large subunit	E9LUP9	Lactobacillus_phage	0.0e+00	92.1
WP_003644528.1\|1275386_1275581_+	DUF1056 family protein	E9LUQ0	Lactobacillus_phage	7.4e-27	98.4
WP_061876145.1\|1275583_1276777_+\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	4.5e-223	98.0
WP_061876146.1\|1276754_1277498_+\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	1.9e-123	93.9
WP_061876147.1\|1277512_1278745_+\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	5.7e-205	89.9
WP_061876148.1\|1278817_1279150_+\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	1.4e-44	83.6
WP_061876149.1\|1279139_1279487_+\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	4.5e-43	72.2
WP_061876150.1\|1279489_1279897_+	HK97 gp10 family phage protein	A0A2P0ZLE6	Lactobacillus_phage	2.6e-66	94.7
WP_061876151.1\|1279896_1280277_+	DUF806 family protein	A0A2P0ZLF4	Lactobacillus_phage	7.6e-60	90.5
WP_061876152.1\|1280293_1280953_+\|tail	phage tail protein	A0A2P0ZLH1	Lactobacillus_phage	2.6e-111	94.0
WP_061876153.1\|1281023_1281398_+\|tail	phage tail assembly chaperone	A0A2P0ZLH4	Lactobacillus_phage	6.0e-57	94.4
WP_003644519.1\|1281436_1281628_+	hypothetical protein	NA	NA	NA	NA
WP_061876154.1\|1281659_1286687_+	C40 family peptidase	A0A2P0ZLG0	Lactobacillus_phage	0.0e+00	54.1
WP_061876155.1\|1286763_1288536_+\|tail	phage tail family protein	A0A2P0ZLH2	Lactobacillus_phage	0.0e+00	93.6
WP_061876156.1\|1288600_1291012_+	hypothetical protein	A0A2P0ZLF8	Lactobacillus_phage	0.0e+00	94.0
WP_061876157.1\|1291028_1293575_+	hypothetical protein	A0A2K9VDD0	Lactobacillus_phage	3.0e-248	80.6
WP_013355621.1\|1293567_1293819_+	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	2.4e-30	98.6
WP_164997707.1\|1293822_1293984_+	hypothetical protein	A0A2P0ZLG1	Lactobacillus_phage	2.1e-19	98.1
WP_061876158.1\|1294751_1295924_+	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	1.1e-210	94.1
WP_003644510.1\|1295923_1296187_+	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	2.0e-38	100.0
WP_061876159.1\|1296198_1296729_+	hypothetical protein	E9LUS0	Lactobacillus_phage	1.5e-40	97.9
WP_003643145.1\|1297785_1298211_-	hypothetical protein	NA	NA	NA	NA
1297448:1297464	attR	NA	NA	NA	NA
WP_003643143.1\|1298375_1299389_-	hypothetical protein	NA	NA	NA	NA
WP_003643142.1\|1299494_1300016_+	GtrA family protein	NA	NA	NA	NA
WP_003645248.1\|1300115_1300475_-	YisL family protein	NA	NA	NA	NA
WP_003643140.1\|1300547_1302404_-	bifunctional homocysteine S-methyltransferase/methylenetetrahydrofolate reductase	NA	NA	NA	NA
WP_003643139.1\|1302417_1304724_-	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
WP_003643138.1\|1305612_1307250_+	sulfotransferase family protein	NA	NA	NA	NA
WP_003643137.1\|1307227_1308403_+	sulfate adenylyltransferase	A0A2P1ELS9	Moumouvirus	8.5e-49	32.7
WP_003643136.1\|1308405_1309029_+	adenylyl-sulfate kinase	A0A2K9L4R9	Tupanvirus	6.3e-27	40.6
WP_061876310.1\|1309018_1309975_+	bifunctional oligoribonuclease/PAP phosphatase NrnA	NA	NA	NA	NA
WP_003643134.1\|1310196_1311936_+	aryl-sulfate sulfotransferase	NA	NA	NA	NA
WP_003644260.1\|1312441_1314217_+	SLC13 family permease	NA	NA	NA	NA
WP_003643131.1\|1314492_1315884_+	MATE family efflux transporter	NA	NA	NA	NA
WP_003643130.1\|1316010_1316256_+	hypothetical protein	NA	NA	NA	NA
WP_011101382.1\|1316644_1317091_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_024003017.1\|1317362_1319051_+\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	1.5e-75	32.9

DBSCAN-SWA_5

1345158 : 1354995

Lactobacillus_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061876165.1\|1345158_1346388_+	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	4.6e-215	97.4
WP_033608586.1\|1346478_1347450_-	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	5.9e-181	98.5
WP_027822909.1\|1347635_1348583_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	1.0e-177	99.7
WP_003643097.1\|1348925_1349540_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_061876166.1\|1349542_1351981_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.6
WP_003643095.1\|1352068_1352629_+	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	2.7e-101	100.0
WP_011101401.1\|1352699_1353140_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	3.0e-76	98.6
WP_015380221.1\|1353235_1353373_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_003645220.1\|1353999_1354995_+	glycosyltransferase family 2 protein	S5FKN0	Shigella_phage	3.1e-52	38.8

DBSCAN-SWA_6

2192665 : 2201501

Lactobacillus_phage(33.33%)

tail,head,portal,terminase,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061876213.1\|2192665_2192935_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_061876214.1\|2193344_2194925_-\|capsid	phage major capsid protein	B8R651	Lactobacillus_phage	4.8e-39	26.1
WP_061876215.1\|2194914_2196021_-\|portal	phage portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	4.7e-49	33.3
WP_061876216.1\|2196175_2197879_-\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	2.4e-121	40.3
WP_061876217.1\|2197875_2198349_-\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_061876218.1\|2198910_2199321_-	HNH endonuclease	A0A1Q1PW15	Staphylococcus_phage	2.9e-20	47.1
WP_061876219.1\|2199313_2199652_-\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	1.6e-08	33.7
WP_061876220.1\|2199661_2199844_-	sporulation protein Cse60	NA	NA	NA	NA
WP_061876221.1\|2200106_2201501_-	virulence protein	A0A1W6JQD6	Staphylococcus_phage	3.3e-68	41.6

DBSCAN-SWA_7

2396889 : 2405400

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642593.1\|2396889_2397468_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.9e-22	35.0
WP_003642592.1\|2397460_2398486_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	8.4e-61	41.7
WP_003642591.1\|2398482_2399937_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.5e-50	34.0
WP_003642590.1\|2399921_2402141_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	7.7e-144	39.3
WP_003644726.1\|2402133_2402814_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_061876238.1\|2402813_2403068_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_003642587.1\|2403069_2403801_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
WP_003644727.1\|2403803_2404934_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003645861.1\|2404917_2405400_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP014780

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection