CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP014861	Erysipelothrix rhusiopathiae strain GXBY-1 chromosome, complete genome	1 crisprs	DEDDh,csa3,WYL,cas3	0	0	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP014861_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP014861_1

1357813-1357889

Orphan

Consensus_repeat	Method
GGTTTCACTTCTGGTTTTTCTTCCGGTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP014861_1

>merge|NZ_CP014861|1|1357813-1357889|CRISPRCasFinder
GGATTTGTTTCAGGTTTCACTTCTGGTTTTTCTTCCGGTTTCACTTCTGGTTTTTCTTCCGGTTTCACTTCCGGTTT

>NZ_CP014861|1|1|1357813-1357889|CRISPRCasFinder
GGATTTGTTTCAGGTTTCACTTCTGGTTT	TTCTTCCGGTTTCACTTCT
GGTTTTTCTTCCGGTTTCACTTCCGGTTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP014861.1\|WP_013852752.1\|1356401_1356926_+\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|377744
NZ_CP014861.1\|WP_013852751.1\|1356879_1357395_-\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|239217
NZ_CP014861.1\|WP_003773207.1\|1364758_1366084_-\|UDP-N-acetylmuramate--L-alanine-ligase	unknown	unknown	gnl\|CDD\|234757
NZ_CP014861.1\|WP_013852746.1\|1368481_1369114_-\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	unknown	unknown	gnl\|CDD\|234649
NZ_CP014861.1\|WP_013852757.1\|1351139_1351685_-\|16S-rRNA-(guanine(966)-N(2))-methyltransferase-RsmD	unknown	unknown	gnl\|CDD\|223813
NZ_CP014861.1\|WP_013852760.1\|1347633_1349436_-\|molecular-chaperone-DnaK	unknown	unknown	gnl\|CDD\|234715
NZ_CP014861.1\|WP_013852745.1\|1369212_1370280_+\|nucleotidyltransferase-family-protein	unknown	unknown	gnl\|CDD\|377535
NZ_CP014861.1\|WP_013852748.1\|1363422_1364304_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014861.1\|WP_013852755.1\|1353116_1353689_+\|peptide-deformylase	unknown	unknown	gnl\|CDD\|234668
NZ_CP014861.1\|WP_013852749.1\|1362430_1363426_-\|substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|130546
NZ_CP014861.1\|WP_013852758.1\|1350005_1351037_-\|heat-inducible-transcription-repressor-HrcA	unknown	unknown	gnl\|CDD\|234621
NZ_CP014861.1\|WP_003773205.1\|1366726_1367431_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014861.1\|WP_003773206.1\|1366067_1366703_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014861.1\|WP_013852744.1\|1370269_1371364_-\|methionine-adenosyltransferase	unknown	unknown	gnl\|CDD\|350837
NZ_CP014861.1\|WP_013852754.1\|1353697_1355566_+\|ribonuclease-J	unknown	unknown	gnl\|CDD\|223668
NZ_CP014861.1\|WP_013852753.1\|1355562_1356381_+\|metallophosphoesterase	unknown	unknown	gnl\|CDD\|277331
NZ_CP014861.1\|WP_043892556.1\|1349449_1350025_-\|nucleotide-exchange-factor-GrpE	unknown	unknown	gnl\|CDD\|271355
NZ_CP014861.1\|WP_013852747.1\|1367417_1368482_-\|M42-family-metallopeptidase	unknown	unknown	gnl\|CDD\|349906
NZ_CP014861.1\|WP_003773209.1\|1364296_1364713_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014861.1\|WP_013852756.1\|1351684_1352941_-\|FtsW/RodA/SpoVE-family-cell-cycle-protein	unknown	unknown	gnl\|CDD\|223843

Protein	Function_ID	Function_description	E-value
NZ_CP014861.1\|WP_013852752.1\|1356401_1356926_+\|methyltransferase-domain-containing-protein	gnl\|CDD\|377744	pfam06962, rRNA_methylase, Putative rRNA methylase. This family contains a number of putative rRNA methylases. Note that many family members are hypothetical proteins.	1.38762e-29
NZ_CP014861.1\|WP_013852751.1\|1356879_1357395_-\|NUDIX-hydrolase	gnl\|CDD\|239217	cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+ for their activity. Members of this family are recognized by a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which forms a structural motif that functions as a metal binding and catalytic site. Substrates of nudix hydrolase include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance and "house-cleaning" enzymes. Substrate specificity is used to define child families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required. This superfamily consists of at least nine families: IPP (isopentenyl diphosphate) isomerase, ADP ribose pyrophosphatase, mutT pyrophosphohydrolase, coenzyme-A pyrophosphatase, MTH1-7,8-dihydro-8-oxoguanine-triphosphatase, diadenosine tetraphosphate hydrolase, NADH pyrophosphatase, GDP-mannose hydrolase and the c-terminal portion of the mutY adenine glycosylase.	5.32923e-14
NZ_CP014861.1\|WP_003773207.1\|1364758_1366084_-\|UDP-N-acetylmuramate--L-alanine-ligase	gnl\|CDD\|234757	PRK00421, murC, UDP-N-acetylmuramate--L-alanine ligase; Provisional.	4.29176e-154
NZ_CP014861.1\|WP_013852746.1\|1368481_1369114_-\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	gnl\|CDD\|234649	PRK00121, trmB, tRNA (guanine-N(7)-)-methyltransferase; Reviewed.	9.08137e-54
NZ_CP014861.1\|WP_013852757.1\|1351139_1351685_-\|16S-rRNA-(guanine(966)-N(2))-methyltransferase-RsmD	gnl\|CDD\|223813	COG0742, COG0742, N6-adenine-specific methylase [DNA replication, recombination, and repair].	1.0814e-58
NZ_CP014861.1\|WP_013852760.1\|1347633_1349436_-\|molecular-chaperone-DnaK	gnl\|CDD\|234715	PRK00290, dnaK, molecular chaperone DnaK; Provisional.	0
NZ_CP014861.1\|WP_013852745.1\|1369212_1370280_+\|nucleotidyltransferase-family-protein	gnl\|CDD\|377535	pfam05636, HIGH_NTase1, HIGH Nucleotidyl Transferase. This family consists of HIGH Nucleotidyl Transferases.	7.9094e-121
NZ_CP014861.1\|WP_013852755.1\|1353116_1353689_+\|peptide-deformylase	gnl\|CDD\|234668	PRK00150, def, peptide deformylase; Reviewed.	1.50332e-56
NZ_CP014861.1\|WP_013852749.1\|1362430_1363426_-\|substrate-binding-domain-containing-protein	gnl\|CDD\|130546	TIGR01481, catabolite_control_protein_A, catabolite control protein A. Catabolite control protein A is a LacI family global transcriptional regulator found in Gram-positive bacteria. CcpA is involved in repressing carbohydrate utilization genes [ex: alpha-amylase (amyE), acetyl-coenzyme A synthase (acsA)] and in activating genes involved in transporting excess carbon from the cell [ex: acetate kinase (ackA), alpha-acetolactate synthase (alsS)]. Additionally, disruption of CcpA in Bacillus megaterium, Staphylococcus xylosus, Lactobacillus casei and Lactocacillus pentosus also decreases growth rate, which suggests CcpA is involved in the regulation of other metabolic pathways. [Regulatory functions, DNA interactions].	8.73722e-71
NZ_CP014861.1\|WP_013852758.1\|1350005_1351037_-\|heat-inducible-transcription-repressor-HrcA	gnl\|CDD\|234621	PRK00082, hrcA, heat-inducible transcription repressor; Provisional.	6.15183e-113
NZ_CP014861.1\|WP_013852744.1\|1370269_1371364_-\|methionine-adenosyltransferase	gnl\|CDD\|350837	cd18079, S-AdoMet_synt, S-adenosylmethionine synthetase. S-adenosylmethionine synthetase (EC 2.5.1.6), also known as methionine adenosyltransferase, catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP in two steps, the formation of AdoMet and hydrolysis of the tripolyphosphate, which occurs prior to release of the product from the enzyme, which consists of three structural domains that have a similar alpha+beta fold.	0
NZ_CP014861.1\|WP_013852754.1\|1353697_1355566_+\|ribonuclease-J	gnl\|CDD\|223668	COG0595, COG0595, mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair].	0
NZ_CP014861.1\|WP_013852753.1\|1355562_1356381_+\|metallophosphoesterase	gnl\|CDD\|277331	cd07385, MPP_YkuE_C, Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain. YkuE is an uncharacterized Bacillus subtilis protein with a C-terminal metallophosphatase domain and an N-terminal twin-arginine (RR) motif. An RR-signal peptide derived from the Bacillus subtilis YkuE protein can direct Tat-dependent secretion of agarase in Streptomyces lividans. This is an indication that YkuE is transported by the Bacillus subtilis Tat (Twin-arginine translocation) pathway machinery. YkuE belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	9.91269e-33
NZ_CP014861.1\|WP_043892556.1\|1349449_1350025_-\|nucleotide-exchange-factor-GrpE	gnl\|CDD\|271355	cd00446, GrpE, nucleotide exchange factor GrpE. GrpE is the adenine nucleotide exchange factor of DnaK (Hsp70)-type ATPases. In bacteria, the DnaK-DnaJ-GrpE (KJE) chaperone system functions at the fulcrum of protein homeostasis. GrpE participates actively in response to heat shock by preventing aggregation of stress-denatured proteins; unfolded proteins initially bind to DnaJ, the J-domain ATPase-activating protein (Hsp40 family), whereupon DnaK hydrolyzes its bound ATP, resulting in a stable complex. The GrpE dimer binds to the ATPase domain of Hsp70 catalyzing the dissociation of ADP, which enables rebinding of ATP, one step in the Hsp70 reaction cycle in protein folding. In eukaryotes, only the mitochondrial Hsp70, not the cytosolic form, is GrpE dependent. Over-expression of Hsp70 molecular chaperones is important in suppressing toxicity of aberrantly folded proteins that occur in Alzheimer's disease (AD), Parkinson's disease (PD), amyotrophic lateral sclerosis, as well as several polyQ-diseases such as Huntington's disease and ataxias.	6.78041e-53
NZ_CP014861.1\|WP_013852747.1\|1367417_1368482_-\|M42-family-metallopeptidase	gnl\|CDD\|349906	cd05656, M42_Frv, M42 Peptidase, endoglucanases. Peptidase M42 family, Frv (Frv Operon Protein; Endo-1 4-Beta-Glucanase; Cellulase Protein; Endoglucanase; Endo-1 4-Beta-Glucanase Homolog; Glucanase; EC. 3.2.1.4) subfamily. Frv is a co-catalytic metallopeptidase, found in archaea and bacteria, including Pyrococcus horikoshii tetrahedral shaped phTET1 (DAPPh1; FrvX; PhDAP aminopeptidase; PhTET aminopeptidase; deblocking aminopeptidase), phTET2 (DAPPh2) and phTET3 (DAPPh3), Haloarcula marismortui TET (HmTET) as well as Bacillus subtilis YsdC. All of these exhibit aminopeptidase and deblocking activities. The HmTET is a broad substrate aminopeptidase capable of degrading large peptides. PhTET2, which shares 24% identity with HmTET, is a cobalt-activated peptidase and possibly a deblocking aminopeptidase, assembled as a 12-subunit tetrahedral dodecamer, while PhTET1 can be alternatively assembled as a tetrahedral dodecamer or as an octahedral tetracosameric structure. The active site in such a self-compartmentalized complex is located on the inside such that substrate sizes are limited, indicating function as possible peptide scavengers. PhTET2 cleaves polypeptides by a nonprocessive mechanism, preferring N-terminal hydrophobic or uncharged polar amino acids. Streptococcus pneumoniae PepA (SpPepA) also forms dodecamer with tetrahedral architecture, and exhibits selective substrate specificity to acidic amino acids with the preference to glutamic acid, with the substrate binding S1 pocket containing an Arg allows electrostatic interactions with the N-terminal acidic residue in the substrate. The YsdC gene is conserved in a number of thermophiles, archaea and pathogenic bacterial species; the closest structural homolog is Thermotoga maritima FrwX (34% identity), which is annotated as either a cellulase or an endoglucanase, and is possibly involved in polysaccharide biosynthesis or degradation.	1.4174e-140
NZ_CP014861.1\|WP_013852756.1\|1351684_1352941_-\|FtsW/RodA/SpoVE-family-cell-cycle-protein	gnl\|CDD\|223843	COG0772, FtsW, Bacterial cell division membrane protein [Cell division and chromosome partitioning].	7.0818e-70

>NZ_CP014861.1|WP_013852751.1|1356879_1357395_-|NUDIX-hydrolase
MIIKYFDDDQFKAANICNVRNTVRCFVLNEFGQCAMILIKGQDLFGKRNHYESPGGGIEVGESMIQAVHREIQEELGYEVDSISYLASVVDAYHRLELTTVHNYFVCKLAKKTCYARTCLELQLFDSIEWKLPNVWLDILDKPQDGVNELVHARERFMMRYFVDKQETLRD
>NZ_CP014861.1|WP_013852752.1|1356401_1356926_+|methyltransferase-domain-containing-protein
MNHKERSHKWMKQFLNKDSIVVDMTCGNGYDTHFLANHAGHVYAIDIQEEAILSSKQLNQNFSNITYIHSDHSRVNFEEKAPFTGAIYNLGYLPRSDKSIITTSHTTVSSLKNIFPLLTDFLVIACYLKHEGGYEEYEAVRDYIISTNMPYETLEYETPLSPVTFLVYLRNNAS
>NZ_CP014861.1|WP_013852753.1|1355562_1356381_+|metallophosphoesterase
MSKKKLAVLLGLIAIVSSLIYFEMTHFAPQRVKLRIETVESTRIPASFNNLSIGFLSDVYSHEENLDKALIELDSFKPDMIIFGGNLFKAAPSEKEQAAMIEKLSKVNAKLGKYAVLGENDIRKANEVTQEVLTQSGFKLISNTKIDVHNFTTESIQLVGIDANNDINKETEFPYPTTSEDLFNITIANNPDNVKEFDDTEVDLMLSGKTMGGYIRLPLIGSITESSDYINKRQTVDETTLIISSGIGLKEPEMRLLSNPDVMIVILKSPEA
>NZ_CP014861.1|WP_013852754.1|1353697_1355566_+|ribonuclease-J
MDEKNMKLRKTDTLVYALGGLGEVGKNMYCIEHDDEIIIIDCGVMFPEENLLGVDYVIQDYAHLIRNQKKVKALVITHGHEDHIGGIPFLLQKVNVPQIYAPQFAKAQIERKLEERKIRTKHKIQEIDSKSTIKTKHFVIGFFNVVHSIPDALGVLVNTPNGRIVSTGDFKFDLTPVGNNPDYQIMSYMGEIGVTLLMSDSTNAEVSGFSISEKEVGREIKRIFNKTEGRIIIATFASNVYRVQQIIEAAIADGRKIAIFGRSMDNVVNIARKLGHIDAADKHFVNAHQLNKLPADQSCIICTGSQGEPLAALSRIANGTHRQISIMPGDTVVFSSSPIPGNATSVSHVVNQLTRAGANVLTNSPLNSIHTTGHASKEEQTLMLQLIKPKFFMPMHGEYKMLKAHRQTAIETGVDPDNIFICSNGDVVALRDGVAFMSDTRIQADDIYVDGNDSSGLSTAVLKDRKILSDSGLVSVVVTIDSRQNKILCKPTIVTRGFVFIKENQTLLKEAELVVYEALKKRMTKKVTFGEIKNTIRGSLEPFLYKHTQRNPLVIPVILNQKTAMTPVKVENKKENSGQETKPVKKQKKNNNKQNNEPKQQQKDAKKPKTPKATKPQQAREA
>NZ_CP014861.1|WP_013852755.1|1353116_1353689_+|peptide-deformylase
MHDINMDTIVLDPNPVLREKCEPVSFPLSEEDRNTLENMLQYVRDSRDPELAEKYNLQPANGIAAPQIGVAKQMTALVVDLEDKHGNIKTVEYALVNPKIVSNSVKQCALSYGEGCLSIRKDYPGLVRRSQRIKVLAYDMITDQRIEIVAKDILAIVLQHEIDHLNGVLFYDHIDSKDPWMAEKGLKIIE
>NZ_CP014861.1|WP_013852756.1|1351684_1352941_-|FtsW/RodA/SpoVE-family-cell-cycle-protein
MKKRKISLKMPMGYNRPIHAAALILNIFGVLMVISGSMTSGSTPKSLVLVGVKELVFVIVSYIMMVMVARRFSLNYFRKNYAKILLLMVGMLGITLVFPAVNGAKAWINLKVMTIQPSEFAKIFGILTIATFLADRNKRTSASTFDMVKKPFFIILAIFVFVVKAQHDLGSAVVIIGVAYICVLIPSHDKLTRLQKVMFILAGVGIIGLIFLDSSFGISLIEKLNIPPYMIGRFKTSSNPFLDRYGSGYQIFNGMVAMFKGGLFGMGYGNSLIKYGYLPEAHTDFILAVTIEELGMIGFSVILIGYGTMLFQLVKYSFKVKKESDKVILMGTVAYIMIHFIFNIGGITALIPLTGVPLLFISKGGSSRMAIMIAIGLTQNVISRYEMGIINVKRKDQLRIKQEETKRKENLKRLTEVV
>NZ_CP014861.1|WP_013852757.1|1351139_1351685_-|16S-rRNA-(guanine(966)-N(2))-methyltransferase-RsmD
MRVVAGRFGSRPIKTLKGDTTRPTTDKVRAAIFNRIGPFFNEGAMLDVFGGSGAMAIESISRGIERAVVFEKDVRAFSVIQDNIKTFGLESRIQLKKGDSMKLLETVSGSFEFVFLDPPYRYAQTLKIIKLIIKRDLVVDGGLIICETDKNYDLPDEIDGYSLDCVKDYGISKVRYYKKDK
>NZ_CP014861.1|WP_013852758.1|1350005_1351037_-|heat-inducible-transcription-repressor-HrcA
MLTPRKIEIFKAIVKEFINTAEPVGSKTLIDKYNLSYSSATIRNEMSDLEKIGLLEKTHTSSGRIPSTKGYRFYVEHLMDEEENYGIETAIAQIFSDRRLGIDEAIRQSCDILSQMTNLTTVVLGPSAMNETLKSVQLIPLSEFNAMAVFVTESGHAEHRIFNFDSKVDVNDLEACTSILNERLKGTELSEVVDKMESLRPILSKRIEKYEVLFEAFVGAFVKFAQDEVYLSGERNMLYQPEFSNIEKLREMMDMLENSEMWRNLSTGQNHLSLKKGDQSEIVWVDDMAVVSSSFNLLDNHEHKLMIVGPSRMEYSRVVSLMDYVSEMIETVYGKGGNDEQDE
>NZ_CP014861.1|WP_043892556.1|1349449_1350025_-|nucleotide-exchange-factor-GrpE
MMSKTNKTAEEFNEEVQLEQEVEATDSEELETSNSENEASETDEAIDENEALRKEIETLKNDYFKMLADTENLKKRLQREHDQLRKYRIQGFAADVLPVLDNLERALKQETTDEALREGVQMIYDQLMASLKAEGVEPINALNQPFDPNIHQAMMTEEKEGVESNIVIEEFQKGYMLKDRILRASLVKVSQ
>NZ_CP014861.1|WP_013852760.1|1347633_1349436_-|molecular-chaperone-DnaK
MSKVIGIDLGTTNSAVSVMDGGEAKVITNPEGNRTTPSVVSFKNGERIVGDAAKRQVVTNPNSAVSVKRLIGTGEKVTLEGKDYTPEEISAMILGYMKSYAEDYLGEKVTKAVITVPAYFNDAQRQATKDAGKIAGLEVERIINEPTAAALAFGIDKTDKEEKVLVFDLGGGTFDVSILELADGTFEVLSTAGDNKLGGDDFDNIVVDYLVDIFKKENGIDLSSDKMAMQRLKEAAEKAKKDLSSTVNASISLPFISAGENGPLHLETTLSRAKFEEMTKSLVERTMVPVRQALKDAGLTKNDIHQVLLVGGSTRIPAVVEAVKNELGKEPNKSVNPDEVVAMGAAIQGGVISGDVKDVLLLDVTPLSLGIETMGGVMTVLIERNTTIPTSKSQVFSTAADNQPAVDINVLQGERPMAKDNKSLGLFKLDGIAPAKRGIPQIEVTFDIDVNGIVNVSAMDKGTNKKQSITISNSSGLSDEEIERMVREAEENASEDLRLKEEAELKNRAEQFIHQIDESLASEDSPVDDAQKEEVTKLRDELQAAMDNNDFETLKEKLDQLEQAAQAMSQAMYEQQAGQAEVDASSSDETVVDAEFEEKN
>NZ_CP014861.1|WP_013852749.1|1362430_1363426_-|substrate-binding-domain-containing-protein
MKRVTIYDVAKEAGVSLATVSRVINGLEIVREETRVKVETAIDKLGYKPNAIAQGLALQKTTTIALLVPEASFGYTGQIINGLIDVAKIYKYNIMLHTMTEGIVDIKDVIDDIIKSRVDGVIIYNDKLMENELAELNKYQFPIVIIGNKMSDKQISSVYVDIEKAVYELTMQKIQMDPKNRVAVIQDRKNDFTTNQMVSGVQRAYQELGIDDEGYIEIPVDYRRSYDYFLDHIESMNYNFLIANRDSQAISAMNAAHECNMNIPEDLEIVCLIDTKYNSMVRPRLSSFAIPSYDLGAVAMRVLTKMLNEDEVEDKEIELSYLYTPRQSTKN
>NZ_CP014861.1|WP_013852748.1|1363422_1364304_-|hypothetical-protein
MSKYDEILNELVYQIDDVVYNFYSESNEIIAAKNGQERLLTFRDKTLNTINDMNVRSLEIISGFKDSDLIQERAEHLLEKNKDIVNSALEVLRAAPERNEFFDDLGNLATGIFESAKTTFQKVEESETFDRFKEGALLGLKKMQKGLDDLAKHPGVVKSTEIVKEKTKEAVDAGTQIVKDTSKNVADWVSEQELRAKAEKVSKEVHAGAETVKVKVHDGAEKVSEFVEDTVETKAHEFEEDAFSFLDTLEEELDQVSRDAESNLEPSNIVEAAEKQVRELDKKLDEVKEDEEV
>NZ_CP014861.1|WP_003773209.1|1364296_1364713_-|hypothetical-protein
MDALIQNLREVSILIAPIVGVVCLIILAMILYRIYVVVRDLPKTIDRVNGVIDSTQSSVDQLQAPLNTLNNVTNTVDLVNQSAVSAVSSVASYGAKHSDAIVNWTKDLLDKRRNGRNPESSDVQETGDEKEEDFGIYE
>NZ_CP014861.1|WP_003773207.1|1364758_1366084_-|UDP-N-acetylmuramate--L-alanine-ligase
MSMKNKPIYFIGIKGTGMAALARICYKMGYEVMGSDIDRHFFTEDALRALNIPIVPFNKNNIKDNTVVIIGNAFLDDHEEVQAAKANPTVETYRYHEYLGKMMDSYRTIAVSGSHGKTTTTTLLRDMLSYSKETGYLIGDGRGDLQRDDEYFAVEACEFRRHFLAYKPKIAIMTNFEIDHVDYFKSVEDYLSAFKEFAKNVESLIVVWGDDPHYQDLSFDVETWSYGFGEGNKIRATELEKTTTHSIFDVEVDGKRIHRFNLPIVGDHMILDALAVIAVGLYEGIEPNDIEAGLQTFTGAKRRFVIETGKDNVYIDDYAHHPTEVRVTLEAARTRYPDRKIVGIFKPHRVGRVYYFADEFADALSLADEVCLCPFTSIDDAEEGIDIDITYLQDRIEDSHVVDLNDHDLDLLESFGPAVYVFMSSKDIYDLKDALKIRFND
>NZ_CP014861.1|WP_003773206.1|1366067_1366703_-|hypothetical-protein
MFRRLASVLFKEEEIVIEEEISDHVGEVEIPELKPILPKEKKIVEKPKTVTEHVDITEPVISEKPITDMTPDEAVKAASELNRKSRMITADDDLAKRKMERAKAARTSELEVKKFEYQRKDIISPMYGGPSQPSEPLDIPKKNKASKHVPVAEVISPMYGKVQEESKAEARKIDESLMDLRVDDIISNEGKGETVQVSLYDYLEGIDEHEE
>NZ_CP014861.1|WP_003773205.1|1366726_1367431_-|hypothetical-protein
MSLRKLMTALLLLLLVSGCTPAAINYDDLVKSALSRPMPEATNHNKKYYRYYLLPDVGIKQSTQISTLYEIDRKPIMLDLDVANIVAKRYTEITENNEGKEKGDQKEDSKIQFSSLIKEEAVSYRTTGTYVDGSDKEQHFIFSIVDLEKHKAVVLENGQVDMMAIVNDANMDMIVQSMFTTMRSITVNEDLVVQDFSKKDIITYHERYEEFFEHAIPESGAISDIIDKTAPKTE
>NZ_CP014861.1|WP_013852747.1|1367417_1368482_-|M42-family-metallopeptidase
MLNEKQLNWFETLTQLDGVSGHEHQVAQYLFNEYSNYTDEILRDNLGSILAVRRSNKKNAPKVLVLGHMDEVGFLVREVTETGVLKIHPVGGWFSQVLLGHRVRVTTRHGEVYDGAIGATPPHMLSAEERLKPIQIPQMTVDVGATTPEEVHAMGIQIGDMVVVDGEFNVLNKGKRLLAKAFDNRYGCVMGLDLLEALKDQELDYDLYVGCSVQEEVGLRGAQTVANLVKPDLAIILDCSPANDALDSKAIGKLGGGVLVRVMDGNMIATKDLIYKFVDICNEHDIKHQYYFSPGGTDAGAVHKSNSGVKTLTCCLCARNIHTSSSILDTDDYLAAREALLHFIDKKTWGDVIA
>NZ_CP014861.1|WP_013852746.1|1368481_1369114_-|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB
MRLRKKEWSSEVFETFADYTVTEFETIKGNWKEALGSELLHLEIGSGKGDYWHQLSALYPDRGIVAMERDFTASSIALKKLEKNPGDHKRFIYGDAENLNDMFAPGEVDVVHLNFSDPWPKKRHTKRRLTYKDKLDEYYSVLSDKGEIWMKTDNVGLFNYSLVSVGQHKFELVEVDVDFRSHEHEDPFTEYERKFHEMGQPIFRAIWRKK
>NZ_CP014861.1|WP_013852745.1|1369212_1370280_+|nucleotidyltransferase-family-protein
MKNKLTATGIIVEYNPLHNGHCYHIKKTREITRCDVLIAVMSPNFVQRGEPAYLDKWVRTEAALESGVDLVLELPTIYTLQSADVFAFKAVEILNHVGIQSLVFGSESNVLPVKPQFDKGLLKQGHSFAHASNTSNHQSNDILGVYYVQACQTYGITPLTILRTNNYHDQSISTSIASASAIRKAHQEGISVSHTTPLNLNTLTSYQLKEYEPFIHYLLSVHPSKTLSQNSLVSEGIQNLFIKHRHLPLDVLIETCTSKRYTRSRVQRTLMNLLLNFTKDLEQPLEHVRVLGMNTKGKAYLRQLSDDEIPYTTQFKHYQFKELELRATEVYTLPKDETIKKRLLKQEVSELIIKT
>NZ_CP014861.1|WP_013852744.1|1370269_1371364_-|methionine-adenosyltransferase
MNLVFFTSESVTDGHPDKMCDQIADAILDQALKQDPNSKMAVEATIKDNFVLIYGEANTKAVIDYTQVAKDVIADIGYPEDYEVMVKVNKQSSQINNAVISQENVGAGDQGIMFGFACNETENYMPLPIHLAHALSKRLSDAKSEIDWLYPDGKTQVTVAYEGNEPKFVHTVLVSASHKAGIDHATIEKTVMESIIKPVIDSKWITEETRFIVNPSGEFSIAGPFSDSGTTGRKIVVDSYGGFGRIGGGCFSSKDPSKVDRSAAYFSRYVAKSVVAAGLCDKIELQLSYAIGLSDPLSIHIDTFGTHKRPESEILDIIKANFDFKVGNIISELDLLRPIYRDTANFGHFGRDGFPWEVIKPLKF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

193532 : 202380

Streptococcus_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003774361.1\|193532_194903_+	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	9.1e-79	39.0
WP_003774363.1\|194904_196413_+	peptidoglycan DD-metalloendopeptidase family protein	A0A2D0ZM66	Rhodococcus_phage	1.2e-15	39.0
WP_003774364.1\|196480_198016_+	peptidoglycan DD-metalloendopeptidase family protein	A0A292GJG6	Xanthomonas_phage	8.0e-07	44.3
WP_013853428.1\|198032_198761_+	MBL fold metallo-hydrolase	A0A2H4J3R0	uncultured_Caudovirales_phage	3.4e-24	30.8
WP_016357484.1\|198757_199861_+	trypsin-like peptidase domain-containing protein	A0A1B1IRH0	uncultured_Mediterranean_phage	2.9e-11	29.2
WP_003774367.1\|199857_200313_+	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_003774368.1\|200383_200650_+	phosphocarrier protein HPr	NA	NA	NA	NA
WP_013853426.1\|200712_202380_+	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	3.5e-125	43.1

DBSCAN-SWA_2

528331 : 541706

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_062810421.1\|528331_530053_+	DNA topoisomerase 3	A0A2H4UU47	Bodo_saltans_virus	3.1e-07	20.8
WP_062810422.1\|530045_531011_+	DNA (cytosine-5-)-methyltransferase	D2IZY5	Enterococcus_phage	1.1e-75	49.0
WP_062810423.1\|530997_538641_+	DEAD/DEAH box helicase family protein	I3PUW5	Vibrio_phage	4.5e-276	37.7
WP_062810424.1\|538684_539341_+	hypothetical protein	NA	NA	NA	NA
WP_062810425.1\|539486_539696_+	helix-turn-helix domain-containing protein	S5MNP8	Brevibacillus_phage	1.9e-12	53.1
WP_178085409.1\|539688_540810_+	methyltransferase domain-containing protein	A0A1X9I6N4	Streptococcus_phage	1.3e-136	100.0
WP_002294505.1\|540842_541706_+	aminoglycoside nucleotidyltransferase ANT(6)-Ia	A0A1X9I6F2	Streptococcus_phage	8.7e-168	100.0

DBSCAN-SWA_3

545284 : 574464

Streptococcus_phage(96.3%)

integrase

attL 534643:534658|attR 573121:573136

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
534643:534658	attL	NA	NA	NA	NA
WP_002294513.1\|545284_546769_+	ABC-F type ribosomal protection protein Lsa(E)	A0A2H4UUX5	Bodo_saltans_virus	2.6e-26	26.0
WP_002294514.1\|546822_547626_+	lincosamide nucleotidyltransferase Lnu(B)	NA	NA	NA	NA
WP_002303393.1\|549277_549502_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_062810426.1\|549516_550386_+	nucleotidyltransferase domain-containing protein	A0A1X9I6C9	Streptococcus_phage	1.5e-151	90.7
WP_000662263.1\|550366_551101_+	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.5e-141	100.0
WP_001255864.1\|551133_552042_+	aminoglycoside nucleotidyltransferase ANT(6)-Ia	E4ZFP8	Streptococcus_phage	2.0e-167	93.4
WP_000627290.1\|552038_552581_+	streptothricin N-acetyltransferase Sat4	A0A1B0RXL7	Streptococcus_phage	8.9e-94	100.0
WP_001096887.1\|552673_553468_+	aminoglycoside O-phosphotransferase APH(3')-IIIa	E4ZFP6	Streptococcus_phage	2.3e-154	100.0
WP_001079938.1\|553743_554316_+	HTH domain-containing protein	A0A1B0RXM1	Streptococcus_phage	5.5e-102	99.5
WP_072387101.1\|554288_554696_+	WYL domain-containing protein	A0A1B0RXM3	Streptococcus_phage	1.1e-59	98.3
WP_000802831.1\|554806_555466_+	RibD family protein	A0A1B0RXM8	Streptococcus_phage	3.1e-125	100.0
WP_000582200.1\|556127_556379_+	hypothetical protein	NA	NA	NA	NA
WP_001291561.1\|556941_558159_-\|integrase	tyrosine-type recombinase/integrase	A0A1S5SEW7	Streptococcus_phage	3.7e-233	100.0
WP_000814511.1\|558240_558444_-	excisionase	A0A1S5SF07	Streptococcus_phage	4.0e-31	100.0
WP_000857133.1\|558904_559135_-	helix-turn-helix domain-containing protein	A0A1S5SEX1	Streptococcus_phage	2.7e-36	100.0
WP_000804885.1\|559131_559554_-	sigma-70 family RNA polymerase sigma factor	A0A1S5SEW0	Streptococcus_phage	2.5e-72	100.0
WP_001227347.1\|560058_560412_+	helix-turn-helix domain-containing protein	A0A1S5SFA6	Streptococcus_phage	1.3e-58	100.0
WP_000336323.1\|560471_560639_-	cysteine-rich KTR domain-containing protein	D0R0F6	Streptococcus_phage	1.6e-14	68.0
WP_000691746.1\|560757_562677_-	tetracycline resistance ribosomal protection protein Tet(M)	A0A1S5SF82	Streptococcus_phage	0.0e+00	98.4
WP_001814923.1\|562692_562809_-	tetracycline resistance determinant leader peptide	NA	NA	NA	NA
WP_001224318.1\|563053_563986_-	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	3.1e-171	99.4
WP_000769868.1\|563982_564984_-	bifunctional lysozyme/C40 family peptidase	A0A1S5SEZ8	Streptococcus_phage	5.0e-191	100.0
WP_000804748.1\|564980_567158_-	membrane protein	A0A1S5SF30	Streptococcus_phage	0.0e+00	100.0
WP_000331160.1\|567160_569608_-	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	100.0
WP_000506270.1\|569591_570098_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	8.6e-91	100.0
WP_000342539.1\|570072_570570_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.7e-91	100.0
WP_001009056.1\|570686_570908_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.3e-31	100.0
WP_000398284.1\|570950_572156_-	replication initiation factor domain-containing protein	A0A1S5SEX3	Streptococcus_phage	2.8e-233	100.0
WP_000879507.1\|572178_572331_-	hypothetical protein	NA	NA	NA	NA
WP_062810427.1\|572333_573719_-	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	5.5e-265	99.8
573121:573136	attR	NA	NA	NA	NA
WP_000985015.1\|573747_574134_-	YdcP family protein	A0A1S5SF96	Streptococcus_phage	3.0e-64	100.0
WP_000420682.1\|574149_574464_-	YdcP family protein	A0A1S5SF38	Streptococcus_phage	5.2e-54	100.0

DBSCAN-SWA_4

1218560 : 1342536

117

Erysipelothrix_phage(16.22%)

transposase,tRNA,holin,tail,integrase,bacteriocin,protease,terminase,portal,capsid

attL 1213383:1213399|attR 1338595:1338620

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1213383:1213399	attL	NA	NA	NA	NA
WP_110899918.1\|1218560_1220666_-\|bacteriocin	bacteriocin transporter	NA	NA	NA	NA
1213383:1213399	attL	NA	NA	NA	NA
WP_016357128.1\|1225330_1225654_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_081484478.1\|1225654_1225966_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A0C5AEB1	Paenibacillus_phage	6.5e-17	59.2
WP_062810466.1\|1226158_1228342_+	hypothetical protein	NA	NA	NA	NA
WP_003773349.1\|1228411_1228981_+	hypothetical protein	NA	NA	NA	NA
WP_013852857.1\|1231137_1232526_+	radical SAM protein	NA	NA	NA	NA
WP_062810468.1\|1232522_1233518_+	hypothetical protein	NA	NA	NA	NA
WP_003773336.1\|1233532_1233802_+	hypothetical protein	NA	NA	NA	NA
WP_013852855.1\|1233794_1233983_+	hypothetical protein	NA	NA	NA	NA
WP_062810469.1\|1234035_1235613_+	ABC transporter ATP-binding protein/permease	A0A1V0SKJ1	Klosneuvirus	3.7e-07	26.8
WP_003773332.1\|1235614_1236469_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.3e-30	36.1
WP_041690530.1\|1236461_1237562_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_003773326.1\|1237563_1238850_+	hypothetical protein	NA	NA	NA	NA
1237813:1237829	attR	NA	NA	NA	NA
WP_003773319.1\|1240098_1240674_-	replication initiator protein A	A0A286QNA4	Streptococcus_phage	1.4e-20	45.2
1237813:1237829	attR	NA	NA	NA	NA
WP_003773317.1\|1240851_1241223_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013852851.1\|1241506_1242175_-	hypothetical protein	NA	NA	NA	NA
WP_013852850.1\|1242246_1243107_-	DUF5596 domain-containing protein	NA	NA	NA	NA
WP_013852849.1\|1243158_1243632_-	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_013852848.1\|1243743_1245174_-	beta-Ala-His dipeptidase	NA	NA	NA	NA
WP_013852847.1\|1245270_1245678_+	large-conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
WP_013852846.1\|1245835_1247971_-	ATP-dependent RecD-like DNA helicase	A0A1P8DII4	Virus_Rctr197k	3.9e-36	32.7
WP_013852845.1\|1247987_1248716_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_013852844.1\|1248699_1249818_-\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_003773302.1\|1249814_1250252_-	transcriptional regulator Spx	NA	NA	NA	NA
WP_013852843.1\|1250365_1251361_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_013852842.1\|1252118_1252343_-	YneF family protein	NA	NA	NA	NA
WP_013852841.1\|1252636_1254322_+\|tRNA	proline--tRNA ligase	A0A2K9L3R9	Tupanvirus	5.9e-11	30.7
WP_062810471.1\|1254390_1256763_-	Cna B-type domain-containing protein	NA	NA	NA	NA
WP_110899873.1\|1256999_1262990_-	Cna B-type domain-containing protein	NA	NA	NA	NA
WP_062810472.1\|1263161_1265510_-	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	1.2e-81	47.1
WP_003773289.1\|1265523_1267182_-	ribonuclease J	NA	NA	NA	NA
WP_003773287.1\|1267325_1268090_-	TIGR00282 family metallophosphoesterase	NA	NA	NA	NA
WP_013852837.1\|1268089_1269646_-	ribonuclease Y	NA	NA	NA	NA
WP_013852836.1\|1269757_1270783_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	5.2e-119	62.1
WP_003773281.1\|1270814_1271408_-	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_013852835.1\|1271407_1272361_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_013852834.1\|1272803_1273118_-	DivIVA domain-containing protein	NA	NA	NA	NA
WP_013852833.1\|1273244_1273826_+	Holliday junction resolvase RecU	R9TMF8	Paenibacillus_phage	3.7e-21	32.8
WP_013852832.1\|1273822_1276879_+	penicillin-binding protein	NA	NA	NA	NA
WP_013852831.1\|1276940_1278068_-	alanine racemase	NA	NA	NA	NA
WP_013852830.1\|1278064_1279081_-	D-alanine--D-alanine ligase	NA	NA	NA	NA
WP_013852829.1\|1279081_1280404_-	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase	NA	NA	NA	NA
WP_013852828.1\|1280400_1281021_-	endonuclease III	NA	NA	NA	NA
WP_003773270.1\|1281017_1281524_-	DnaD domain protein	NA	NA	NA	NA
WP_003773269.1\|1281526_1281988_-	hypothetical protein	NA	NA	NA	NA
WP_062810473.1\|1282127_1283612_-	hypothetical protein	NA	NA	NA	NA
WP_013852826.1\|1283621_1285418_-	glucosaminidase domain-containing protein	NA	NA	NA	NA
WP_013852825.1\|1285570_1286230_+	hemolysin III family protein	NA	NA	NA	NA
WP_003773265.1\|1286242_1286686_-	hypothetical protein	NA	NA	NA	NA
WP_013852824.1\|1286757_1287822_-\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_013852823.1\|1287831_1288599_-	phosphatidate cytidylyltransferase	A0A2K9L268	Tupanvirus	3.7e-05	26.8
WP_003773262.1\|1288600_1289281_-	isoprenyl transferase	A0A076FI83	Aureococcus_anophage	9.6e-13	25.0
WP_003773261.1\|1289283_1289829_-	ribosome recycling factor	NA	NA	NA	NA
WP_003773260.1\|1289831_1290545_-	UMP kinase	NA	NA	NA	NA
WP_003773259.1\|1290596_1291481_-	elongation factor Ts	NA	NA	NA	NA
WP_003773257.1\|1291483_1292407_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_013852821.1\|1292562_1293705_-	pyridoxal phosphate-dependent aminotransferase	A0A1X7QHI1	Faustovirus	4.6e-07	25.4
WP_003773255.1\|1293694_1294078_-	hypothetical protein	NA	NA	NA	NA
WP_013852820.1\|1294228_1295533_+	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_003773604.1\|1295573_1296512_-\|transposase	IS30-like element ISErh4 family transposase	Q9MBM9	Staphylococcus_prophage	4.1e-22	28.5
WP_003773253.1\|1296633_1297356_-\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_013852819.1\|1297355_1297853_-	16S rRNA processing protein RimM	NA	NA	NA	NA
WP_003773251.1\|1297887_1298136_-	KH domain-containing protein	NA	NA	NA	NA
WP_013852818.1\|1298138_1298411_-	30S ribosomal protein S16	NA	NA	NA	NA
WP_013852817.1\|1298493_1299432_-	HD domain-containing protein	NA	NA	NA	NA
WP_144742866.1\|1299421_1301419_-	RecX family transcriptional regulator	NA	NA	NA	NA
WP_003773247.1\|1301494_1302001_-	bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR	NA	NA	NA	NA
WP_013852815.1\|1302372_1302972_+	hypothetical protein	NA	NA	NA	NA
WP_062810474.1\|1303017_1303248_-	hypothetical protein	A0A0H4TFF4	Erysipelothrix_phage	5.3e-32	97.4
WP_041690572.1\|1303251_1304226_-	CHAP domain-containing protein	A0A0H4TJ61	Erysipelothrix_phage	5.9e-189	95.1
WP_013852813.1\|1304290_1304662_-\|holin	phage holin family protein	A0A0H4TEZ1	Erysipelothrix_phage	9.4e-63	100.0
WP_013852812.1\|1304654_1304894_-	hypothetical protein	A0A0H4U092	Erysipelothrix_phage	5.9e-34	97.5
WP_013852811.1\|1304906_1306949_-	phage structural protein	A0A0H4TI29	Erysipelothrix_phage	0.0e+00	95.9
WP_013852810.1\|1306948_1308556_-	hypothetical protein	A0A0H4TFF7	Erysipelothrix_phage	5.9e-53	76.6
WP_013852809.1\|1308555_1308924_-	hypothetical protein	NA	NA	NA	NA
WP_013852808.1\|1308934_1311535_-	tape measure protein	A0A2P1JTW1	Anoxybacillus_phage	2.7e-31	35.3
WP_013852807.1\|1311531_1311723_-	hypothetical protein	NA	NA	NA	NA
WP_013852806.1\|1311866_1312226_-	hypothetical protein	NA	NA	NA	NA
WP_013852805.1\|1312241_1312670_-\|tail	major tail protein	R9TNE5	Paenibacillus_phage	2.1e-13	36.0
WP_013852804.1\|1312729_1313044_-	hypothetical protein	NA	NA	NA	NA
WP_013852803.1\|1313040_1313565_-	HK97 gp10 family phage protein	A0A060QNE4	Streptococcus_phage	1.6e-15	33.6
WP_041690528.1\|1313555_1313873_-	hypothetical protein	NA	NA	NA	NA
WP_013852801.1\|1313865_1314231_-	hypothetical protein	NA	NA	NA	NA
WP_013852800.1\|1314250_1315207_-	hypothetical protein	D2IYW7	Enterococcus_phage	2.4e-57	43.5
WP_013852799.1\|1315211_1315823_-	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_013852798.1\|1316004_1316229_-	hypothetical protein	NA	NA	NA	NA
WP_062810475.1\|1316203_1317787_-\|capsid	minor capsid protein	A0A141E1Y0	Streptococcus_phage	5.3e-30	33.0
WP_013852795.1\|1317764_1319093_-\|portal	phage portal protein	A0A2H4JDT5	uncultured_Caudovirales_phage	2.3e-66	36.6
WP_013852794.1\|1319092_1320466_-\|terminase	phage terminase large subunit	A0A2H4J7G6	uncultured_Caudovirales_phage	7.9e-131	52.4
WP_013852793.1\|1320446_1320911_-	hypothetical protein	A0A0A7RTX1	Clostridium_phage	6.5e-29	46.3
WP_013852791.1\|1321322_1322819_-	hypothetical protein	NA	NA	NA	NA
WP_013852790.1\|1322999_1323509_-	DUF2335 domain-containing protein	NA	NA	NA	NA
WP_158308987.1\|1323495_1323633_-	hypothetical protein	NA	NA	NA	NA
WP_144742865.1\|1323831_1324242_-	hypothetical protein	NA	NA	NA	NA
WP_013852786.1\|1324437_1324842_-	RusA family crossover junction endodeoxyribonuclease	Q5YA86	Bacillus_phage	6.1e-39	58.8
WP_013852785.1\|1324834_1325101_-	hypothetical protein	NA	NA	NA	NA
WP_013852784.1\|1325093_1325354_-	hypothetical protein	NA	NA	NA	NA
WP_013852783.1\|1325829_1328103_-	AAA family ATPase	Q5YA88	Bacillus_phage	6.4e-271	62.4
WP_062810476.1\|1328188_1328680_+	hypothetical protein	NA	NA	NA	NA
WP_013852781.1\|1328852_1330442_-	DEAD/DEAH box helicase	A0A0K2CZF8	Paenibacillus_phage	1.2e-228	73.5
WP_062810477.1\|1330445_1330904_-	DUF669 domain-containing protein	A0A0K2CZ91	Paenibacillus_phage	3.3e-33	49.7
WP_050921055.1\|1330921_1332001_-	ATP-binding protein	A0A097BY66	Enterococcus_phage	1.1e-87	48.4
WP_013852778.1\|1332003_1333284_-	AAA family ATPase	A0A097BY67	Enterococcus_phage	1.1e-142	62.7
WP_013852777.1\|1333270_1333489_-	hypothetical protein	NA	NA	NA	NA
WP_062810478.1\|1333481_1334084_-	hypothetical protein	NA	NA	NA	NA
WP_013852775.1\|1334131_1334512_+	hypothetical protein	NA	NA	NA	NA
WP_013852773.1\|1334625_1334880_-	hypothetical protein	NA	NA	NA	NA
WP_013852772.1\|1334917_1335124_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013852771.1\|1335252_1335669_+	helix-turn-helix transcriptional regulator	H0UST7	Bacillus_phage	6.3e-07	31.9
WP_013852770.1\|1335795_1336158_+	hypothetical protein	NA	NA	NA	NA
WP_062810479.1\|1336268_1337297_+	Abi family protein	A0A1Q1PVS3	Staphylococcus_phage	1.0e-29	31.3
WP_013852768.1\|1337379_1338594_+\|integrase	site-specific integrase	Q8SBN2	Clostridium_phage	2.6e-24	27.4
WP_050921054.1\|1339514_1339799_+	Ltp family lipoprotein	A0A097BY93	Leuconostoc_phage	3.5e-09	59.2
WP_003773238.1\|1340181_1340379_+	hypothetical protein	NA	NA	NA	NA
WP_013852766.1\|1340476_1341205_+	hypothetical protein	NA	NA	NA	NA
WP_003773236.1\|1341197_1341767_-	hypothetical protein	NA	NA	NA	NA
WP_013852765.1\|1341771_1342536_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage