CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP015035	Burkholderia cenocepacia strain 842 chromosome 3, complete sequence	0 crisprs	PD-DExK,RT,csa3	0
NZ_CP015032	Burkholderia cenocepacia strain 842 plasmid pBcn842-1, complete sequence	0 crisprs	PD-DExK	1
NZ_CP015033	Burkholderia cenocepacia strain 842 chromosome 1, complete sequence	0 crisprs	cas3,csa3,WYL,c2c9_V-U4,RT,DEDDh,DinG	2
NZ_CP015034	Burkholderia cenocepacia strain 842 chromosome 2, complete sequence	2 crisprs	csa3,cas3,PD-DExK,RT,DinG	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

87078 : 147547

Trichoplusia_ni_ascovirus(16.67%)

integrase,transposase

attL 106121:106137|attR 125988:126004

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_062883921.1\|87078_89214_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_059677875.1\|89877_90156_+	HU family DNA-binding protein	Q6QIE5	Burkholderia_phage	2.6e-17	55.1
WP_059677874.1\|90152_91307_+	DUF1016 domain-containing protein	A0A0U2BZN7	Salmonella_phage	2.8e-60	72.2
WP_059677872.1\|92599_93463_+	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_059677871.1\|93459_94212_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.1e-12	28.4
WP_059677870.1\|94288_95617_+	MFS transporter	NA	NA	NA	NA
WP_059677869.1\|95647_96826_+	L-rhamnonate dehydratase	Q6A202	Oenococcus_phage	1.3e-28	28.0
WP_059677868.1\|96846_97629_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.7e-19	30.1
WP_059677867.1\|97657_98602_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_059677866.1\|98732_99047_+	L-rhamnose mutarotase	NA	NA	NA	NA
WP_080465450.1\|99336_101136_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_062883925.1\|101146_102016_+	AAA family ATPase	NA	NA	NA	NA
WP_080465451.1\|102008_102521_+	hypothetical protein	NA	NA	NA	NA
WP_154817256.1\|102642_103056_+	hypothetical protein	NA	NA	NA	NA
WP_062883927.1\|103373_104777_+	MFS transporter	NA	NA	NA	NA
WP_062883928.1\|104790_105336_+	hypothetical protein	NA	NA	NA	NA
WP_062883929.1\|105498_106647_+	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
106121:106137	attL	NA	NA	NA	NA
WP_062883930.1\|106708_107983_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_062883931.1\|108055_108958_+	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
WP_062883932.1\|109186_110137_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_062883933.1\|110150_111320_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_044845603.1\|111343_112120_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.4e-15	25.6
WP_062883934.1\|112119_112836_+	ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	3.0e-12	28.3
WP_154817257.1\|112897_113896_+	4-hydroxyproline epimerase	NA	NA	NA	NA
WP_062883936.1\|113945_115181_+	amidohydrolase family protein	NA	NA	NA	NA
WP_062884019.1\|115274_115997_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_080465452.1\|118407_119493_+	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
WP_062884020.1\|119618_120743_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_062883937.1\|121024_121975_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_062883938.1\|122203_123079_+	transporter	NA	NA	NA	NA
WP_154817258.1\|123168_123690_-	hypothetical protein	NA	NA	NA	NA
WP_154817266.1\|123688_125353_+\|integrase	tyrosine-type recombinase/integrase	A0A2K9VH72	Gordonia_phage	1.6e-05	30.9
WP_062883940.1\|125480_126629_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
125988:126004	attR	NA	NA	NA	NA
WP_062883941.1\|127553_129044_+	alanine:cation symporter family protein	NA	NA	NA	NA
WP_062883942.1\|129083_130673_+	aldehyde dehydrogenase (NADP(+))	NA	NA	NA	NA
WP_062883943.1\|131606_132944_-	cation:dicarboxylase symporter family transporter	NA	NA	NA	NA
WP_062883944.1\|132970_134341_-	3-carboxy-cis,cis-muconate cycloisomerase	NA	NA	NA	NA
WP_062883945.1\|134485_135217_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_062883946.1\|135464_136262_-	DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_062884021.1\|136525_138367_+	bifunctional 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	NA	NA	NA	NA
WP_062884022.1\|138368_139349_+	3-carboxyethylcatechol 2,3-dioxygenase	NA	NA	NA	NA
WP_062883947.1\|139353_140133_+	2-keto-4-pentenoate hydratase	NA	NA	NA	NA
WP_062883948.1\|140141_141089_+	acetaldehyde dehydrogenase (acetylating)	G9E526	Ostreococcus_lucimarinus_virus	6.8e-33	33.4
WP_062883949.1\|141101_142115_+	4-hydroxy-2-oxovalerate aldolase	E5EQ69	Micromonas_sp._RCC1109_virus	2.2e-45	33.2
WP_062883950.1\|142222_143452_+	3-(3-hydroxy-phenyl)propionate transporter MhpT	NA	NA	NA	NA
WP_062884023.1\|143561_144431_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_080465453.1\|144702_145146_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_062883952.1\|145117_146698_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.0e-73	36.2
WP_062883953.1\|146729_147080_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	2.5e-17	40.4
WP_080465454.1\|147055_147547_-\|transposase	transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP015033

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

182345 : 191413

unidentified_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006484964.1\|182345_183896_+	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	9.5e-24	31.3
WP_006476832.1\|183931_184474_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_006484932.1\|184470_185157_+	deoxynucleoside kinase	A0A0M3UL55	Enterococcus_phage	7.2e-08	26.4
WP_006485002.1\|185200_186016_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	1.8e-37	34.2
WP_062884101.1\|186144_188067_-	bifunctional anthranilate synthase component I family protein/class IV aminotransferase	S4VNU7	Pandoravirus	6.9e-56	37.4
WP_006476837.1\|188070_189207_-	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	5.0e-22	26.9
WP_006484920.1\|189460_191413_-	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	2.5e-146	50.3

DBSCAN-SWA_2

512398 : 517301

Acidithiobacillus_phage(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080324571.1\|512398_512869_+	excisionase family DNA-binding protein	K4ICM4	Acidithiobacillus_phage	1.5e-17	34.5
WP_062884740.1\|512870_513452_+	PIN domain-containing protein	K4HZX4	Acidithiobacillus_phage	2.3e-23	35.9
WP_062884148.1\|514123_514651_+	hypothetical protein	A4JWV5	Burkholderia_virus	1.7e-57	65.1
WP_062884149.1\|514647_515376_+	VRR-NUC domain-containing protein	A4JWV4	Burkholderia_virus	1.5e-48	48.3
WP_062884150.1\|515385_516498_+	DUF3396 domain-containing protein	E5E3X7	Burkholderia_phage	4.3e-204	93.8
WP_059723936.1\|516785_517301_-\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	9.5e-21	52.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP015034

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP015034_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015034_1

2128884-2129022

Orphan

Consensus_repeat	Method
TCGATCAGCATGGCCGTCGCGCCTCATGCGCGCCGCAGCGTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015034_1

>merge|NZ_CP015034|1|2128884-2129022|CRISPRCasFinder
TCGATCAGCATGGCCGTCGCGCCTCATGCGCGCCGCAGCGTCGCGGCCCACACCCCCAACGCGGCCACGCTCGCCCCCACGCAGAGCACGCAGACGCTCGATCAGCATGGCCGTCGCGCCTCATGCACGCCGCAGCGTC

>NZ_CP015034|1|1|2128884-2129022|CRISPRCasFinder
TCGATCAGCATGGCCGTCGCGCCTCATGCGCGCCGCAGCGTC	GCGGCCCACACCCCCAACGCGGCCACGCTCGCCCCCACGCAGAGCACGCAGACGC
TCGATCAGCATGGCCGTCGCGCCTCATGCACGCCGCAGCGTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015034.1\|WP_006482934.1\|2122693_2123653_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133045
NZ_CP015034.1\|WP_006497289.1\|2117296_2118709_+\|UDP-glucose/GDP-mannose-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|223936
NZ_CP015034.1\|WP_006492002.1\|2123696_2124842_+\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340831
NZ_CP015034.1\|WP_062885391.1\|2126315_2127500_+\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340831
NZ_CP015034.1\|WP_034178568.1\|2130345_2130864_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP015034.1\|WP_062885394.1\|2132580_2133354_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_CP015034.1\|WP_006482944.1\|2118739_2119183_+\|low-molecular-weight-phosphotyrosine-protein-phosphatase	unknown	unknown	gnl\|CDD\|319971
NZ_CP015034.1\|WP_020979476.1\|2135666_2137157_+\|sigma-54-dependent-Fis-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225114
NZ_CP015034.1\|WP_006479474.1\|2133380_2133722_-\|FKBP-type-peptidyl-prolyl-cis-trans-isomerase	unknown	unknown	gnl\|CDD\|223619
NZ_CP015034.1\|WP_006482941.1\|2119176_2120355_+\|exopolysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|237903
NZ_CP015034.1\|WP_062885395.1\|2139649_2140069_+\|DUF2384-domain-containing-protein	unknown	unknown	gnl\|CDD\|378249
NZ_CP015034.1\|WP_006482932.1\|2120405_2122631_+\|polysaccharide-biosynthesis-tyrosine-autokinase	unknown	unknown	gnl\|CDD\|183173
NZ_CP015034.1\|WP_062885393.1\|2130945_2132454_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP015034.1\|WP_077020940.1\|2138158_2138407_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015034.1\|WP_012493182.1\|2134303_2135221_+\|metal-dependent-hydrolase	unknown	unknown	gnl\|CDD\|378401
NZ_CP015034.1\|WP_012493184.1\|2137185_2137569_-\|GtrA-family-protein	unknown	unknown	gnl\|CDD\|377229
NZ_CP015034.1\|WP_034203384.1\|2115848_2117222_+\|undecaprenyl-phosphate-glucose-phosphotransferase	unknown	unknown	gnl\|CDD\|274396
NZ_CP015034.1\|WP_062885390.1\|2124852_2126319_+\|glucose-6-phosphate-isomerase	unknown	unknown	unknown
NZ_CP015034.1\|WP_006482818.1\|2127499_2128666_+\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340831
NZ_CP015034.1\|WP_006490696.1\|2138632_2139415_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270421

Protein	Function_ID	Function_description	E-value
NZ_CP015034.1\|WP_006482934.1\|2122693_2123653_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133045	cd06423, CESA_like, CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.	6.44285e-22
NZ_CP015034.1\|WP_006497289.1\|2117296_2118709_+\|UDP-glucose/GDP-mannose-dehydrogenase-family-protein	gnl\|CDD\|223936	COG1004, Ugd, Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane].	0
NZ_CP015034.1\|WP_006492002.1\|2123696_2124842_+\|glycosyltransferase-family-4-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	6.85695e-20
NZ_CP015034.1\|WP_062885391.1\|2126315_2127500_+\|glycosyltransferase-family-4-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	5.44544e-59
NZ_CP015034.1\|WP_034178568.1\|2130345_2130864_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	7.40499e-31
NZ_CP015034.1\|WP_062885394.1\|2132580_2133354_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	3.62432e-24
NZ_CP015034.1\|WP_006482944.1\|2118739_2119183_+\|low-molecular-weight-phosphotyrosine-protein-phosphatase	gnl\|CDD\|319971	cd16343, LMWPTP, Low molecular weight protein tyrosine phosphatase. Low molecular weight protein tyrosine phosphatases (LMW-PTP) are a family of small soluble single-domain enzymes that are characterized by a highly conserved active site motif (V/I)CXGNXCRS and share no sequence similarity with other types of protein tyrosine phosphatases (PTPs). LMW-PTPs play important roles in many biological processes and are widely distributed in prokaryotes and eukaryotes.	8.02627e-48
NZ_CP015034.1\|WP_020979476.1\|2135666_2137157_+\|sigma-54-dependent-Fis-family-transcriptional-regulator	gnl\|CDD\|225114	COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms].	5.31271e-143
NZ_CP015034.1\|WP_006479474.1\|2133380_2133722_-\|FKBP-type-peptidyl-prolyl-cis-trans-isomerase	gnl\|CDD\|223619	COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones].	2.08141e-60
NZ_CP015034.1\|WP_006482941.1\|2119176_2120355_+\|exopolysaccharide-biosynthesis-protein	gnl\|CDD\|237903	PRK15078, PRK15078, polysaccharide export protein Wza; Provisional.	6.60759e-106
NZ_CP015034.1\|WP_006482818.1\|2127499_2128666_+\|glycosyltransferase-family-4-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	1.34776e-53
NZ_CP015034.1\|WP_062885395.1\|2139649_2140069_+\|DUF2384-domain-containing-protein	gnl\|CDD\|378249	pfam09722, DUF2384, Protein of unknown function (DUF2384). Proteins in this family are found almost exclusively in the Proteobacteria, but also in Gloeobacter violaceus PCC 7421, a cyanobacterium. The function is unknown.	4.53947e-09
NZ_CP015034.1\|WP_006482932.1\|2120405_2122631_+\|polysaccharide-biosynthesis-tyrosine-autokinase	gnl\|CDD\|183173	PRK11519, PRK11519, tyrosine-protein kinase Wzc.	3.01158e-178
NZ_CP015034.1\|WP_012493182.1\|2134303_2135221_+\|metal-dependent-hydrolase	gnl\|CDD\|378401	pfam10118, Metal_hydrol, Predicted metal-dependent hydrolase. Members of this family of proteins comprise various bacterial transition metal-dependent hydrolases.	3.13969e-105
NZ_CP015034.1\|WP_012493184.1\|2137185_2137569_-\|GtrA-family-protein	gnl\|CDD\|377229	pfam04138, GtrA, GtrA-like protein. Members of this family are predicted to be integral membrane proteins with three or four transmembrane spans. They are involved in the synthesis of cell surface polysaccharides. The GtrA family are a subset of this family. GtrA is predicted to be an integral membrane protein with 4 transmembrane spans. It is involved is in O antigen modification by Shigella flexneri bacteriophage X (SfX), but does not determine the specificity of glucosylation. Its function remains unknown, but it may play a role in translocation of undecaprenyl phosphate linked glucose (UndP-Glc) across the cytoplasmic membrane. Another member of this family is a DTDP-glucose-4-keto-6-deoxy-D-glucose reductase, which catalyzes the conversion of dTDP-4-keto-6-deoxy-D-glucose to dTDP-D-fucose, which is involved in the biosynthesis of the serotype-specific polysaccharide antigen of Actinobacillus actinomycetemcomitans Y4 (serotype b). This family also includes the teichoic acid glycosylation protein, GtcA, which is a serotype-specific protein in some Listeria innocua and monocytogenes strains. Its exact function is not known, but it is essential for decoration of cell wall teichoic acids with glucose and galactose.	6.05476e-13
NZ_CP015034.1\|WP_034203384.1\|2115848_2117222_+\|undecaprenyl-phosphate-glucose-phosphotransferase	gnl\|CDD\|274396	TIGR03023, Sugar_transferase., Undecaprenyl-phosphate glucose phosphotransferase. This family of proteins encompasses the E. coli WcaJ protein involved in colanic acid biosynthesis, the Methylobacillus EpsB protein involved in methanolan biosynthesis, as well as the GumD protein involved in the biosynthesis of xanthan. All of these are closely related to the well-characterized WbaP (formerly RfbP) protein, which is the first enzyme in O-antigen biosynthesis in Salmonella typhimurium. The enzyme transfers galactose from UDP-galactose (NOTE: not glucose) to a polyprenyl carrier (utilizing the highly conserved C-terminal sugar transferase domain, pfam02397) a reaction which takes place at the cytoplasmic face of the inner membrane. The N-terminal hydrophobic domain is then believed to facilitate the "flippase" function of transferring the liposaccharide unit from the cytoplasmic face to the periplasmic face of the inner membrane. Most of these genes are found within large operons dedicated to the production of complex exopolysaccharides such as the enterobacterial O-antigen. Colanic acid biosynthesis utilizes a glucose-undecaprenyl carrier, knockout of EpsB abolishes incorporation of UDP-glucose into the lipid phase, and the C-terminal portion of GumD has been shown to be responsible for the glucosyl-1-transferase activity.	0
NZ_CP015034.1\|WP_062885393.1\|2130945_2132454_-\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	6.62858e-60
NZ_CP015034.1\|WP_006490696.1\|2138632_2139415_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270421	cd13703, PBP2_HisJ_LAO, Substrate binding domain of ABC-type histidine- and lysine/arginine/ornithine transporters; the type 2 periplasmic-binding protein fold. This subgroup includes the periplasmic-binding proteins, HisJ and LAO, that serve as initial receptors in the ABC transport of histidine and lysine-arginine-ornithine amino acids. They are belong to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	8.83127e-127

>NZ_CP015034.1|WP_006482818.1|2127499_2128666_+|glycosyltransferase-family-4-protein
MSQSSRPIKSLQIGMHWFPERAGGLDRMYYSLVGALPGAGVEVRGLVAGSPKVADDTGGAIQGFGPASEPLARRMLAARRALRDEIRSARPDVISSHFALYTFPGLDVTRGIPQVSHFQGPWADESQVEGAASLGQRAKRYLEQAVYTRSSRLIVLSQAFGQILTNRYGIDPSRVRVIPGCVDTAQFDTPLTPAEARHKLQLPQDRPIVLAVRRLVRRMGLEDLIDAIGLVKRRHPDVLLLIAGKGKIGEELQQRIDEAGLQDNVKLLGFVPDHHLAALYRAATVSVVPTVALEGFGLITVESLASGTPVLVTPVGGLPEAVAGLSNDLVLPSTGADAIAEGLGGALSGAIALPDEAACKRYARDHFDNAVIARRVAGVYEEAIQAAG
>NZ_CP015034.1|WP_062885391.1|2126315_2127500_+|glycosyltransferase-family-4-protein
MRIAIVTHVVRHNDGQGRVNYEIARAALAENYEVTLVASHVAPELLADPRVRWVPVKVGGFWPSNLVKQQVFALKSAAWLRAHRGEYDVLHVNGFISWIKADVNTAHFVHGGWFKSPYYPFGPTKGLWSAYQYVYTRVNTVLERWAYKRSRAITAVSQKVADEIAGLGIDSRKISVIYNGVDGSAFAGAQADRAAFKLPDDAFLLLFVGDLRTPRKNLGTVLKALTKLPANVHLAVAGYLPGSPYPEEARALGIDSRVHFLGLVKDMPTLMRSVDAYVFPSRYEAMSLSLLEAMAAGLPVVTARTAGGAEIITRECGIVLEDPDDPAALAQAIGALAASRDTCRAMGDAARELMTRFGWAHMGAQYVALYRRIGQPTQPSAFERVEHAITQEQP
>NZ_CP015034.1|WP_062885390.1|2124852_2126319_+|glucose-6-phosphate-isomerase
MSTIAAERAPSRARSWFAEPKHWAGQAGLWTFTAALIAIHQGKVLTLAFPVLAIAVGIWLYFKSPARYVGFMWWVWFLSPEVRRLADWSKGAFTPTSLIQVAPLAVTMIAGLGLLRHYRVLAQRRGIPVLLMLFGLAYAYLVGIVSSGVMAATYDLANWVYPVLIGFHIMVNARDYPEYRDVLLSTFMWGMLVMGLYGIVQYFVMPQWDVLWMIGSDMGSQGEPVPYGVRVFSTMNSSGPFAFAIMGALVFVFAAPQKIRWFAGAAGFVSFALCLVRSTWGGWVIALAIQLVQSSNRVRMRILISGVVLVGLCVPLLTVGPVADRLGARLQSITNLKDDRSYDDRNKFYATFAQTAFTDVAGEGMGATGASTKLSSDSGELGKYGSFDSGVMNVPFVLGWPGTLLYLAGVVMLFGRMLRAAFKLRQDKFVAACLSLCLSTFAMLVFTNSLIGTGGLLMFTAIFSILAAAHWQKAQRLLAAARSRGGDH
>NZ_CP015034.1|WP_006492002.1|2123696_2124842_+|glycosyltransferase-family-4-protein
MTTKAATKVHVHLFHGADPRTYRKGDDIGCLYGYHHAESDEFRLTYSQDGAENRVVSVARRALKAALGFDVVHAWRNRAALLDTDVIWTHTEQEHLAAALILKLAGEQGKRPLLLAQSVWLFDKWGSFGGPRRWLYRKLIARADALTTLARDNADLCRRYLGRDAEFVYYGLNTQDFPPVEPQQWTPNRPLRIAAIGNDRDRDWRTFLAAFGGDARYDVRLATRRRVPREWHAPNVKIGPASGLAKQHELYAWADVIVVPLRPNFHASGITVMLEAAAVGKPMIVSDVGGLSDYFPHDTAAYVPAFDAQAMRQAADRFVADPVAALDCARAAAACLRERDLTTQAFAEQHVRITRDMLRRRRTPAAAGVAMPLADSRPSSR
>NZ_CP015034.1|WP_006482934.1|2122693_2123653_+|glycosyltransferase-family-2-protein
MKISVLVPTYRRPADLARCLLALQRQQRLPDEVIVVARPEDDATHERLADPAVGGALPLRLVPVDVPGQVAALNKGLDSANGDIVAITDDDAAPRPDWLARIEAAFLSDPRVGAVGGRDWVHEKGRVLDESRELVGQLTLSGKIVGNHHLGVGGAREVDMLKGANMSYRRAAIERLRFDTRLRGAGAQVHNDMGFSMHVQREGWKLVYDPSIAVDHFPAERFDDDRRDAASLNAISNGAYNLHLILREHLPPLRREIAWWWWTLVGTRVYPGFAHVLLSLPGARRERVLAHWRAVRRGARDARRTNLAPHRAAMPPVTS
>NZ_CP015034.1|WP_006482932.1|2120405_2122631_+|polysaccharide-biosynthesis-tyrosine-autokinase
MVNTQAKHSYADLTAKTEEEDVVLGQLLQVIMDDIWLLLGIAVTVVALAGLYCFIAKPVYQADVHVRVEGNDNTSQALTQTQTGASINSGPQQAPTDAEIEIIKSRGVVAPVVDQFKLNFTVAPKTLPVIGSLAARLATPGTPSRPWLGLKSYAWGGEVADIDTINVVPALEGKKLTLTAGPNGTYSLVDENGTRLLAGRVGESAQGGGVTLLVQKLVARPGTQFTVVRYNDLDAISGFQAGIQVSEQGKQTGVVQISLEGKDPDQTAAIANALAQSYLNQHVVAKQAEATKMLDFLKGEEPRLKADLERAEAALTQYQRTSGSINASDEAKVYLEGSVQYEQQIAAQRLQLASLAQRFTDSHPMVIAAKQQLAELQGEKDKFSNRFRSLPATEVKAVQLQRDAKVAEDIYVLLLNRVQELSVQKAGTGGNIHLIDSALRPGAPVKPKKVLILSAAVFLGLILGTGVVFLRRNLFQGIEDPDRIERAFNLPLYGLVPQSAEQVKLDAAAEKGGSRARPILASLRPKDLSVESMRSLRTAMQFAMMDAKNRVIVLTGPTPGIGKSFLTVNLAVLLAHSGKRVLLIDADMRRGMLDRYFGLTVQPGLSELLSDQSALEDAVRETPVQGLSFISAGTRPPNPSELLMSTRLPQYLEGLGKRYDVVLIDSPPVLAVTDATIIGRMAGSTFLVLRSGMHTEGEIADAIKRLRTAGVDLEGGIFNGVPPKARGYGRGYAAVHEYLSA
>NZ_CP015034.1|WP_006482941.1|2119176_2120355_+|exopolysaccharide-biosynthesis-protein
MLKRPMRPVALAVALTTFLSACATAPGNYLDSSNLKDEGRQEAAETYPVHYIDAKVVMDQLQKAQVDHPLPPGRYTDPSQYTYRVGPQDILGVTVWDHPELTTPQGQSFSSGGNTTQSVAGALQQPYTTALPGQADPYGQTVAADGTIFFPFVGRIRVAGKTVAQIRDEMASSLARYVKNPQLDVRVLSFRSQKVQVTGEVKQPGPLAVSDVPLTLVDAISRSGGSTAEADLQRVRLTRDGKLYTLDANGVLDRGEVKQNVMLQPGDIVNVPDRSDSRVFIMGEVKTPVTVPMLKGRLTIADALTAGGGILDTDANPRKIYVMRGMRDNPTKPEVFRLDMTQPDALMLSSRFPLQPLDVVYVSTASSVQFNRVLQQVLPTIQTIFYMRQITR
>NZ_CP015034.1|WP_006482944.1|2118739_2119183_+|low-molecular-weight-phosphotyrosine-protein-phosphatase
MFRNILIVCHANVCRSPAAEMLFKSHAASRGGPRPTFHSAGVHANDGDGIDPVMRQLLAERGVDATTHRSRRLSRRIVRDADLILVSERRQIAAVEAVDPFARGKVHLLGKWEGAEIADPHGGPEADYRESYSLIERLVQGWLQKLC
>NZ_CP015034.1|WP_006497289.1|2117296_2118709_+|UDP-glucose/GDP-mannose-dehydrogenase-family-protein
MNLTIIGSGYVGLVTGACLADIGHDVFCLDVDQAKIDILNDGGVPIHEPGLKEVIARNRSAGRLRFSTDIEAAVAHGDVQFIAVGTPPDEDGSADLQYVLAAARNIGRYMTGFKVIVDKSTVPVGTAERVRAAVAEELAKRGGDQMFSVVSNPEFLKEGAAVDDFTRPDRIVIGCDDDVPGERARELMKKLYAPFNRNHERTLYMDVRSAEFTKYAANAMLATRISFMNELANLADRFGADIEAVRRGIGSDPRIGYHFLYAGCGYGGSCFPKDVEALIRTADEHGQSLQILKAVSSVNATQKRVLADKIVARFGEDLSGRTFALWGLAFKPNTDDMREAPSRELIAELLSRGARVAAYDPVAQQEARRVIALDLADHPSWLERLTFVDDEAQAARDADALVIVTEWKAFKSPDFVALGRLWKTPVIFDGRNLYEPETMSEQGIEYHPIGRPGSRQAVAARVPGAARASA
>NZ_CP015034.1|WP_034203384.1|2115848_2117222_+|undecaprenyl-phosphate-glucose-phosphotransferase
MLSVLARVIDIAMVVTGALIAAALHDGSIGLSDLQRTTVLFDCLLVVVFFPAVGIYQSWRGKRLVGLMGRVAFAWLAVELAGILMSFSFHQSGDLSRLWLGYWALVTMALLAGSKACVHVVLRQLRRGGYNLKAVAIVGGTPAARRLIAQMRARPEAGFNPVCVYDESEAPGEVALDDVRIERQFESLVWLVRSRAISELWLTLPITEERRIHQIVTVFRHDFVNIRFIPDVRTLSFFNQEVVEVLGVPAINLAASPITDVRILPKFVFDRLFALAALTALAPVMVLIAALIKLTSRGPVFFRQKRKGIDGHEFEIYKFRSMKVHQEVAGQVTQATKNDSRVTPVGRFLRRTSLDELPQFINVLKGEMSVVGPRPHALAHDDIYKDLVKGYMFRYRIKPGITGWAQINGFRGETDQIEKMMGRVKLDLYYMQNWSFWLDIKIVVLTLWKGFTGSNAY
>NZ_CP015034.1|WP_034178568.1|2130345_2130864_+|helix-turn-helix-transcriptional-regulator
MAGMPAKAAGVIAESNMARQKSLADSPCPVARATDIVGDRWALLIVRDAFDGVRRFGDFRASLGVASNILSDRLKMLVDAGVFDVVPASDGTAYQEYVLTKKGEGLFPVIVMLRQWGEANLFARGERHSVLIDRGTGRAIRKLALRHDDGRPLKAADTVVKKIDDEAGAARR
>NZ_CP015034.1|WP_062885393.1|2130945_2132454_-|MFS-transporter
MDTTTPSPAFPPALARVVATVSIGFVVTQLDVTIVNIALAHLAADLHLPVAGLQWVVDAYTLAFAVLMLSAGALGDRFGARRLYVAGLLLFALASLACGAAVAPAMLIAARALQGVGAAAMLPNSLALLNDACRHDPRLRARAVGGWTAAGSIAIAAGPVVGGLLIAAWGWRGIFLVNLPLCAAGLAATFAWVPARREQAAPARSARSLDPRGQFVAIAMLTALTGAVIEWRPLGFTHLVVTGGFTLAALAALAFVAIESRTATPMLPLSLFRHRTFSAAVLFGICVNLTYYGTVFMLALYLQRTRDQSALQAGLAFLPLTGGFLLSNLASGRVVARHGPRMPMVAGALVAALGYGSLHVVDATTPLVMVLVPFLLIPSGMGFAVPAMTTAVLASVAPDRAGIASAVLNTARQAGGAIGVAAFGALAGGGGAAQVVSGLRIETAVSVALLLAAALLATRVRTNADRGASPAPRATPPVDRTRAVTRHRGEAGSGNADERRSA
>NZ_CP015034.1|WP_062885394.1|2132580_2133354_-|AraC-family-transcriptional-regulator
MERIASPAIALRRYATCEASDVHDFHQVVLGVDGAMVMAVDGIGQRIDRHAAWLIPAGARHDYAGLGDNRQLVIDLPAASLAVPQRLFDHARAVSIDPALTSLVAQVAAAAAQHDVPDGDARQAAAHRFQWQAAARLCDALLDDAGIAAPASGLDFARIDRWLRARLAEPLRIADLAAHCGYGMRRFHQLFVDAFGETPHRYLQRLRLDAAIVLLADGRHALVDIAGSVGFADQSTFTHAFTKRFGVAPGRWRGERH
>NZ_CP015034.1|WP_006479474.1|2133380_2133722_-|FKBP-type-peptidyl-prolyl-cis-trans-isomerase
MSVITTESGLKYEDLTEGTGAEAQAGKTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGPRGAGGVIPPNATLVFEVELLDV
>NZ_CP015034.1|WP_012493182.1|2134303_2135221_+|metal-dependent-hydrolase
MKSAASATAAGIMPVRRDLRFDLPVERAKDWHGLGSHVTHFFNALSLLFPAGERFFMDSVRNYRDRIDDPVLKQQVLGFIGQEAMHTREHIEYNELMQANRLPARKLDQRVWTVLGYMKRKLPHSVQLAHTVAAEHYTAMLADWLLRDPTRLDGSVEGYRQMWIWHALEETEHKAVSFDVWNAAMKPGLRRYLIRIGVYLLTTLTFWPTVFLMHATLLWRDRGAGHHVRGMLRMIAFLYGPRRGLFPRIAGEWLSFFRPGFHPWDHDNRHHLARVDALAATYGEHGGAPAGRGRANTPAPLASGR
>NZ_CP015034.1|WP_020979476.1|2135666_2137157_+|sigma-54-dependent-Fis-family-transcriptional-regulator
MVARSPDANGQAAPEMTDVSVTAPEAGRKLFVIMRTPDEPLLAQLRGLGWEIAVAKTAGAAQNMTSGVSVAAGLVDFTGFTSRDYPALKMCLSQPAIGWISIAQAGITIGPAVRELIRSYCFDYVTLPLPYEWISHVLGHARGMAALDRVDGAAYAASIGEHGMIGNCEAMQQLFSTIRKVAKTDASVFISGESGTGKELTALAIHERSGRGKGPFVAINCGAIPHHLLQSELFGYERGAFTGANQRRAGRIESANGGTLFLDEIGDMPVESQASLLRFLQEGKIERLGGQESIAVDVRIISATHVDLDGAVEAGRFRADLYHRLCVLRIHEPPLRARGKDIDILAHYVLQKFKADSGRKISGFTSAALDAMRRYEWPGNVRELINRVRRAIVMAESRLLTPHDLGLDTPGETEPVTLEQARALAERTAIENALLRNDHRINKAAAELGISRVTLYRMMIEHGLNDHDNNGGSGGNGDSGGHDGAPSGDAGHQRVG
>NZ_CP015034.1|WP_012493184.1|2137185_2137569_-|GtrA-family-protein
MLRTFAAERARLIRFGVSGLGSTALHALIAAAMFALCDATPVVANASAFVCSTAFSYLANTLWSFSSPVTWGNFMRFLAVAMAGLAVTMLLAHGTDALGLARAWSIVAVVLCVPPVTFVLHRLWTYR
>NZ_CP015034.1|WP_077020940.1|2138158_2138407_+|hypothetical-protein
MIDHHTPRSAGRDRRDSGHRRSNVALAADRHASTGHLSAPGARRIRLVAGHPRRVGTFLHANPVRMGMCTRAPVPRRPIFAY
>NZ_CP015034.1|WP_006490696.1|2138632_2139415_-|ABC-transporter-substrate-binding-protein
MKRLIAAVSIALLAVSAGPAVAKDWTTIRFGTDASYAPFESKAPDGKLVGFDIDLGNEICARLKAKCVWLENDFDGMIPALKAKKFDAVLSSMSITPQRAQQIGFTTKIYNQPTRLVVKKGSPLLPTAESLKGKSIGVEQGTTQETYAKAYWGKQGANVVSYQNQDGVYADLIAGRLDAALQDEVQAAIGFLKSPRGANYTFVGPELVDEKVLGIGAGIGLRQEDTDLKAKIDRAILDMVKDGTYKRLASKYFDFDIYGS
>NZ_CP015034.1|WP_062885395.1|2139649_2140069_+|DUF2384-domain-containing-protein
MSLPAYDSHSALPHASVAQMSAAGLRAFFNIARDWELTIDEQIVLLGSPGRSTFFKWKAAPESARLPRDTLERLSLLLGIYKGLQILLPQPAAADAWVKRPNDAAPFGGKRALDRMLAGNVGDLVAVRQYLDAMRGGWA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP015034_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015034_2

2517375-2517483

Orphan

Consensus_repeat	Method
CCTTGCGGCGGCCCGGCGGAGGCTGA	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of NZ_CP015034_2

>merge|NZ_CP015034|2|2517375-2517483|CRISPRCasFinder
CCTTGCGGCGGCCCGGCGGAGGCTGAGATGAAACGACCCCCACGCTCACTTTGTTCGCTGCCCCCCGCGGGGGCGGTCAGCCTCCTTGGGGCGGCCCGGCGGAGGCTGA

>NZ_CP015034|2|2|2517375-2517483|CRISPRCasFinder
CCTTGCGGCGGCCCGGCGGAGGCTGA	GATGAAACGACCCCCACGCTCACTTTGTTCGCTGCCCCCCGCGGGGGCGGTCAGCCT
CCTTGGGGCGGCCCGGCGGAGGCTGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015034.1\|WP_062885479.1\|2505800_2506268_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237864
NZ_CP015034.1\|WP_062885480.1\|2512123_2513749_-\|APC-family-permease	unknown	unknown	gnl\|CDD\|223605
NZ_CP015034.1\|WP_006491351.1\|2517484_2517718_+\|(2Fe-2S)-binding-protein	unknown	unknown	gnl\|CDD\|379229
NZ_CP015034.1\|WP_062885485.1\|2525425_2525776_+\|helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|197713
NZ_CP015034.1\|WP_012493270.1\|2506301_2507165_+\|peptide-binding-protein	unknown	unknown	gnl\|CDD\|227324
NZ_CP015034.1\|WP_062885486.1\|2525765_2526200_+\|YeeE/YedE-family-protein	unknown	unknown	gnl\|CDD\|225264
NZ_CP015034.1\|WP_006495060.1\|2509445_2510468_-\|Ldh-family-oxidoreductase	unknown	unknown	gnl\|CDD\|224966
NZ_CP015034.1\|WP_058903005.1\|2516074_2517202_+\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223737
NZ_CP015034.1\|WP_062885482.1\|2517714_2518983_+\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223523
NZ_CP015034.1\|WP_006484864.1\|2515145_2516078_+\|4-hydroxyproline-epimerase	unknown	unknown	gnl\|CDD\|172473
NZ_CP015034.1\|WP_062885484.1\|2523964_2525326_+\|aromatic-acid/H+-symport-family-MFS-transporter	unknown	unknown	gnl\|CDD\|273327
NZ_CP015034.1\|WP_062885481.1\|2513973_2514894_-\|dihydrodipicolinate-synthase-family-protein	unknown	unknown	gnl\|CDD\|188630
NZ_CP015034.1\|WP_062885483.1\|2520137_2521181_+\|gentisate-1,2-dioxygenase	unknown	unknown	gnl\|CDD\|131325
NZ_CP015034.1\|WP_012493271.1\|2507285_2509145_-\|dihydroxy-acid-dehydratase	unknown	unknown	gnl\|CDD\|237104
NZ_CP015034.1\|WP_062885478.1\|2503976_2505503_-\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|274108
NZ_CP015034.1\|WP_058903009.1\|2522675_2523884_+\|3-hydroxybenzoate-6-monooxygenase	unknown	unknown	gnl\|CDD\|181262
NZ_CP015034.1\|WP_034202471.1\|2519029_2519974_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274127
NZ_CP015034.1\|WP_006488722.1\|2521268_2521967_+\|fumarylacetoacetate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223257
NZ_CP015034.1\|WP_058903003.1\|2510460_2512053_-\|aldehyde-dehydrogenase-(NADP(+))	unknown	unknown	gnl\|CDD\|143447
NZ_CP015034.1\|WP_006495051.1\|2522001_2522643_+\|maleylacetoacetate-isomerase	unknown	unknown	gnl\|CDD\|273527

Protein	Function_ID	Function_description	E-value
NZ_CP015034.1\|WP_062885479.1\|2505800_2506268_+\|hypothetical-protein	gnl\|CDD\|237864	PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional.	5.3625e-05
NZ_CP015034.1\|WP_062885480.1\|2512123_2513749_-\|APC-family-permease	gnl\|CDD\|223605	COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism].	6.02298e-51
NZ_CP015034.1\|WP_006491351.1\|2517484_2517718_+\|(2Fe-2S)-binding-protein	gnl\|CDD\|379229	pfam13510, Fer2_4, 2Fe-2S iron-sulfur cluster binding domain. The 2Fe-2S ferredoxin family have a general core structure consisting of beta(2)-alpha-beta(2) which a beta-grasp type fold. The domain is around one hundred amino acids with four conserved cysteine residues to which the 2Fe-2S cluster is ligated. This cluster appears within sarcosine oxidase proteins.	1.16336e-17
NZ_CP015034.1\|WP_062885485.1\|2525425_2525776_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197713	smart00418, HTH_ARSR, helix_turn_helix, Arsenical Resistance Operon Repressor.	1.53577e-17
NZ_CP015034.1\|WP_012493270.1\|2506301_2507165_+\|peptide-binding-protein	gnl\|CDD\|227324	COG4991, COG4991, Uncharacterized protein with a bacterial SH3 domain homologue [Function unknown].	1.17804e-19
NZ_CP015034.1\|WP_062885486.1\|2525765_2526200_+\|YeeE/YedE-family-protein	gnl\|CDD\|225264	COG2391, COG2391, Predicted transporter component [General function prediction only].	2.58314e-12
NZ_CP015034.1\|WP_006495060.1\|2509445_2510468_-\|Ldh-family-oxidoreductase	gnl\|CDD\|224966	COG2055, COG2055, Malate/L-lactate dehydrogenases [Energy production and conversion].	7.98248e-130
NZ_CP015034.1\|WP_058903005.1\|2516074_2517202_+\|FAD-binding-oxidoreductase	gnl\|CDD\|223737	COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism].	5.76304e-52
NZ_CP015034.1\|WP_062885482.1\|2517714_2518983_+\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|223523	COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only].	5.67674e-24
NZ_CP015034.1\|WP_006484864.1\|2515145_2516078_+\|4-hydroxyproline-epimerase	gnl\|CDD\|172473	PRK13970, PRK13970, 4-hydroxyproline epimerase.	0
NZ_CP015034.1\|WP_062885484.1\|2523964_2525326_+\|aromatic-acid/H+-symport-family-MFS-transporter	gnl\|CDD\|273327	TIGR00895, transport_protein, benzoate transport. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	4.07862e-107
NZ_CP015034.1\|WP_062885481.1\|2513973_2514894_-\|dihydrodipicolinate-synthase-family-protein	gnl\|CDD\|188630	cd00408, DHDPS-like, Dihydrodipicolinate synthase family. Dihydrodipicolinate synthase family. A member of the class I aldolases, which use an active-site lysine which stabilizes a reaction intermediate via Schiff base formation, and have TIM beta/alpha barrel fold. The dihydrodipicolinate synthase family comprises several pyruvate-dependent class I aldolases that use the same catalytic step to catalyze different reactions in different pathways and includes such proteins as N-acetylneuraminate lyase, MosA protein, 5-keto-4-deoxy-glucarate dehydratase, trans-o-hydroxybenzylidenepyruvate hydratase-aldolase, trans-2'-carboxybenzalpyruvate hydratase-aldolase, and 2-keto-3-deoxy- gluconate aldolase. The family is also referred to as the N-acetylneuraminate lyase (NAL) family.	1.31745e-97
NZ_CP015034.1\|WP_062885483.1\|2520137_2521181_+\|gentisate-1,2-dioxygenase	gnl\|CDD\|131325	TIGR02272, gentisate_12-dioxygenase, gentisate 1,2-dioxygenase. This family consists of gentisate 1,2-dioxygenases. This ring-opening enzyme acts in salicylate degradation that goes via gentisate rather than via catechol. It converts gentisate to maleylpyruvate. Some putative gentisate 1,2-dioxygenases are excluded by a relatively high trusted cutoff score because they are too closely related to known examples of 1-hydroxy-2-naphthoate dioxygenase. Therefore some homologs may be bona fide gentisate 1,2-dioxygenases even if they score below the given cutoffs.	0
NZ_CP015034.1\|WP_012493271.1\|2507285_2509145_-\|dihydroxy-acid-dehydratase	gnl\|CDD\|237104	PRK12448, PRK12448, dihydroxy-acid dehydratase; Provisional.	0
NZ_CP015034.1\|WP_062885478.1\|2503976_2505503_-\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|274108	TIGR02393, RNA_polymerase_sigma_factor_RpoD, RNA polymerase sigma factor RpoD, C-terminal domain. This model represents the well-conserved C-terminal region of the major, essential sigma factor of most bacteria. Members of this clade show considerable variability in domain architecture and molecular weight, as well as in nomenclature: RpoD in E. coli and other Proteobacteria, SigA in Bacillus subtilis and many other Gram-positive bacteria, HrdB in Streptomyces, MysA in Mycobacterium smegmatis, etc. [Transcription, Transcription factors].	2.27739e-88
NZ_CP015034.1\|WP_058903009.1\|2522675_2523884_+\|3-hydroxybenzoate-6-monooxygenase	gnl\|CDD\|181262	PRK08163, PRK08163, 3-hydroxybenzoate 6-monooxygenase.	0
NZ_CP015034.1\|WP_034202471.1\|2519029_2519974_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|274127	TIGR02424, TF_pcaQ, pca operon transcription factor PcaQ. Members of this family are LysR-family transcription factors associated with operons for catabolism of protocatechuate. Members occur only in Proteobacteria. [Energy metabolism, Other, Regulatory functions, DNA interactions].	1.11024e-47
NZ_CP015034.1\|WP_006488722.1\|2521268_2521967_+\|fumarylacetoacetate-hydrolase-family-protein	gnl\|CDD\|223257	COG0179, MhpD, 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Secondary metabolites biosynthesis, transport, and catabolism].	2.23284e-96
NZ_CP015034.1\|WP_058903003.1\|2510460_2512053_-\|aldehyde-dehydrogenase-(NADP(+))	gnl\|CDD\|143447	cd07129, ALDH_KGSADH, Alpha-Ketoglutaric Semialdehyde Dehydrogenase. Alpha-Ketoglutaric Semialdehyde (KGSA) Dehydrogenase (KGSADH, EC 1.2.1.26) catalyzes the NAD(P)+-dependent conversion of KGSA to alpha-ketoglutarate. This CD contains such sequences as those seen in Azospirillum brasilense, KGSADH-II (D-glucarate/D-galactarate-inducible) and KGSADH-III (hydroxy-L-proline-inducible). Both show similar high substrate specificity for KGSA and different coenzyme specificity; KGSADH-II is NAD+-dependent and KGSADH-III is NADP+-dependent. Also included in this CD is the NADP(+)-dependent aldehyde dehydrogenase from Vibrio harveyi which catalyzes the oxidation of long-chain aliphatic aldehydes to acids.	0
NZ_CP015034.1\|WP_006495051.1\|2522001_2522643_+\|maleylacetoacetate-isomerase	gnl\|CDD\|273527	TIGR01262, Maleylacetoacetate_isomerase, maleylacetoacetate isomerase. Maleylacetoacetate isomerase is an enzyme of tyrosine and phenylalanine catabolism. It requires glutathione and belongs by homology to the zeta family of glutathione S-transferases. The enzyme (EC 5.2.1.2) is described as active also on maleylpyruvate, and the example from a Ralstonia sp. catabolic plasmid is described as a maleylpyruvate isomerase involved in gentisate catabolism. [Energy metabolism, Amino acids and amines].	1.07893e-94

>NZ_CP015034.1|WP_058903005.1|2516074_2517202_+|FAD-binding-oxidoreductase
MSETKTDVVVIGAGIVGAACAHELAQRGLRVLVVDDASGGATGAGMGHLVAMDDNAAELALSHYSIELWRALSGEMPDGCAYRNCGTLWLAADAHEMDLARAKQATLAAHGVAGELIDAAALAQLEPMLRAGLGGALKIPGDAILYAPVTANWLLQRTPRVTVRRERAVAVDGPSVTLASGDVLRAERVVVANGVAARTLLPELPLRPKKGHLLITDRYPGHVSHQLVELGYAASAHASDGTSVAFNVQPRPTGQLLIGSSRQFDTEDAQVEPPVLARMLRRAVGYLPALADLNGIRAWTGFRSASPDGLPLLGEHPARPGVWLAVGHEGLGVTTAPGSARLVAALMAGERPPIEIEPYLPGRFLTASPVAGALT
>NZ_CP015034.1|WP_006484864.1|2515145_2516078_+|4-hydroxyproline-epimerase
MKRIQIIDSHTGGEPTRLVVSGFPSLGDGTMAERRDVLAREHDRYRTACILEPRGSDVLVGALLCDPVAPDAAAGVIFFNNSGYLGMCGHGTIGVVRTLHHMGRIAPGVHRIETPVGTVEATLHDDLSVSVRNVPAYRHAQGVALDVPGYGPVKGDIAWGGNWFFLISDHGQRVAGDNVAALTAYASAVREGLERAGITGANGGEIDHIELFADDPEHDSRSFVLCPGLAYDRSPCGTGTSAKLACLAADGKLAPGAVWRQASVIGSVFHASYERADGGIVPTIRGSAHLSAEATLLIEEDDPFGWGIGS
>NZ_CP015034.1|WP_062885481.1|2513973_2514894_-|dihydrodipicolinate-synthase-family-protein
MSRNAIQWTGVFPAVSTQFKPDFSLDIDATHRVVKNLVNDGVSGLVVCGTVGENTSLSTSEKLQVIEAARDAAGGKIPVIAGIAEFTTEFARNTVREAQRVGVDGVMVMPALVYSAKPHETAAHFRAVATSTDLPVMVYNNPPIYKNDVTPDVLIALQDCENIVCFKDSSGDTRRFIDLRNAVGDRFVLFAGLDDVVVESIAVGAEGWVSGMSNAFPKEGETLFRLAKQKRFDEALALYRWFMPLLHLDARPDLVQCIKLCEELVGRGSAITRPPRLALQGDTLAEVKAIVAKALETRPALPDVGF
>NZ_CP015034.1|WP_062885480.1|2512123_2513749_-|APC-family-permease
MPGQGNAHPSVPLSRSAHPGAGHGKFKKQLSLTDLTFIGLGAIFGSGWLFAASHVSTIAGPAGIFSWLLGGFAVLLLGIVYCELGAALPRAGGVVRYPVFSHGPLLGYLMGFITLIAFSSLIAIEVVAARQYAAARFPGLTVEGSSDPTTLGWLVQAALLCFFFYLNYSSVKTFAKANNIISIFKFIVPLSVIAVLFTFFKPANLTVHGFAPFGMPGIEMAVSAGGIIFAYLGLTPIVSVASEVRNPQRTIPIALILSILLSTLIYVLLQLAFIGSIPTAMLAAGWHDVSKAFSLPYRDIALALGVGWLAVMVVADAMISPSGCGNIYMNATPRVVYGWAKTGTFFKVFTRVDEASGIPRAGLWLTFGLAIFWTLPFPSWEALINIVSAALVLSYAVAPVSVAALRRTAPDLPRPFRASAFGLTGPASFVIAALIVYWSGWSTVSWLLGLQIVMFAIYLACRRWVPTAHLSLAEQVRSSAWLIAFYAAMIVLSYLGGFGGTGRLAHPYDTVVVAAVALVIYYWGANTGVRTDKLQLDDDED
>NZ_CP015034.1|WP_058903003.1|2510460_2512053_-|aldehyde-dehydrogenase-(NADP(+))
MQLTGQLLIGQSAVAGQNGTLHAIAAATGAPLEPAFGGASLHDLETACALADDAFDTYRETSLDARAAFLDAIGRHIMALGDDLIERCVVETELPRARIEGERGRTVGQLALFASLVRDGGFLDARIDPARPERKPLPRVDLRLRNVAVGPVAVFGASNFPLAFSVAGGDTASALAAGCPVIVKAHSAHPGTSELVGRAIQQAARECGMPAGVFSLLFDASREIGQALVADPRIKAVGFTGSRRGGVALMHIAAARPEPIPVYAEMSSINPVLLCPAALDARHDAIAPQFVASLTLGAGQFCTNPGLVLAVDGPALRAFESAAADAVRAVAAQTMLTPPIHASYAQGVAALRDHSAVALLAEGVEGGRHQARAALLATSADAFIAHPELRDEVFGPASLIVRCPDTDTLHRVLKSLEGQLTIAAHIADGDAALFAALRPTLERKAGRILVNGFGTGVEVGHAMVHGGPFPATSDTRTTSVGARAIERFLRPVSYQDVPDALLPEAIRSSNPLHVPQRIDGVPAPREVNHG
>NZ_CP015034.1|WP_006495060.1|2509445_2510468_-|Ldh-family-oxidoreductase
MADHTTEVVLSLDEVHALALRVLTHHGMSDAHARAIANVITQGQRDECHSHGVYRLLVCVRSLKKGKVDPQAVPTLRRLSSSIVAVDAHRGFSLLSFETGLPVLVEMAKQHGIAAMAINHCYHFSALWPEVEAIAAEGLVGIAMNPSHSWVAPEGGREPVFGTNPIAFAWPRPGGEPFVFDFATSAIARGDIELHAKQGKAIPSHWAIDADGQPTTDPKAALQGAMRTFGGHKGSALAAMVELLGGALIGDMTSRESMDFDEGVGATPCHGELVIAFDPKVFLGDELDTGLARGERMFESIVAQGARLPSQRRFDARARSIANGVRIPKPLYDEILTLLD
>NZ_CP015034.1|WP_012493271.1|2507285_2509145_-|dihydroxy-acid-dehydratase
MPTYRSKTSTAGRNMAGARSLWRATGMKDDDFSKPIIAVVNSFTQFVPGHVHLKDLGQLVAREIEAAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSRDIIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPVIFVSGGPMEAGKTRLANPVTKTVELKKLDLVDAMVIAADQSYSDADVAEVERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGTVVATHADREQLFKRAGRRIVELTRQHYEQDDERVLPRSVGFKAFENAMTLDIAMGGSTNTILHLLAIAQEAGIDFTMKDIDRLSRTVPQLCKVAPNTNKYHIEDVHRAGGIMAILGELERAGKLHTDVPTVHAPTLKDALDQWDIVLTQDDAVRTFYLAGPAGIPTQVAFSQNTRWPSLDLDRAEGCIRSYEHAFSKEGGLAVLTGNIALDGCVVKTAGVDESILVFEGSAHVTESQDEAVENILNDKVKAGDVVIVRYEGPKGGPGMQEMLYPTSYIKSKGLGKACALLTDGRFSGGTSGLSIGHCSPEAAAGGAIGLVRDGDRIRIDIPNRTIDVLVSDEELARRREEQNAKGWKPAQPRPRKVSAALKAYAKLVMSADKGAVRDLSLLDD
>NZ_CP015034.1|WP_012493270.1|2506301_2507165_+|peptide-binding-protein
MRNTIVRSLCVVLAGLAAAPGVADAQSSAYTNSPAELFAGPAPDYPVVAQIPPGTALDVFGCLSDYTWCDVALPGVRGWIDAQLLDYPYQGSYVPLLEYGAIIGVPVTGFAIGAYWDRYYRHRPWYPDRDRWAHRAEPRLGPGGMPPAQGRPQPGAPLQVAPGGPPPVHDTRPSATRGGWNGANRVPPPAAPTPAPTPMPGGMGNARPASPAAPTPMPGGAGNARPANPPPAVLHSSPAPGGEGRTMPQPARQGGWGGGGYARPQGGGNGGGNHGGGGGGGPDELRH
>NZ_CP015034.1|WP_062885479.1|2505800_2506268_+|hypothetical-protein
MNPISAARPAVVALAALALGGCYYTSPYGYAPYYAPVPATVTQREIPAAPTAPGPAASTVPQAEVDVGPAVPVYVAPAYVPPPYPYAPYPYAYPAYYSGWYGPPVTIGFWGRWGGGYWGGRGGYWHRPWGGGHWGGGHWGGGHWGGGHWGGGHRH
>NZ_CP015034.1|WP_062885478.1|2503976_2505503_-|sigma-70-family-RNA-polymerase-sigma-factor
MTTPRPTPRADTPLDPIIQLLALAGEQGYLTHADLVDALPPESDSPDALDVVRAALADIGIAVLDEPAVPAPFAGAAPVEVDRDALDEGRAMLGDLARGTSASTDPLALYMRRMHAVPLLTREGEIVLAREIETGRHQVLHAIAGYPPAVDALLERHRATGTTGSPDDDDADAPVPARYDTLQAAASALREAVHAHGTRSAEYRDARNHVAALLGSLAWVAPAVDDASRVVRALAAAPHDPPAGDAACFDAVARRALAAALSDGQQKVRDATRAMLEANLRLVLSIARKYLNRGVDLSDLVQDGCLGLMRAIEKFEYRRGFKFSTYATWWIRQAIARAVADRSRTIRVPVHVGDQYQRVQRHALRFRQRTGRRATPAELAAETGLAEDKLRAVLALPAEPVSLDTPLPDADTGLVELIEDQASASPFEQLADTRMRDCVRSLLRSVTPTEADVLRRRFGLGGAEPDTYDAIAQDAGMSRERVRQIEKRALAALRTAAEAENAQSFLDA
>NZ_CP015034.1|WP_006491351.1|2517484_2517718_+|(2Fe-2S)-binding-protein
MIIHLDGRALTVADGATVAAAVAASGDDMTRVSCTGAARAPFCGMGICQECRMTIDGRRRLACQTLCRDGMQVERTR
>NZ_CP015034.1|WP_062885482.1|2517714_2518983_+|NAD(P)/FAD-dependent-oxidoreductase
MNQERLSVDVAIVGAGPAGLSAARAAARSGATVAIVDDNPRAGGQIWRQPAASAPTPAAAERLAVLRQPNVTHLAATRIVAETQPGTLLLEDDERGLLLDFRTLILCCGARELLLPFPGWTLPGVTGAGGLQALIKYGLDVRGQRTVIAGSGPLLLASAATARQAGARVSHVLEQAAWGDVAGFGAGLWRWPSKLAQAAKLVTAAYRPAAYVVEAFGDQRLERVRIRQGDREFDVDCDRLACGFGLVPNTVLPRHLGCRIEHGAVAVDAHQRTSRDGYFAAGECTGVGGSELAMVEGEIAGYAATGQTARLAARVARRAHWQAFAEAVRERFAIREPIRRLARADTLLCRCEDVRFDAVAREPGWTAAKLQSRCGMGACQGRVCGAAAQALFGWTPPAPRTPLVPARVGTLMLDGTESCDGA
>NZ_CP015034.1|WP_034202471.1|2519029_2519974_-|LysR-family-transcriptional-regulator
MDWTHRLRLRHLQVLLSLAGTGNLSQSAVALATTQPALSKWLKELEEDVGLPLFERHARGLRPTPYGEALIEHARRVEAQLDIARDDMAALREGGSGLVTIGTSGVAAADTVPFAVSQLLKRMPRAQVRLTESTMNQLMPQLARSELDIVVGRSGSTSVDPLLHAEALYVDPVVFVARPDHALAGATSLGWDDVLAYPWIVWPAGTPVHNALEAALHAAGRVQPPHCVESNSSILNLTLLNNTDLLGVASHRAARRFAQLNAIRILPMELEGQGAVSMYWHPDSANRAAVAATIECLRACATPQVGGWEKVKVE
>NZ_CP015034.1|WP_062885483.1|2520137_2521181_+|gentisate-1,2-dioxygenase
MTTHPDATRAAYYARIAEQRLAPLWESLHNLVPTSPQPAAQAAIWKYAQIRDLVMQAGSVISAEEAVRRVLVLENPGLPGKSSMTPSLYAGLQLILPGEIAPSHRHTQSALRFTVEGRGAWTAVNGERTTMHPGDFIITPSWAWHDHGNPSVEDGGEPVVWLDGLDIPLLAHLDAGFAENFPEAVQPVNRPEGDSFARFGHNMVPVRHRVSDPTSPVFSYPYARSREALDALYRNGELDAWDGVKLRYVNPATGGWPMPTIATFMQFLPAGFDGRTYRSTDATIYCVVEGSGAALIGDQTFAFAPHDIFVAPSWAPVRLSASCDSVLFSYSDRPVLSALNLLREARD
>NZ_CP015034.1|WP_006488722.1|2521268_2521967_+|fumarylacetoacetate-hydrolase-family-protein
MTFVFPPEAPVALPVAGSDARFAVRRVYCVGRNYAAHAREMGFDPDREPPFFFCKPADSIVPVAYGETLDLAYPSQTQNYHYEAELVAVIGKGGSDIPLERALDHVWGYAVGLDMTRRDLQMKMREMGRPWEIGKAFDRSAPLGPVHRASDVGHVEQGGLWLTVNGATRQKSDVSHLIWSVAETVADLSKFFRLEPGDVIFTGTPEGVGPVVAGDVMKVGVERLGELTVRVV
>NZ_CP015034.1|WP_006495051.1|2522001_2522643_+|maleylacetoacetate-isomerase
MQLHSFFNSSTSYRVRIALALKGLPYDTLPVNIRTGEHRDADYIAQVNPSAAVPALTDGDFRLGQSLAILDYLDQIQPTPRLIPLEPRRRARVLELAALIACDIHPVNNLRVLRYLDSELKVTPQQKSAWYRHWVAEGMAGVERLLARANAGPWCFGDAPTLADVCLVPQVANALRMDCDLSAYPRCLAVVEHARHEPAFEAAQPQRQPDYVA
>NZ_CP015034.1|WP_058903009.1|2522675_2523884_+|3-hydroxybenzoate-6-monooxygenase
MGETINNGRRVLVIGGGIGGLATALALARQGIRVKLLEQAERIGEIGAGIQLAANAFNALDALGVGEAARGRAVLTDWLQLMDAIDAREVARIDTGAAYRDRFGNPYAVIHRADIHLSIYEAVKDHPLIEFRTSTQVCGFEQDGNGVTVIDQHGERYRADAVIGCDGVKSAIRQALIGDAHRVTGHVVYRAVVEVDNMPKDLQINAPVVWAGPHCHLVHYPLRGGRQYNLVVTFHSREQETWGVRDGSKEEVLSYFDGIHPLPKQMLDRPTSWKRWATADRDPVERWSAGRATVLGDAAHPMTQYIAQGACQALEDAVTLGAAVAQTNGDFEAAFALYERVRIPRTARVLYSAREMGRIYHAKGVERQVRNGLWVGRTDAQFYDALDWLHGWRAEDCLKTAA
>NZ_CP015034.1|WP_062885484.1|2523964_2525326_+|aromatic-acid/H+-symport-family-MFS-transporter
MADTLSIDVSEWVDRHRIAPFQAAIVVLCFLIVAIDGFDTASIGFIAPVIRAEWGLSPARLAPVFGAGLAGLMAGALVFGPFGDRFGRKRLLLACVACFGIASAASASAGSLTELIVWRFVTGLGLGGAMPNAITLTSEYCPARRRSLLVTTMFCGFTIGSALGGLAAASLIEHHGWRAVLVVGGAAPLLLLPLLAWRLPESVRYLVNQGAPSARIATMLGRIAPDPHLAHASFIAPAGKPAGSPLGRLFAADLLRGTLLLWLTFFMSLLVIYLLSSWLPTLLRTTGATLQTAARVTAMFQVGGTLGAIILGWLMDRFDPHRVLACSYAAAGACVAAIGVFAASPWGAALAVFAAGFCVSGSQVGANALSAAFYPTECRTTGVSWANGIGRGGSVVGSMAGGAMLAMGVPLSTAFAVVAAPCVIAAVAVLALGVVRAGVVRAAAADGMAGRQA
>NZ_CP015034.1|WP_062885485.1|2525425_2525776_+|helix-turn-helix-transcriptional-regulator
MNDDLPAGLPAPDQMRAAAESACALLKVMSNPDRLLLLCELSQGECCVSDLEARLDIHQPTLSQQLGVLRDNALVRTRREGKTIRYSLDSPAVVAVMGVLYGQFCGATAKEARDAD
>NZ_CP015034.1|WP_062885486.1|2525765_2526200_+|YeeE/YedE-family-protein
MQIDALHFTPWLSLAGGVLIGLAAAWLVAFNGRIAGISGIVGGLLAAGGAERGWRVAFIAGMIVAPVAMHVAGSSLTPRIDAGWPELLAAGLLVGIGTRYAGGCTSGHGVCGMSRGALRSVVATATFMVAGFATVFVRLHVAGG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

559744 : 621833

Burkholderia_phage(20.0%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_062884928.1\|559744_560698_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_124550714.1\|561076_561310_+	hypothetical protein	NA	NA	NA	NA
WP_006484721.1\|561361_562243_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006498764.1\|562364_562808_+	DMT family transporter	NA	NA	NA	NA
WP_062884929.1\|562862_564368_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_062884930.1\|564401_564932_-	cytochrome C	NA	NA	NA	NA
WP_059721840.1\|564928_565429_-	cytochrome c	NA	NA	NA	NA
WP_006483798.1\|565425_565971_-	amine dehydrogenase	NA	NA	NA	NA
WP_034178328.1\|566010_566637_-	methylamine dehydrogenase accessory protein MauD	NA	NA	NA	NA
WP_062884931.1\|566633_567188_-	methylamine utilization protein MauE	NA	NA	NA	NA
WP_062884932.1\|567195_568353_-	amine dehydrogenase	NA	NA	NA	NA
WP_060263707.1\|568593_569556_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_006483802.1\|569683_570628_+	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_048985100.1\|571119_572832_+	peptidase	NA	NA	NA	NA
WP_058903454.1\|572911_574162_+	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_006491379.1\|574294_574663_+	YbjQ family protein	NA	NA	NA	NA
WP_034201984.1\|574852_576103_-	MFS transporter	NA	NA	NA	NA
WP_006483801.1\|576346_577486_-	porin	NA	NA	NA	NA
WP_059721832.1\|577746_578715_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_006491381.1\|578760_580296_-\|holin	choline-sulfatase	NA	NA	NA	NA
WP_006486273.1\|580533_581439_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006486276.1\|581610_582495_+	formyltetrahydrofolate deformylase	NA	NA	NA	NA
WP_062884227.1\|582573_583794_-\|transposase	ISL3 family transposase	A9YX10	Burkholderia_phage	5.1e-230	94.1
WP_006486278.1\|583982_585638_-	APC family permease	NA	NA	NA	NA
WP_006486270.1\|585816_586680_-	glycine betaine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_006498749.1\|586814_587963_-	hybrid-cluster NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_006486272.1\|587992_589234_-	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_006491387.1\|589286_590072_-	electron transfer flavoprotein subunit beta/FixA family protein	NA	NA	NA	NA
WP_006488991.1\|590068_591238_-	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_034201981.1\|591242_593168_-	(Fe-S)-binding protein	NA	NA	NA	NA
WP_006488987.1\|593171_595235_-	NAD(P)-binding protein	NA	NA	NA	NA
WP_062884933.1\|595303_595837_-	4-vinyl reductase	NA	NA	NA	NA
WP_006488981.1\|595976_596948_-	membrane dipeptidase	NA	NA	NA	NA
WP_006488995.1\|596987_598262_-	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	5.9e-104	54.2
WP_077175816.1\|598618_599734_+	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_112750434.1\|599806_601170_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.7e-78	54.0
WP_062884934.1\|601245_602655_-	hypothetical protein	NA	NA	NA	NA
WP_006498742.1\|602929_604351_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_060263887.1\|604555_605329_+	hypothetical protein	NA	NA	NA	NA
WP_062884935.1\|605492_606380_+	DMT family transporter	NA	NA	NA	NA
WP_006498737.1\|606368_607283_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006488979.1\|607436_608633_-	formaldehyde dehydrogenase, glutathione-independent	A0A2K9L7I1	Tupanvirus	4.9e-12	27.7
WP_006488988.1\|608645_608885_+	hypothetical protein	NA	NA	NA	NA
WP_062884936.1\|608859_610050_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_062884937.1\|610049_611912_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_006482184.1\|611914_612853_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_060263880.1\|612863_614471_-	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_062884938.1\|614467_615751_-	glycosyltransferase	NA	NA	NA	NA
WP_006482692.1\|615768_616338_-	isoprenylcysteine carboxylmethyltransferase family protein	NA	NA	NA	NA
WP_006498732.1\|616405_617308_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_062884939.1\|618029_618614_+	transcriptional regulator BetI	NA	NA	NA	NA
WP_062884940.1\|618646_620116_+	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_062884941.1\|620132_621833_+\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	3.8e-50	29.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP015032

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP015033

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP015034

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection