CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP015038	Burkholderia cenocepacia strain 895 plasmid pBcp895-1, complete sequence	0 crisprs	NA	1
NZ_CP015037	Burkholderia cenocepacia strain 895 chromosome 2, complete sequence	0 crisprs	RT,PD-DExK,cas14j	1
NZ_CP015036	Burkholderia cenocepacia strain 895 chromosome 1, complete sequence	1 crisprs	csa3,cas3,PD-DExK,DinG,RT,DEDDh,WYL	16

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

33230 : 102800

Bacillus_phage(18.75%)

integrase,plate,transposase

attL 72865:72882|attR 105140:105157

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085954470.1\|33230_34047_+\|transposase	IS5-like element ISBcen20 family transposase	NA	NA	NA	NA
WP_062911760.1\|34455_34752_+	H-NS histone family protein	NA	NA	NA	NA
WP_062911761.1\|34993_35197_+	hypothetical protein	NA	NA	NA	NA
WP_011880278.1\|35492_36089_-	plasmid pRiA4b ORF-3 family protein	A0A2H4PDG5	Mycobacterium_phage	2.6e-22	33.0
WP_012213993.1\|37872_38661_+	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	8.8e-34	34.1
WP_011880276.1\|40308_40656_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	7.0e-36	64.5
WP_043291487.1\|40652_41084_-\|transposase	transposase	B6DZU5	Stx2-converting_phage	1.8e-12	36.4
WP_062911763.1\|41397_42936_-\|transposase	IS3-like element ISBmu11 family transposase	A0A1B1P773	Bacillus_phage	4.8e-44	35.2
WP_080467006.1\|42960_43845_+	phosphate ABC transporter substrate-binding protein PstS	M4QHS4	Cyanophage	9.5e-37	34.2
WP_009693048.1\|43938_45270_-	HAMP domain-containing protein	Q8QNA2	Ectocarpus_siliculosus_virus	1.5e-09	32.4
WP_009693049.1\|45266_45929_-	response regulator	W8CYM9	Bacillus_phage	1.6e-25	33.3
WP_080467007.1\|45910_46261_-	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_009693051.1\|46676_46919_+	hypothetical protein	NA	NA	NA	NA
WP_009693052.1\|47232_47538_-	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_060097648.1\|47843_48176_+	PepSY domain-containing protein	NA	NA	NA	NA
WP_060097651.1\|48349_49741_+	TolC family protein	NA	NA	NA	NA
WP_060097655.1\|49745_50840_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_060097657.1\|50836_53905_+	efflux RND transporter permease subunit	S5VL66	Leptospira_phage	2.9e-32	21.3
WP_009693061.1\|53992_54658_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.4e-21	30.3
WP_062911764.1\|54633_56022_+	sensor histidine kinase	Q8QNA2	Ectocarpus_siliculosus_virus	1.1e-07	31.1
WP_012213865.1\|56871_58422_+\|transposase	IS21-like element ISBmu3 family transposase	K4I413	Acidithiobacillus_phage	1.0e-158	55.4
WP_009687279.1\|58437_59187_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	2.4e-81	61.2
WP_080467023.1\|59454_59766_-	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_060097665.1\|60882_61332_-	hypothetical protein	NA	NA	NA	NA
WP_060097661.1\|61366_62149_-	hypothetical protein	NA	NA	NA	NA
WP_012213993.1\|66060_66849_+	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	8.8e-34	34.1
WP_080467024.1\|68277_68526_-	hypothetical protein	NA	NA	NA	NA
WP_080467009.1\|70238_70799_-	hypothetical protein	NA	NA	NA	NA
WP_062911766.1\|70805_75044_-	hypothetical protein	A0A2H4JHK7	uncultured_Caudovirales_phage	1.6e-25	48.4
72865:72882	attL	NA	NA	NA	NA
WP_006482386.1\|75065_75524_-	DUF1795 domain-containing protein	NA	NA	NA	NA
WP_062911767.1\|75589_76033_-	hypothetical protein	NA	NA	NA	NA
WP_062911768.1\|76076_76946_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_062911769.1\|76945_79945_-	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_062911770.1\|80092_81973_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_062911771.1\|82553_83009_+	hypothetical protein	NA	NA	NA	NA
WP_062911772.1\|83262_83511_-	hypothetical protein	NA	NA	NA	NA
WP_062911773.1\|83958_84249_-	hypothetical protein	NA	NA	NA	NA
WP_062911774.1\|84250_84430_-	hypothetical protein	NA	NA	NA	NA
WP_062911775.1\|84939_85833_-	hypothetical protein	NA	NA	NA	NA
WP_080467011.1\|86056_86311_-	hypothetical protein	NA	NA	NA	NA
WP_062911776.1\|86373_86841_-	hypothetical protein	NA	NA	NA	NA
WP_080467012.1\|86958_87918_-	DUF4268 domain-containing protein	NA	NA	NA	NA
WP_062911779.1\|88747_89476_-	hypothetical protein	NA	NA	NA	NA
WP_062911781.1\|90290_91034_-	hypothetical protein	NA	NA	NA	NA
WP_062911782.1\|91065_91323_-	hypothetical protein	NA	NA	NA	NA
WP_062911783.1\|91604_92060_+	hypothetical protein	NA	NA	NA	NA
WP_154817472.1\|92146_92578_-	hypothetical protein	NA	NA	NA	NA
WP_062911785.1\|92888_93089_-	hypothetical protein	NA	NA	NA	NA
WP_062911786.1\|93137_93485_-	hypothetical protein	NA	NA	NA	NA
WP_080467013.1\|94104_95490_-	RES family NAD+ phosphorylase	NA	NA	NA	NA
WP_063822438.1\|95525_96026_-	RES family NAD+ phosphorylase	NA	NA	NA	NA
WP_080467014.1\|96029_96491_-	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_062911788.1\|96651_97539_-	hypothetical protein	NA	NA	NA	NA
WP_062911789.1\|97713_98013_-	hypothetical protein	NA	NA	NA	NA
WP_062911790.1\|98477_98954_+	hypothetical protein	NA	NA	NA	NA
WP_062911791.1\|98997_99852_+	hypothetical protein	NA	NA	NA	NA
WP_154817473.1\|99848_100955_+	hypothetical protein	NA	NA	NA	NA
WP_062911793.1\|100964_102800_+\|integrase	tyrosine-type recombinase/integrase	A0A067ZJC0	Vibrio_phage	3.1e-05	37.5
105140:105157	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP015037

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

826394 : 864047

Burkholderia_phage(91.67%)

head,plate,transposase,terminase,capsid,portal,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034200813.1\|826394_827645_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	6.9e-41	41.7
WP_062911639.1\|828272_828611_-	helix-turn-helix domain-containing protein	A4JWW9	Burkholderia_virus	3.5e-48	88.4
WP_062911640.1\|829000_829879_+	DUF550 domain-containing protein	R4JG80	Burkholderia_phage	8.6e-123	80.6
WP_154817461.1\|829869_830199_-	hypothetical protein	NA	NA	NA	NA
WP_062911643.1\|830406_830586_+	hypothetical protein	R4JEN9	Burkholderia_phage	6.8e-19	88.1
WP_062911644.1\|830582_830813_+	hypothetical protein	R4JJR9	Burkholderia_phage	1.1e-32	88.2
WP_062911645.1\|830809_831715_+	DNA adenine methylase	R4JMC6	Burkholderia_phage	8.0e-156	89.0
WP_062911646.1\|831716_831932_+	hypothetical protein	R4JG87	Burkholderia_phage	4.2e-23	81.7
WP_124634079.1\|832110_833085_+	phosphoadenosine phosphosulfate reductase family protein	Q8W6P3	Burkholderia_virus	9.9e-136	71.9
WP_062911648.1\|833096_834998_+	replication protein	A4JWW0	Burkholderia_virus	6.8e-258	73.1
WP_080289798.1\|834994_835273_+	hypothetical protein	R4JMD0	Burkholderia_phage	1.0e-45	93.5
WP_080466991.1\|835274_835556_+	ogr/Delta-like zinc finger family protein	R4JG92	Burkholderia_phage	1.7e-48	94.6
WP_080466992.1\|835552_835885_+	hypothetical protein	R4JDJ1	Burkholderia_phage	3.9e-52	91.7
WP_062911650.1\|835889_836480_+	hypothetical protein	R4JDJ1	Burkholderia_phage	5.5e-89	92.3
WP_062911651.1\|836476_837262_+	hypothetical protein	R4JEP8	Burkholderia_phage	1.4e-47	75.2
WP_062911652.1\|837258_837666_+	hypothetical protein	E5FFG0	Burkholderia_phage	6.1e-15	54.1
WP_062911653.1\|837876_838266_-	type II toxin-antitoxin system HicB family antitoxin	R4JJS9	Burkholderia_phage	6.6e-67	98.4
WP_015875749.1\|838262_838517_-	type II toxin-antitoxin system HicA family toxin	R4JMD3	Burkholderia_phage	1.6e-42	100.0
WP_062911654.1\|838940_840002_-\|portal	phage portal protein	R4JG97	Burkholderia_phage	3.0e-138	96.4
WP_080466993.1\|840001_841819_-\|terminase	terminase	R4JDJ3	Burkholderia_phage	0.0e+00	91.7
WP_062911655.1\|841973_842840_+\|capsid	phage capsid protein	R4JEQ3	Burkholderia_phage	9.1e-141	88.2
WP_062911656.1\|842885_843923_+\|capsid	phage major capsid protein, P2 family	R4JJT6	Burkholderia_phage	9.4e-185	93.3
WP_063822436.1\|843932_844631_+\|terminase	terminase	R4JMF4	Burkholderia_phage	1.6e-108	93.7
WP_062911658.1\|844727_845228_+\|head	head completion/stabilization protein	R4JGC6	Burkholderia_phage	2.2e-83	94.6
WP_137984761.1\|845227_845482_+	hypothetical protein	A0A1S5NNB0	Burkholderia_phage	2.9e-23	67.1
WP_060336527.1\|845478_845685_+\|tail	phage tail protein	R4JDL4	Burkholderia_phage	1.9e-33	98.5
WP_062911660.1\|845692_846136_+	hypothetical protein	R4JES4	Burkholderia_phage	2.3e-76	98.0
WP_027812680.1\|846123_846528_+	hypothetical protein	R4JJW4	Burkholderia_phage	8.7e-62	93.3
WP_062911661.1\|846563_847013_+	peptidase M15	R4JMG7	Burkholderia_phage	2.0e-75	97.3
WP_062911662.1\|847009_847450_+	hypothetical protein	R4JGE0	Burkholderia_phage	2.5e-54	78.8
WP_062911664.1\|847576_848053_+\|tail	phage tail protein	R4JET5	Burkholderia_phage	9.2e-79	94.3
WP_062911665.1\|848049_848523_+	phage virion morphogenesis protein	R4JJX8	Burkholderia_phage	2.9e-77	96.1
WP_062911666.1\|848656_849373_+\|plate	phage baseplate assembly protein V	R4JMH2	Burkholderia_phage	1.9e-123	94.1
WP_062911667.1\|849372_849747_+\|plate	baseplate assembly protein	R4JGE4	Burkholderia_phage	2.3e-61	96.8
WP_062911668.1\|849743_850652_+\|plate	baseplate assembly protein	R4JDM0	Burkholderia_phage	2.8e-156	95.4
WP_062911669.1\|850641_851187_+\|tail	phage tail protein I	R4JET8	Burkholderia_phage	2.7e-98	97.8
WP_080466994.1\|851189_854549_+\|tail	phage tail protein	A0A1S5NTG6	Burkholderia_phage	0.0e+00	83.7
WP_062911671.1\|854561_854972_+	hypothetical protein	A0A1S5NV54	Burkholderia_phage	1.8e-67	89.0
WP_062911672.1\|855022_855355_+	hypothetical protein	R4JGE6	Burkholderia_phage	1.3e-47	91.8
WP_062911673.1\|855422_856610_+\|tail	phage tail sheath protein	R4JDM4	Burkholderia_phage	2.7e-220	98.5
WP_062911674.1\|856665_857175_+\|tail	phage major tail tube protein	R4JEU1	Burkholderia_phage	5.0e-91	95.3
WP_062911675.1\|857228_857534_+\|tail	phage tail assembly protein	R4JJY8	Burkholderia_phage	2.4e-48	99.0
WP_076882569.1\|857545_857662_+\|tail	GpE family phage tail protein	A0A1S5NR79	Burkholderia_phage	2.7e-08	71.1
WP_062911676.1\|857654_860573_+	hypothetical protein	R4JMH9	Burkholderia_phage	0.0e+00	85.6
WP_062911677.1\|860580_861087_+\|tail	phage tail protein	R4JGF0	Burkholderia_phage	1.8e-85	97.0
WP_062911678.1\|861091_862171_+	phage late control D family protein	R4JDM6	Burkholderia_phage	9.7e-201	98.1
WP_062911679.1\|862208_862541_-	hypothetical protein	R4JGF4	Burkholderia_phage	4.8e-42	74.0
WP_080466995.1\|862649_863468_-	glycosyltransferase family 25 protein	A0A1S5NQ44	Burkholderia_phage	9.2e-103	68.0
WP_062911680.1\|863504_864047_-	hypothetical protein	R4JDM9	Burkholderia_phage	1.1e-91	94.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP015036

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP015036_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015036_1

2819793-2819887

Orphan

Consensus_repeat	Method
AAATCAATTACAGTCGATTACGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015036_1

>merge|NZ_CP015036|1|2819793-2819887|CRISPRCasFinder
AAATCAATTACAGTCGATTACGCGGCGACGAACGTTTTAATTCACACCTGACAACCCGATTCCAGACCGAAAAAATCCATAAAAATCAATTACAG

>NZ_CP015036|1|1|2819793-2819887|CRISPRCasFinder
AAATCAATTACAGTCGATTACGC	GGCGACGAACGTTTTAATTCACACCTGACAACCCGATTCCAGACCGAAA
AAATCCATAAAAATCAATTACAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015036.1\|WP_006481723.1\|2826637_2827324_-\|type-1-glutamine-amidotransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|153235
NZ_CP015036.1\|WP_058903073.1\|2827664_2828693_-\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380665
NZ_CP015036.1\|WP_058903078.1\|2812416_2813646_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|273776
NZ_CP015036.1\|WP_006485654.1\|2819144_2819702_-\|DNA-directed-RNA-polymerase-subunit-beta	unknown	unknown	gnl\|CDD\|372030
NZ_CP015036.1\|WP_006485655.1\|2818066_2818912_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_CP015036.1\|WP_062910753.1\|2822533_2823484_-\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP015036.1\|WP_034202394.1\|2815882_2817367_+\|heavy-metal-sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|273593
NZ_CP015036.1\|WP_006481721.1\|2828880_2830443_+\|glycoside-hydrolase-68-family-protein	unknown	unknown	gnl\|CDD\|367086
NZ_CP015036.1\|WP_085964389.1\|2808220_2809027_+\|Crp/Fnr-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223736
NZ_CP015036.1\|WP_006485651.1\|2825386_2826496_-\|NADH:flavin-oxidoreductase/NADH-oxidase	unknown	unknown	gnl\|CDD\|239242
NZ_CP015036.1\|WP_058903594.1\|2813651_2815157_+\|efflux-transporter-outer-membrane-subunit	unknown	unknown	gnl\|CDD\|273830
NZ_CP015036.1\|WP_048985533.1\|2820742_2821297_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372030
NZ_CP015036.1\|WP_006485660.1\|2824177_2825248_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NZ_CP015036.1\|WP_006485658.1\|2817466_2818054_+\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
NZ_CP015036.1\|WP_034202391.1\|2809212_2812380_+\|efflux-RND-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|223911
NZ_CP015036.1\|WP_058903075.1\|2821700_2822495_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|212491
NZ_CP015036.1\|WP_048985535.1\|2823580_2823955_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|183058
NZ_CP015036.1\|WP_034202390.1\|2806462_2808115_-\|acyl-CoA-synthetase	unknown	unknown	gnl\|CDD\|236169
NZ_CP015036.1\|WP_006485650.1\|2820065_2820620_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372030
NZ_CP015036.1\|WP_006485649.1\|2815190_2815886_+\|heavy-metal-response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|130454

Protein	Function_ID	Function_description	E-value
NZ_CP015036.1\|WP_006481723.1\|2826637_2827324_-\|type-1-glutamine-amidotransferase-domain-containing-protein	gnl\|CDD\|153235	cd03141, GATase1_Hsp31_like, Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein. Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein (EcHsp31). This group includes EcHsp31 and Saccharomyces cerevisiae Ydr533c protein. EcHsp31 has chaperone activity. Ydr533c is upregulated in response to various stress conditions along with the heat shock family. EcHsp31 coordinates a metal ion using a 2-His-1-carboxylate motif present in various ions that use iron as a cofactor such as Carboxypeptidase A. The catalytic triad typical of GATase1 domains is not conserved in this GATase1-like domain. However, in common with a typical GATase1 domain, a reactive Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. For EcHsp31, this Cys together with a different His and, an Asp (rather than a Glu) residue form a different catalytic triad from the typical GATase1 domain. For Ydr533c a catalytic triad forms from the conserved Cys together with a different His and Glu from that of the typical GATase1domain. Ydr533c protein and EcHsp31 are homodimers.	3.46709e-104
NZ_CP015036.1\|WP_058903073.1\|2827664_2828693_-\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|380665	cd20010, PBP1_AglR-like, Ligand-binding domain of DNA transcription repressor specific for alpha-glucosides (AglR) and similar proteins. Ligand-binding domain of DNA transcription repressor specific for alpha-glucosides (AglR) which is a member of the LacI-GalR family of bacterial transcription regulators. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.	1.72409e-97
NZ_CP015036.1\|WP_058903078.1\|2812416_2813646_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|273776	TIGR01730, COG0845:_Membrane-fusion_protein, RND family efflux transporter, MFP subunit. This model represents the MFP (membrane fusion protein) component of the RND family of transporters. RND refers to Resistance, Nodulation, and cell Division. It is, in part, a subfamily of pfam00529 (Pfam release 7.5) but hits substantial numbers of proteins missed by that model. The related HlyD secretion protein, for which pfam00529 is named, is outside the scope of this model. Attributed functions imply outward transport. These functions include nodulation, acriflavin resistance, heavy metal efflux, and multidrug resistance proteins. Most members of this family are found in Gram-negative bacteria. The proposed function of MFP proteins is to bring the inner and outer membranes together and enable transport to the outside of the outer membrane. Note, however, that a few members of this family are found in Gram-positive bacteria, where there is no outer membrane. [Transport and binding proteins, Unknown substrate].	7.45875e-59
NZ_CP015036.1\|WP_006485654.1\|2819144_2819702_-\|DNA-directed-RNA-polymerase-subunit-beta	gnl\|CDD\|372030	pfam12306, PixA, Inclusion body protein. This family of proteins is found in bacteria. Proteins in this family are typically between 173 and 191 amino acids in length. PixA is thought to be specifically produced in Xenorhabdus nematophila. It is an inclusion body protein.	5.10969e-68
NZ_CP015036.1\|WP_006485655.1\|2818066_2818912_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	1.51499e-27
NZ_CP015036.1\|WP_062910753.1\|2822533_2823484_-\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	5.20394e-25
NZ_CP015036.1\|WP_034202394.1\|2815882_2817367_+\|heavy-metal-sensor-histidine-kinase	gnl\|CDD\|273593	TIGR01386, Probable_sensor_protein_PcoS, heavy metal sensor kinase. Members of this family contain a sensor histidine kinase domain (pfam00512) and a domain found in bacterial signal proteins (pfam00672). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc.	5.03261e-107
NZ_CP015036.1\|WP_006481721.1\|2828880_2830443_+\|glycoside-hydrolase-68-family-protein	gnl\|CDD\|367086	pfam02435, Glyco_hydro_68, Levansucrase/Invertase. This Pfam family consists of the glycosyl hydrolase 68 family, including several bacterial levansucrase enzymes, and invertase from zymomonas.	1.40526e-166
NZ_CP015036.1\|WP_085964389.1\|2808220_2809027_+\|Crp/Fnr-family-transcriptional-regulator	gnl\|CDD\|223736	COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms].	1.12263e-23
NZ_CP015036.1\|WP_006485651.1\|2825386_2826496_-\|NADH:flavin-oxidoreductase/NADH-oxidase	gnl\|CDD\|239242	cd02932, OYE_YqiM_FMN, Old yellow enzyme (OYE) YqjM-like FMN binding domain. YqjM is involved in the oxidative stress response of Bacillus subtilis. Like the other OYE members, each monomer of YqjM contains FMN as a non-covalently bound cofactor and uses NADPH as a reducing agent. The YqjM enzyme exists as a homotetramer that is assembled as a dimer of catalytically dependent dimers, while other OYE members exist only as monomers or dimers. Moreover, the protein displays a shared active site architecture where an arginine finger at the COOH terminus of one monomer extends into the active site of the adjacent monomer and is directly involved in substrate recognition. Another remarkable difference in the binding of the ligand in YqjM is represented by the contribution of the NH2-terminal tyrosine instead of a COOH-terminal tyrosine in OYE and its homologs.	0
NZ_CP015036.1\|WP_058903594.1\|2813651_2815157_+\|efflux-transporter-outer-membrane-subunit	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	3.43332e-99
NZ_CP015036.1\|WP_048985533.1\|2820742_2821297_+\|hypothetical-protein	gnl\|CDD\|372030	pfam12306, PixA, Inclusion body protein. This family of proteins is found in bacteria. Proteins in this family are typically between 173 and 191 amino acids in length. PixA is thought to be specifically produced in Xenorhabdus nematophila. It is an inclusion body protein.	8.5758e-62
NZ_CP015036.1\|WP_006485660.1\|2824177_2825248_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	2.78885e-36
NZ_CP015036.1\|WP_006485658.1\|2817466_2818054_+\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	1.68651e-22
NZ_CP015036.1\|WP_034202391.1\|2809212_2812380_+\|efflux-RND-transporter-permease-subunit	gnl\|CDD\|223911	COG0841, AcrB, Cation/multidrug efflux pump [Defense mechanisms].	0
NZ_CP015036.1\|WP_058903075.1\|2821700_2822495_+\|SDR-family-oxidoreductase	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.49555e-56
NZ_CP015036.1\|WP_048985535.1\|2823580_2823955_-\|hypothetical-protein	gnl\|CDD\|183058	PRK11251, PRK11251, osmotically-inducible lipoprotein OsmE.	6.84749e-10
NZ_CP015036.1\|WP_034202390.1\|2806462_2808115_-\|acyl-CoA-synthetase	gnl\|CDD\|236169	PRK08162, PRK08162, acyl-CoA synthetase; Validated.	0
NZ_CP015036.1\|WP_006485650.1\|2820065_2820620_+\|hypothetical-protein	gnl\|CDD\|372030	pfam12306, PixA, Inclusion body protein. This family of proteins is found in bacteria. Proteins in this family are typically between 173 and 191 amino acids in length. PixA is thought to be specifically produced in Xenorhabdus nematophila. It is an inclusion body protein.	2.99694e-65
NZ_CP015036.1\|WP_006485649.1\|2815190_2815886_+\|heavy-metal-response-regulator-transcription-factor	gnl\|CDD\|130454	TIGR01387, Transcriptional_regulatory_protein_PcoR, heavy metal response regulator. Members of this family contain a response regulator receiver domain (pfam00072) and an associated transcriptional regulatory region (pfam00486). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc. Most members encoded by genes adjacent to genes for encoding a member of the heavy metal sensor histidine kinase family (TIGRFAMs:TIGR01386), its partner in the two-component response regulator system. [Regulatory functions, DNA interactions].	4.0045e-95

>NZ_CP015036.1|WP_006485654.1|2819144_2819702_-|DNA-directed-RNA-polymerase-subunit-beta
MATEVTLASSAQDINIIAVIDTEWVKKTYPNPSQDPNKPTGIAHNGQFLICTGARGVKGQGTADLEITAYPGDRVQFTGVSIYDNSDDAVIIYNIPRYQGDEVFNPFVCNTVVRNGAVEPNPDSGSRNGLPPLKKQLTFATFDSSVRKSGTEYFGVCFALYKLVGGQNQELFGYYWWDPKIYVPA
>NZ_CP015036.1|WP_006485655.1|2818066_2818912_-|AraC-family-transcriptional-regulator
MNRTANRSTVPSPFWRDTALPFIEARTVDDGRAICYAKHTHDTLSVGAIVGGTSTYVNGATNAHVGRGVLVIIDPEQVHACNPYGPDAWAYRMVYVDVPWLARLQHSLGHDPNRDFHGFSPKWTDRGDLFAQFGGFYRTLVSPGIDALGKESAAVEFFTALHGALDRELPDRRPGDDNAKLARAADYIAAHCRESVTLDAICAAADLSPSYLIRAFNARYGMTPHAFLIDRRVQYGRTELRRGRPIAEVALDAGFADQAHFQRAFRRIAAATPGQYRSAMR
>NZ_CP015036.1|WP_006485658.1|2817466_2818054_+|LysE-family-translocator
MSMLVSMAAFALASSITPGPVNIVALSAGARHGLGASLRYAAGATLGFVALFLLIGLGLHAALARWPVLTTATQWSGIAFLLYMALRLALDDGRLSADPHVAGPSAASGAAMQWLNPKAWLACVAAMGAYAADGDRAQVWQFAALYLVICFASIACWGYAGASLRHRLANARRMRVFNRLMALLLAGSALFLLDV
>NZ_CP015036.1|WP_034202394.1|2815882_2817367_+|heavy-metal-sensor-histidine-kinase
MKRSIILRLSAMFGIVSLLVFTLVGCGLFVMMERQLFAELRATIDTRAKVAQMIVSHATTAARGRLMQEKLADLEPPDGSTHYQVISDNPAFRFGSPVDGVPLDPPFGAFQRYQLNDSSYAVMTKTITLAGAGERPTLQLVVATSCERTQRMLRRFGWTLAALIATATVITLLLSRAVARFGLAPLDRLSQDAASVSATNRRQRLHTDALPPELRDLATSFNGALERIQQTYARLEAFNADVAHELRTPISILIGQTQVALTSRDRSVDRMRQTLQSNLEEFERLRVIINDMLFLSRSDRGERATDLKDVSLADEVRRMLDFLEIPLDEARLRAELHGDARAAVDPSLFRRAMTNLLINAIQHSAPGATLNVTITRRDTLVEMAVSNPGEPIDPVLRSHVFERFYRLEEARANSKENHGLGLSIVKAVAEMHGGGVFVACSGGVNTFGFSVSTQPCSGGPLRPADVAGAVDSADSANPSGPRDARPAHAPRALH
>NZ_CP015036.1|WP_006485649.1|2815190_2815886_+|heavy-metal-response-regulator-transcription-factor
MKVLIVEDEPKVVEYLKSGLTEEGWVVDTALDGEDGAWKAVEFDYDVVVLDVMLPKLDGFGVLRALRAQKQTPVIMLTARDRVDDRVRGLRGGADDYLTKPFSFLELIERLRALTRRARVQESTLISIGDLRVDLIGRRATRDGTRLDLTAQEFQLLGVLARRSGEVLSKTTIAELVWDVNFDSNANVVETAIKRLRAKLDGPFADKLLHTIRGMGYVLEAREDGDAERRA
>NZ_CP015036.1|WP_058903594.1|2813651_2815157_+|efflux-transporter-outer-membrane-subunit
MRTRVRPVALAAIVAAAVAAGCTVGPDYRRPPVDTPAAWRLDPADQYWQPAAPARAPLDPVWWTAFGDAQLDALEADALRNNQNLKAVAARYDQAKATLASVASAQYPAVGLNASGQRFKISADRPQTNYATRSMSTVQNEIQVGAAVSYELDLFGRVRRSVEAAQASSEQARDDFANARLVLSADLASSYFALRELDTEIDVVKRSIDLQQKALDYVSARHDLGAVSGLDLLQQRAQLDATRTQAQLLIQQRAQVETAIATLVGAPAPEFSLPPRVVPINAPTLPTGMPSDLLQRRPDVASAERAMAAANAQIGVARAAYFPRITLSPDLGWDATRFAGLFTVPALLWSVGGSLSQPLFEGGKLKAGVDFAQAGYVAAQASYRQTVLTAFQEVQNAVTGLSVLAQAAQQASAAVDDARKLVSLAQDRYAGGLTPFIDVLTAQQQLLTSERQAVQIQGQRAALVVFLAKALGGGWDGNAASGPAPSDVASAAPQRGAGVGP
>NZ_CP015036.1|WP_058903078.1|2812416_2813646_+|efflux-RND-transporter-periplasmic-adaptor-subunit
MEEKHHSAVGIQVDEHGMHLPTRASVSRRGRVVLIVIGVLLAAGAARTLIVNGLNRNRLDAVAEQNTRQYVNVVHPVDAATGGKLTLPGTLRGFVEAPIHARASGYVLRWQADIGAHVKQGQTLAELDTPELNQELAQATAQRQQAQAALALAKTSFDRAQQLRQRDAVSQQELDDRQGAFNQGTANLAAADANMRRLTELKGFQRIVAPIDGIVTQRNVDVGDLVNSGNAGRALFTVVQADRLRLYVQVPQAYAQQVKVGQHVSVAQAELPGRTFDGTITRTSEAIDVATRSLQIEITLPNPDGRLLPGAYVQATLPMTPVGRLQVPANTLLFRAEGPTVAAVDANGQVRLKQVTVVRTIGQTLEVDGPITPNDRLVANPSDALANGDRVVVQAPAAQPASAVAGAKS
>NZ_CP015036.1|WP_034202391.1|2809212_2812380_+|efflux-RND-transporter-permease-subunit
MWIVNLALRRPYTFIVMAIMIVLATPLALMRTPVDVLPAINIPVISVIWNYNGFSATEMTNRITSVHERVLTTTVNNIQHVESTSLPGIAVVKVFLQPGANVQTAIAQTVSSAQAIVRQMPQGATPPLVITYSASSIPVIQLGLSSKTLSEQSLADIALNFLRPQLITVPGAQIPFPYGGRTRVVAIDLDPQALLAKGLTPADIVNAVNAQNLVLPTGTAKMGQTEYRIDTNASADTVADINDLPVQTVNGATTYLREVASVRDGFAPQTNVVRQNGQRGVLISILKSGDASTLKVVSDLKALLPKVIPTLPEGLTITPLFDQSVFVNAAVQGVIHEALIAAVLTAMMILLFLGNWRSTLIIAISIPLSIFTSLIALSALGETINIMTLGGLALAVGILVDDATVTIENIERHLHLGTNLHDAILEGAGEIAVPALVSTLCICIVFVPMFFLTGVARFLFVPLAEAVVFAMLASYVLSRTLVPTLAMLLFRPQQAHTGADHSASRFARIHHAFNRAFERLRAWYIVLLSILLVRRRFYALCFLGFCVLSTGLVFMLGRDFFPNADSGNIRLHMRAPTGYRIEETARLADQVERVIRETVPPDELGAIVDNLGLPVSGINLSYSNAGTIGTLDGELLIALKAGHRATGHYVQTLRTLLPQRFPGVEFFFQPSDIITQILNFGQPAAIDVQVLGNDLASNMTIASSLMKKIRQIPGAVDVHVLQRNDEPTLLADMDRTRMQQLNLSAQNVAQNMLISLSGSSQTTPSFWINPRTGVQYPLQIQTPQYNLSSVDDLLGTPISASGRAGAPLQLLGNLVQVRSTVNPAVITHYNIRPAIDVYVSVEGRDLGAVAGEIDRIVSDARATLPRGTALAMRGQIETMRTSYLGLGAGVAMAIVLVYLLIVVNFQSWLDPLIIISAMPAALAGIAWMLFVTGTHLSVPALTGAIMTVGVATANSILVVSFARQRLAAGAPPLTAALEAGATRIRPVLMTALAMIIGMVPMALGLGEGAEQNAPLGRAVIGGLLFATVSTLLFVPLVFGGVHSRLARRRARQAGH
>NZ_CP015036.1|WP_085964389.1|2808220_2809027_+|Crp/Fnr-family-transcriptional-regulator
METTECRSSAARYPYPRKPAPMHDHPDAAAAPADPPPAPGPLPPLATLFGQCAWFRTLAPEHQALVLAQSHVEQCEAGDVIAHRLAPSAYWIGVHQGLLKLAIFNVSGRGCTFSGVPSGGWFGEGSVIKRELRKYEVVAIQRSTVLFVPVDTFHALLDTSLPFTRFVIHQLNNRMGEFIASIQNSRLLDVDARVAQALAQLFNPALYPDTGPSLSISQEELGMLVGVSRQRINQALQQLEKLGALRLAYNQIDVVDLDALARFGMEQL
>NZ_CP015036.1|WP_034202390.1|2806462_2808115_-|acyl-CoA-synthetase
MTQMFEAGLGRRDANYVPLTPIDFLIRAAEVYGERLAIVHGDVRRTWGETCTRAKQLASALAQAGVGRGDTVAALLPNIPAMVEAHFGVPMAGAVLNTINTRLDVSSVLFMLRHGEAKVLIVDTEYAEVAQRAALEVPGLKIVSVADALPADPDRFAGATDYETFVAGGDPDYAWTPPADEWEAIALNYTSGTTGDPKGVVYHHRGAYLAAISNILEWDMPKHAVYLWTLPMFHCNGWCFPWAVAARAGVNVCLRKFDAKTVFDLIRRERITHYCGAPIVQSAIANAPAEFRAGIDHTVHAMVAGAAPAPAVIAKMKEIGFDLLHVYGLTEVYGPATVCAKQSHWDAVSDEERARLNARQGVRYHLEAGATVLDPDTMTPVPADGETLGEIMFRGNICMKGYLKNPKATDEAFHGGWFHTGDLAVLMPDGYIRIKDRKKDIIISGGENISSIEVEDALYRHPAVAVAAVVAMPDPKWGEVPCAFVELREGASATEAEIVAHCRQLLAGFKVPKAVRFGELPKTSTGKIQKFQLRHAVGSDKAIDLAGDKK
>NZ_CP015036.1|WP_006485650.1|2820065_2820620_+|hypothetical-protein
MKVDPNSINLEKAAQSIQILAVIDTNYIKRSHPNPSLNAQNPTSIPSTALFMLNGHAPGVSSSEGNGNLGLKLNVGDKVSLMGTSLADNSGDAALIYHVQQYSGAQVFAPFTAVTIEQAGAASAAETPDLIATSAQSQVFQAFESVAKSAGSEYLATSFALYTRSQNRKSLFGYFFWVWQAAAA
>NZ_CP015036.1|WP_048985533.1|2820742_2821297_+|hypothetical-protein
MTADLGSLTLDPSAQQIDILAVIDTEYIKWRYPHPSRQPELPIAVDHRAVRLLYTGARGGSIGNGPADPVLTLYPGDTVSLRAVSLYGNVDDAVLIYQVSHLFGQQVFNPFSQDFLDVNAVQLNPETRDGLPPVTKPQTFVSIGSKARESGIETLGACFGLYTLERSTQELVGYYWWDWFVTCS
>NZ_CP015036.1|WP_058903075.1|2821700_2822495_+|SDR-family-oxidoreductase
MQIDLKGKTAVVTASTAGIGLAIAEGLARAGAHVVVNGRSDTSVQSALEKLRDTVPGASFDGVAADLSDAAGVARVTQHTPDADILVNNAGIYGLKQFFDIDDAEWEHYFQINVMSGVRLARHYLKGMIERNAGRIVFISSESGLNIPVDMIHYGFTKTAQLSIARGLAKLAAGTNVTVNSVLPGPTMSEGVRAMLKAQADETGRSIDDVAVDFVRTERATSIIQRPALPEEIANLVVYVCSPLASATTGAALRADGGVLDTIA
>NZ_CP015036.1|WP_062910753.1|2822533_2823484_-|IS481-family-transposase
MNTHKNARLTFARRLEMVQEITEFGSSVQQAAADHGVTAPTVRKWLGRYLVGGAPALADASSRPAHSPRSIAPATALLIVELRQQRLLQRQIARQAGVSASTVSRVLARAGLSRLSDLQPREPVQRYEHEAPGDLLHIDIKKLGRIARPGHRVTGNRRDTVDGVGWEYLFVAVDDHARVAFTAMHPDETKRSAVQFLREAVAWYAGFGVRVRRLLTDNGSAFRSHEFARACQELGIRHKFTRAYRPQTNGKAERFIQSALREWAYAWTYQSSAHRIEALASWQHHYNWHRAHSAIGGIAPMARLPASRNNLLTLHS
>NZ_CP015036.1|WP_048985535.1|2823580_2823955_-|hypothetical-protein
MRLISMSRPAATLSLAASCLMLHGCAWFDSWLPFSYSRTPLARAASRHGATRADVVRAAGNPRSVWMVRNGSGVCYNYFIEHGNDHRSYFVVFDKAGVVTQYGFDSCMDADRKGTLQSGKAASR
>NZ_CP015036.1|WP_006485660.1|2824177_2825248_-|AI-2E-family-transporter
MGAHVPSSHDSAARPRAQQIARVALYAALLVLALWVIRDFIPAIAWACVIAIAMWPLLKRFESHRLFRDRPTLIATVITAAISLLVVLPVAVATTQAIAQAHDLREWLHTVQDNGIPLPDVVSRLPYGAAQITEWWQANLGHPLHAATAMHGVNSEKFIAFGRQFGTKLAHVLLEFGFMLVTLFVILRAGHKLSGALLQGARRAFGRNGAELIERMVAAVYGTVTGLVVVGLGEGALLGVAYALAGVPHAALLGLVTAVAAMLPFCAPVVFCGAALWLFVQGATMWAVVVAALGFIVVFVAEHFVRPVLIGGSTRLPFLLVLFGILGGAETFGLIGLFVGPALMTVLTMLWAEWIA
>NZ_CP015036.1|WP_006485651.1|2825386_2826496_-|NADH:flavin-oxidoreductase/NADH-oxidase
MSALFEPFKLKDVTLRNRIAVPPMCQYVAEDGVVNDWHHVHLAGIARGGAGLVIAEATAVSPEGRITPGCAGLWNDVQAEAFAPSVAAIKAAGAVPGIQIAHAGRKASANRPWEGDDHIADGDPRGWQTIAPSAVPFGAHLPKVPREMTHDDIARVQADFVASAQRARDLGFEWLELHFAHGYLGQSFFSVHSNQRTDEYGGSAENRGRFLVDTLAAVRKVWPEHLPLTARLGVIEYDGRDEETLAESIALTQRMKREGLDMLSVSVGFSTPTAQIPWGPAFLAPIAERVRREAGLPVSSAWGIDTPQLANRVVAEQQLDLVMVGRAHLADPHWPYYAAKQLGVERPSWTLPAPYAHWLERYRVADKVA
>NZ_CP015036.1|WP_006481723.1|2826637_2827324_-|type-1-glutamine-amidotransferase-domain-containing-protein
MKILVVLTSHDTLGDTGKKTGFWLEELAAPYYTFKDAGVELTLASPKGGQPPLDPKSSDPTAQTDATRRFDADAAAKAELASTRKLAEVSADDYDALFYPGGHGPLWDLAEDLHSIGLIERALAAGKPVAAVCHAPGVLRHVKNPQTGESVVRGKRATGFTNSEEAAVELTEVVPFLVEDMLKTNGAEFERSADWAPHVVTDGLLITGQNPASSAPAAEALLAKLGHR
>NZ_CP015036.1|WP_058903073.1|2827664_2828693_-|LacI-family-DNA-binding-transcriptional-regulator
MRGMTVKVNLRALSDALGLSRTTVSRALNGYDDVSEATRERVARAAREMGYVADPTARRLATGRADMIGIVYPFGAGDLGDPRFGEVVAGITERLAERNLDFIIASARPNAELDTYRRIVDGKLVDGLIVARTRVDDPRIAYLQGSAFPYVAYGRTQTAGPYAWFDFDNEAGARDAVRRLIGFGHRRIAMISAPLALNFAAQRRAGYLSALREAGIDADPALLVECAFTHDGGLQAARALLARAEPPTALLVDNNIAGGGAFRALVDGGLRLGADMSLIVYDGVPPDLAHPYRVTAVVQPTGHASGRALAELMLRLLDDGVHDHRLEAPAIEAGDTDGPVRG
>NZ_CP015036.1|WP_006481721.1|2828880_2830443_+|glycoside-hydrolase-68-family-protein
MTYFPLFRPVAAKRLLLAGGALAALASVAHAQSGGTGAPVPTPHTQQAYDPEGNFTMRWTRADIRQIVAQSHTAGADRNSLPQALTMPDIPQDFPLINSNVWVWDTWPLADLQANQLSYKGWEVIFSLTADPHAGYTFDDRHVHARIGFFYRRAGIPASQRPANGGWTWGGHLFPDGASARVFGTAPMTNNAEWSGSARLTNGSNVSLYYTATSFNRSAPGGADITPPQAIITRADGHIHADDKHVWFTGFDDHKALLEPDGNYYQTGQQNTYFSFRDPFVFTDPAHPGKTYMVFEGNTGGPRGARTCTDADLGYAPNDPNREDLNAVMNSGAVYQKANVGLAVATNPQLTEWKFLPPILSANCVDDQTERPQIYLKDGKYYLFTISHRTTMAAGVDGPDGVYGFVGNGIRSDFLPLNGGSGLVLGNPTDFSAPAGAPYAQDPNQNPREFQSYSHYVMPGGLVESFIDAIGPRRGGTLAPTVKVNINGTSTAVDRAYGRAGLGGYGDIPANLPATGAGHN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2755050 : 2823484

Burkholderia_phage(55.77%)

head,tail,transposase,plate,integrase

attL 2753722:2753740|attR 2781056:2781074

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2753722:2753740	attL	NA	NA	NA	NA
WP_006485401.1\|2755050_2755422_-	DNA-binding protein	Q6QIE8	Burkholderia_phage	8.5e-64	100.0
WP_062910474.1\|2755418_2755835_-	regulatory protein GemA	Q6QIE7	Burkholderia_phage	8.6e-65	91.9
WP_015985074.1\|2756162_2756435_-	HU family DNA-binding protein	A4JWM7	Burkholderia_virus	1.1e-41	100.0
WP_062910475.1\|2756498_2757116_-	DUF3164 family protein	A4JWM8	Burkholderia_virus	5.3e-111	98.5
WP_080466866.1\|2757239_2757662_-	hypothetical protein	Q6QIE3	Burkholderia_phage	1.8e-73	96.4
WP_062910476.1\|2757697_2758027_-	hypothetical protein	Q6QIE2	Burkholderia_phage	8.4e-55	97.2
WP_143262559.1\|2758028_2759243_-	AAA family ATPase	Q6QIE1	Burkholderia_phage	1.9e-221	98.8
WP_062910477.1\|2759239_2761039_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	Q6QIE0	Burkholderia_phage	0.0e+00	98.3
WP_062910478.1\|2761056_2761998_-	hypothetical protein	Q6QID9	Burkholderia_phage	2.6e-141	86.5
WP_062910479.1\|2762009_2762318_-	helix-turn-helix domain-containing protein	A4JWN4	Burkholderia_virus	5.3e-35	79.4
WP_062910480.1\|2762314_2762794_-	hypothetical protein	Q6QID6	Burkholderia_phage	1.4e-87	98.1
WP_012493768.1\|2762914_2763151_+	hypothetical protein	Q6QID5	Burkholderia_phage	3.6e-36	100.0
WP_006485399.1\|2763199_2763442_-	DNA-binding protein	Q6QID3	Burkholderia_phage	4.4e-37	100.0
WP_012493766.1\|2763569_2763986_+	helix-turn-helix transcriptional regulator	Q6QID2	Burkholderia_phage	7.1e-67	100.0
WP_062910481.1\|2763982_2764756_+	hypothetical protein	Q6QID1	Burkholderia_phage	1.4e-124	88.0
WP_062910482.1\|2764829_2765018_+	hypothetical protein	A4JWP0	Burkholderia_virus	7.2e-27	98.4
WP_062910483.1\|2764998_2765535_+	hypothetical protein	A4JWP1	Burkholderia_virus	5.3e-91	96.1
WP_062911413.1\|2765598_2765823_+	hypothetical protein	A4JWP2	Burkholderia_virus	1.4e-24	81.2
WP_021158467.1\|2765889_2766237_+	phage protein	A4JWP3	Burkholderia_virus	5.2e-47	89.6
WP_062911414.1\|2766239_2766851_+	transglycosylase SLT domain-containing protein	Q6QIC7	Burkholderia_phage	2.6e-110	97.0
WP_062910484.1\|2766847_2767447_+	hypothetical protein	A4JWP5	Burkholderia_virus	4.0e-87	86.8
WP_015985069.1\|2767443_2767782_+	hypothetical protein	A4JWP6	Burkholderia_virus	6.2e-53	100.0
WP_062910485.1\|2767778_2768111_+	hypothetical protein	Q6QIC3	Burkholderia_phage	1.6e-58	99.1
WP_059598248.1\|2768112_2768658_+	DUF3486 family protein	A4JWJ3	Burkholderia_virus	1.5e-88	99.4
WP_062910486.1\|2768654_2770157_+	hypothetical protein	Q6QIC1	Burkholderia_phage	1.3e-291	98.8
WP_062910487.1\|2770153_2771629_+	DUF935 domain-containing protein	Q6QIC0	Burkholderia_phage	4.0e-282	98.4
WP_062910488.1\|2771621_2772458_+\|head	phage head morphogenesis protein	A4JWJ6	Burkholderia_virus	1.1e-162	97.8
WP_062910489.1\|2772454_2772982_+	phage virion morphogenesis protein	Q6QIB8	Burkholderia_phage	2.6e-90	98.3
WP_062910490.1\|2773196_2774315_+	hypothetical protein	Q6QIB7	Burkholderia_phage	1.4e-210	98.7
WP_006485371.1\|2774360_2775284_+	hypothetical protein	A4JWK0	Burkholderia_virus	5.6e-165	95.1
WP_062910491.1\|2775358_2775691_+	DUF2190 family protein	Q6QIB4	Burkholderia_phage	1.1e-51	99.1
WP_006485358.1\|2775692_2776145_+	DUF1320 domain-containing protein	Q6QIB3	Burkholderia_phage	5.5e-81	100.0
WP_062910492.1\|2776144_2776609_+	hypothetical protein	A4JWK3	Burkholderia_virus	6.7e-82	99.4
WP_062910493.1\|2776605_2776851_+	hypothetical protein	A4JWK4	Burkholderia_virus	1.3e-36	97.5
WP_062910494.1\|2776854_2778288_+\|tail	phage tail protein	A4JWK5	Burkholderia_virus	7.2e-268	97.5
WP_021158451.1\|2778290_2778815_+\|tail	phage major tail tube protein	Q6QIA9	Burkholderia_phage	6.1e-92	97.1
WP_062911415.1\|2778939_2779269_+\|tail	phage tail assembly protein	A4JWK7	Burkholderia_virus	8.1e-50	98.2
WP_062910495.1\|2779195_2779399_+	hypothetical protein	Q6QIA7	Burkholderia_phage	6.3e-29	95.5
WP_062911416.1\|2779401_2779644_-	hypothetical protein	A4JWK9	Burkholderia_virus	1.2e-34	97.5
WP_062910496.1\|2779673_2782280_+\|tail	phage tail tape measure protein	A4JWL0	Burkholderia_virus	0.0e+00	97.9
2781056:2781074	attR	NA	NA	NA	NA
WP_062910497.1\|2782288_2783179_+\|tail	phage tail protein	Q6QIA4	Burkholderia_phage	3.7e-105	98.8
WP_080466867.1\|2783178_2783388_+	hypothetical protein	Q6QIA3	Burkholderia_phage	2.8e-32	95.7
WP_062910499.1\|2783375_2784581_+	phage late control D family protein	Q6QIA2	Burkholderia_phage	1.6e-212	97.0
WP_062910500.1\|2784577_2785180_+\|plate	phage baseplate assembly protein V	A4JWL4	Burkholderia_virus	8.3e-101	92.5
WP_062910501.1\|2785233_2785587_+\|plate	baseplate protein	Q6QIA0	Burkholderia_phage	1.5e-62	99.1
WP_062910502.1\|2785583_2786735_+\|plate	baseplate J/gp47 family protein	Q6QI99	Burkholderia_phage	6.9e-197	92.2
WP_062910503.1\|2786727_2787309_+\|tail	phage tail protein I	Q6QI98	Burkholderia_phage	2.7e-96	92.2
WP_062910504.1\|2787308_2789756_+	hypothetical protein	Q6QI97	Burkholderia_phage	1.3e-96	42.8
WP_080466868.1\|2789811_2790507_+	acyltransferase	NA	NA	NA	NA
WP_034202382.1\|2790818_2791310_+	cupin domain-containing protein	NA	NA	NA	NA
WP_058903085.1\|2791418_2792567_-	epoxide hydrolase	NA	NA	NA	NA
WP_058903084.1\|2792645_2793593_-	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_034203351.1\|2793725_2794526_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_062885506.1\|2794507_2795872_-	MFS transporter	NA	NA	NA	NA
WP_034202385.1\|2795966_2797319_-	MFS transporter	NA	NA	NA	NA
WP_006482658.1\|2797505_2798465_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_058903081.1\|2798642_2800298_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_006479115.1\|2801093_2801576_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_006481932.1\|2801860_2802517_+	LysE family translocator	NA	NA	NA	NA
WP_006481934.1\|2802633_2803809_+	voltage-gated potassium channel protein	NA	NA	NA	NA
WP_048985523.1\|2803870_2804302_+	DedA family protein	NA	NA	NA	NA
WP_058903079.1\|2804441_2806427_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.4e-11	34.5
WP_034202390.1\|2806462_2808115_-	acyl-CoA synthetase	A0A2H4PQM9	Staphylococcus_phage	5.4e-33	26.4
WP_085964389.1\|2808220_2809027_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_034202391.1\|2809212_2812380_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	2.7e-57	21.8
WP_058903078.1\|2812416_2813646_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_058903594.1\|2813651_2815157_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_006485649.1\|2815190_2815886_+	heavy metal response regulator transcription factor	W8CYM9	Bacillus_phage	7.0e-35	36.1
WP_034202394.1\|2815882_2817367_+	heavy metal sensor histidine kinase	NA	NA	NA	NA
WP_006485658.1\|2817466_2818054_+	LysE family translocator	NA	NA	NA	NA
WP_006485655.1\|2818066_2818912_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_006485654.1\|2819144_2819702_-	DNA-directed RNA polymerase subunit beta	NA	NA	NA	NA
WP_006485650.1\|2820065_2820620_+	hypothetical protein	NA	NA	NA	NA
WP_048985533.1\|2820742_2821297_+	hypothetical protein	NA	NA	NA	NA
WP_058903075.1\|2821700_2822495_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_062910753.1\|2822533_2823484_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

3343295 : 3368710

uncultured_virus(28.57%)

transposase,integrase

attL 3339753:3339767|attR 3371034:3371048

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3339753:3339767	attL	NA	NA	NA	NA
WP_105819029.1\|3343295_3344533_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	6.4e-156	94.7
WP_012213993.1\|3344881_3345670_-	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	8.8e-34	34.1
WP_011881665.1\|3347557_3348316_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	1.3e-61	49.0
WP_012217371.1\|3348816_3349182_+	hypothetical protein	NA	NA	NA	NA
WP_012217373.1\|3349504_3350764_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.9e-44	45.0
WP_012217374.1\|3350729_3351683_-	three-Cys-motif partner protein TcmP	NA	NA	NA	NA
WP_011881662.1\|3351761_3352619_+	phage Gp37/Gp68 family protein	M4R142	Tetraselmis_viridis_virus	4.9e-62	46.9
WP_011881661.1\|3352649_3353921_+	three-Cys-motif partner protein TcmP	NA	NA	NA	NA
WP_062910753.1\|3354229_3355180_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_154817385.1\|3355252_3355708_+	hypothetical protein	NA	NA	NA	NA
WP_011881659.1\|3356428_3357082_-	hypothetical protein	NA	NA	NA	NA
WP_131754048.1\|3357934_3358192_+	hypothetical protein	NA	NA	NA	NA
WP_011881658.1\|3358854_3359112_-	hypothetical protein	NA	NA	NA	NA
WP_011881657.1\|3359256_3361965_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_011881656.1\|3361972_3362980_+	AAA family ATPase	NA	NA	NA	NA
WP_011881655.1\|3362982_3364299_+	TniQ family protein	NA	NA	NA	NA
WP_044582768.1\|3364408_3364669_+	hypothetical protein	NA	NA	NA	NA
WP_011881653.1\|3364802_3366443_-\|transposase	IS66-like element ISBmu30 family transposase	A0A218MNE7	uncultured_virus	3.9e-60	32.7
WP_011881652.1\|3366533_3366947_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	3.5e-18	40.4
WP_080466871.1\|3367085_3367856_-	hypothetical protein	NA	NA	NA	NA
WP_080466977.1\|3367804_3368038_+	ferredoxin	NA	NA	NA	NA
WP_012467846.1\|3368125_3368710_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
3371034:3371048	attR	NA	NA	NA	NA

DBSCAN-SWA_3

3384087 : 3439645

Stx2-converting_phage(21.43%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105782820.1\|3384087_3385322_-\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	1.1e-102	65.5
WP_011881636.1\|3386569_3387838_+	porin	NA	NA	NA	NA
WP_011881635.1\|3387887_3389084_+	aminopeptidase P family protein	NA	NA	NA	NA
WP_062910543.1\|3389725_3391036_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_131754044.1\|3391672_3391882_+	hypothetical protein	NA	NA	NA	NA
WP_011881633.1\|3392011_3392272_-	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_011881632.1\|3392564_3393644_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_012467839.1\|3393555_3393909_-	UPF0149 family protein	NA	NA	NA	NA
WP_011881631.1\|3394076_3394865_-	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	4.7e-35	35.3
WP_012217387.1\|3396977_3398498_-	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.1e-11	24.8
WP_011881629.1\|3398887_3400222_+	MFS transporter	NA	NA	NA	NA
WP_011881628.1\|3400270_3401263_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011881627.1\|3401296_3402784_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_011881626.1\|3402810_3404625_+	acetolactate synthase	NA	NA	NA	NA
WP_011881625.1\|3405057_3406041_+	nitrate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011881624.1\|3406070_3406883_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_011881623.1\|3406888_3407671_+	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	3.8e-13	28.3
WP_011881622.1\|3407744_3408818_+	porin	NA	NA	NA	NA
WP_105782820.1\|3409396_3410631_-\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	1.1e-102	65.5
WP_043291487.1\|3411030_3411462_+\|transposase	transposase	A0A0P0ZCV4	Stx2-converting_phage	6.5e-07	29.1
WP_011880276.1\|3411458_3411806_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	7.0e-36	64.5
WP_011880277.1\|3411857_3413402_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	8.6e-134	47.3
WP_011880278.1\|3413409_3414006_+	plasmid pRiA4b ORF-3 family protein	NA	NA	NA	NA
WP_080466875.1\|3414238_3414415_+	hypothetical protein	NA	NA	NA	NA
WP_012217373.1\|3415862_3417122_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.9e-44	45.0
WP_011875599.1\|3417960_3419517_+\|transposase	IS21-like element IS408 family transposase	K4I413	Acidithiobacillus_phage	1.4e-160	55.1
WP_006397350.1\|3419533_3420283_+	Insertion sequence IS408 ATP-binding protein	K4HZD4	Acidithiobacillus_phage	4.8e-82	60.7
WP_062911421.1\|3420636_3421821_-	porin	NA	NA	NA	NA
WP_062911422.1\|3422250_3423054_-	amidohydrolase family protein	NA	NA	NA	NA
WP_080466876.1\|3423217_3423670_-	cupin domain-containing protein	NA	NA	NA	NA
WP_012217391.1\|3424121_3424976_-	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	1.9e-45	66.7
WP_134163192.1\|3425064_3425523_-	hypothetical protein	NA	NA	NA	NA
WP_044582753.1\|3425942_3426884_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011881614.1\|3426960_3427371_+	cupin domain-containing protein	NA	NA	NA	NA
WP_011881613.1\|3427638_3427866_+	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_011881612.1\|3427870_3429067_+	MFS transporter	NA	NA	NA	NA
WP_011881611.1\|3429175_3430069_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011881610.1\|3430370_3431501_+	MFS transporter	NA	NA	NA	NA
WP_012217396.1\|3431526_3432576_+	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L339	Tupanvirus	1.1e-71	44.2
WP_011881608.1\|3432625_3433615_+	aldo/keto reductase	NA	NA	NA	NA
WP_011881605.1\|3434910_3435387_-	hemerythrin	NA	NA	NA	NA
WP_011881604.1\|3435687_3437019_+	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_011881603.1\|3437035_3438211_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_011881602.1\|3438385_3439645_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.9e-44	45.0

DBSCAN-SWA_4

3453237 : 3511997

uncultured_Caudovirales_phage(15.79%)

transposase,integrase,tRNA

attL 3442764:3442780|attR 3485118:3485134

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3442764:3442780	attL	NA	NA	NA	NA
WP_062910547.1\|3453237_3454389_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_062911423.1\|3454388_3456068_+	hypothetical protein	NA	NA	NA	NA
WP_080466877.1\|3456064_3457960_+	hypothetical protein	NA	NA	NA	NA
WP_012213993.1\|3458326_3459115_-	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	8.8e-34	34.1
WP_062910549.1\|3462440_3463805_-	hypothetical protein	NA	NA	NA	NA
WP_080466978.1\|3463807_3464770_-	hypothetical protein	NA	NA	NA	NA
WP_105819029.1\|3464689_3465926_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	6.4e-156	94.7
WP_154817386.1\|3465918_3469230_-	AAA family ATPase	NA	NA	NA	NA
WP_105819029.1\|3469301_3470539_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	6.4e-156	94.7
WP_105848424.1\|3470816_3471978_+\|transposase	IS3 family transposase	Q716C2	Shigella_phage	9.5e-85	53.2
WP_080001177.1\|3472051_3473320_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.5e-40	43.9
WP_062910552.1\|3473593_3474298_+	hypothetical protein	Q7M296	Enterobacteria_phage	3.9e-17	30.5
WP_062910553.1\|3474475_3476587_+	AAA family ATPase	NA	NA	NA	NA
WP_062910554.1\|3476583_3478425_+	ATP-dependent helicase	NA	NA	NA	NA
WP_080466879.1\|3478509_3478977_-\|transposase	transposase	U5P4I9	Shigella_phage	8.1e-11	48.1
WP_062910555.1\|3479757_3480798_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	3.4e-94	53.7
WP_060092086.1\|3481038_3482241_+	DUF4102 domain-containing protein	A0A221SAN4	Ralstonia_phage	6.2e-31	28.6
WP_060092088.1\|3482237_3483308_+	DUF1016 domain-containing protein	A0A0U2BZN7	Salmonella_phage	5.6e-23	42.1
WP_062911424.1\|3483316_3484039_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	2.9e-92	71.2
WP_060092090.1\|3484031_3484454_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	3.8e-52	70.7
WP_060092092.1\|3484464_3485544_-	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
3485118:3485134	attR	NA	NA	NA	NA
WP_060092094.1\|3485551_3486046_-	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	2.0e-28	44.8
WP_060092096.1\|3486052_3486394_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_060092098.1\|3486552_3486861_-	hypothetical protein	NA	NA	NA	NA
WP_060092100.1\|3487493_3488324_+	DUF945 domain-containing protein	A0A2C9CYF8	Yersinia_phage	8.1e-46	38.5
WP_060092101.1\|3488402_3490454_+	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
WP_060092103.1\|3490519_3490732_+	hypothetical protein	NA	NA	NA	NA
WP_060092105.1\|3491486_3491801_+	DUF736 domain-containing protein	NA	NA	NA	NA
WP_080466979.1\|3491871_3492165_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_154817453.1\|3492470_3492836_+	DUF2958 domain-containing protein	A0A1W6DX76	Sphingobium_phage	5.7e-20	47.8
WP_060092107.1\|3493180_3493951_+	DUF2285 domain-containing protein	NA	NA	NA	NA
WP_060092109.1\|3494061_3494346_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_060092111.1\|3494372_3495218_+	RepA replication protein	NA	NA	NA	NA
WP_080466881.1\|3495232_3495487_+	hypothetical protein	NA	NA	NA	NA
WP_060092113.1\|3495483_3496122_+	AAA family ATPase	B0ZSI1	Halomonas_phage	4.3e-31	39.6
WP_060092170.1\|3496118_3496403_+	hypothetical protein	NA	NA	NA	NA
WP_060092114.1\|3496399_3496945_+	DUF2840 domain-containing protein	NA	NA	NA	NA
WP_060092115.1\|3496941_3497541_+	peptidase	NA	NA	NA	NA
WP_024100077.1\|3497989_3499993_+	relaxase/mobilization nuclease and DUF3363 domain-containing protein	NA	NA	NA	NA
WP_080381190.1\|3500201_3501224_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_080381189.1\|3501445_3503707_+	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_057055115.1\|3503773_3505450_+	FAD-binding protein	A0A1V0SI18	Klosneuvirus	1.9e-57	32.1
WP_060092117.1\|3505609_3507250_+	long-chain fatty acid--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	3.6e-29	27.8
WP_080466883.1\|3507246_3508986_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_024100072.1\|3509667_3510612_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_024100071.1\|3510608_3510887_+	EexN family lipoprotein	NA	NA	NA	NA
WP_024100070.1\|3511016_3511997_-\|transposase	IS5 family transposase	Q38213	Escherichia_phage	4.1e-97	58.0

DBSCAN-SWA_5

3692995 : 3814756

115

Stx2-converting_phage(23.08%)

transposase,integrase,tRNA,protease

attL 3750343:3750362|attR 3780947:3780966

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006483311.1\|3692995_3694336_+\|tRNA	histidine--tRNA ligase	NA	NA	NA	NA
WP_006478678.1\|3694391_3695021_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_006483316.1\|3695062_3696208_+	outer membrane protein assembly factor BamB	NA	NA	NA	NA
WP_006493685.1\|3696454_3697792_+	ribosome biogenesis GTPase Der	NA	NA	NA	NA
WP_006399927.1\|3697933_3698173_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_011694299.1\|3698230_3699418_+	GTPase HflX	NA	NA	NA	NA
WP_006493684.1\|3699465_3700812_+\|protease	FtsH protease activity modulator HflK	NA	NA	NA	NA
WP_006485903.1\|3700827_3701727_+\|protease	protease modulator HflC	NA	NA	NA	NA
WP_006478685.1\|3701763_3701955_+	DUF2065 domain-containing protein	NA	NA	NA	NA
WP_006496416.1\|3702068_3703217_+	ATP phosphoribosyltransferase regulatory subunit	NA	NA	NA	NA
WP_006496417.1\|3703330_3704677_+	adenylosuccinate synthase	A0A160ER07	Powai_lake_megavirus	3.4e-70	36.1
WP_006485899.1\|3704684_3705281_+	phosphoribosyltransferase	NA	NA	NA	NA
WP_006485906.1\|3705555_3707472_+	potassium transporter Kup	A7J6G4	Paramecium_bursaria_Chlorella_virus	3.7e-78	32.8
WP_062910588.1\|3707582_3709907_-	RNA-binding transcriptional accessory protein	NA	NA	NA	NA
WP_006485898.1\|3710071_3710824_+	hypothetical protein	NA	NA	NA	NA
WP_006478692.1\|3710900_3711116_+	YdcH family protein	NA	NA	NA	NA
WP_006496420.1\|3711171_3713421_+	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	2.8e-77	29.4
WP_006484415.1\|3713543_3714368_-	outer membrane protein assembly factor BamD	NA	NA	NA	NA
WP_034178468.1\|3714409_3715621_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_012492651.1\|3715627_3716467_+	peptidoglycan editing factor PgeF	NA	NA	NA	NA
WP_062910589.1\|3716827_3718693_+	class I poly(R)-hydroxyalkanoic acid synthase	NA	NA	NA	NA
WP_062910590.1\|3718792_3719974_+	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
WP_006491801.1\|3720095_3720836_+	3-ketoacyl-ACP reductase	NA	NA	NA	NA
WP_006485265.1\|3720955_3721522_+	polyhydroxyalkanoate synthesis repressor PhaR	NA	NA	NA	NA
WP_034201652.1\|3721934_3722069_+	hypothetical protein	NA	NA	NA	NA
WP_062910591.1\|3722184_3722718_+	dihydrofolate reductase	NA	NA	NA	NA
WP_062884493.1\|3722802_3723057_-	hypothetical protein	NA	NA	NA	NA
WP_048986472.1\|3723201_3723462_-	transporter suffix domain-containing protein	NA	NA	NA	NA
WP_006497181.1\|3724026_3725388_+	30S ribosomal protein S12 methylthiotransferase RimO	NA	NA	NA	NA
WP_006485268.1\|3725391_3726318_+	sugar kinase	NA	NA	NA	NA
WP_006485258.1\|3726436_3726976_+	hypothetical protein	NA	NA	NA	NA
WP_006485263.1\|3727089_3728271_+	cystathionine beta-lyase	NA	NA	NA	NA
WP_012492650.1\|3728358_3729204_-	phosphoserine phosphatase SerB	NA	NA	NA	NA
WP_006485262.1\|3729370_3730309_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_034201719.1\|3730433_3731450_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_034178470.1\|3731608_3732160_+	hypothetical protein	NA	NA	NA	NA
WP_062910592.1\|3732378_3732852_+	hypothetical protein	NA	NA	NA	NA
WP_006485250.1\|3732889_3733693_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_006497185.1\|3733689_3734391_-	ATP-binding cassette domain-containing protein	A0A1V0SE00	Indivirus	4.0e-06	24.7
WP_062910593.1\|3734543_3736868_+	AsmA family protein	NA	NA	NA	NA
WP_034201722.1\|3736959_3737412_-	lipocalin-like domain-containing protein	NA	NA	NA	NA
WP_062910594.1\|3737580_3739173_+	ABC-F family ATPase	A0A2K9L0W2	Tupanvirus	3.4e-53	26.7
WP_080466980.1\|3739491_3740508_+	DUF4062 domain-containing protein	NA	NA	NA	NA
WP_154817388.1\|3740719_3741217_-	hypothetical protein	NA	NA	NA	NA
WP_080466884.1\|3741419_3741812_+	recombinase family protein	K7PGS7	Enterobacteria_phage	7.7e-07	49.3
WP_043291487.1\|3741708_3742140_+\|transposase	transposase	A0A0P0ZCV4	Stx2-converting_phage	6.5e-07	29.1
WP_011880276.1\|3742136_3742484_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	7.0e-36	64.5
WP_011880277.1\|3742535_3744080_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	8.6e-134	47.3
WP_080466981.1\|3744544_3745093_+	recombinase family protein	A0A219Y9V9	Aeromonas_phage	4.1e-14	43.0
WP_154817390.1\|3745237_3745462_+	transcriptional regulator	NA	NA	NA	NA
WP_154817391.1\|3745551_3745767_+	hypothetical protein	NA	NA	NA	NA
WP_062910598.1\|3746401_3747268_-	AAA family ATPase	U5N3V8	Enterobacteria_phage	3.7e-49	44.1
WP_062910599.1\|3747264_3748521_-\|transposase	IS21 family transposase	U5N3F9	Enterobacteria_phage	8.5e-47	33.0
WP_154817392.1\|3748745_3749021_+	hypothetical protein	NA	NA	NA	NA
WP_012213993.1\|3749328_3750117_-	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	8.8e-34	34.1
3750343:3750362	attL	NA	NA	NA	NA
WP_154817393.1\|3751924_3752209_+	hypothetical protein	NA	NA	NA	NA
WP_062910602.1\|3752224_3752836_+	hypothetical protein	NA	NA	NA	NA
WP_105848424.1\|3752766_3753929_-\|transposase	IS3 family transposase	Q716C2	Shigella_phage	9.5e-85	53.2
WP_062910603.1\|3754059_3754650_+	hypothetical protein	NA	NA	NA	NA
WP_006397350.1\|3754705_3755455_-	Insertion sequence IS408 ATP-binding protein	K4HZD4	Acidithiobacillus_phage	4.8e-82	60.7
WP_011875599.1\|3755471_3757028_-\|transposase	IS21-like element IS408 family transposase	K4I413	Acidithiobacillus_phage	1.4e-160	55.1
WP_062910604.1\|3757310_3758132_+	hypothetical protein	NA	NA	NA	NA
WP_011880278.1\|3758135_3758732_-	plasmid pRiA4b ORF-3 family protein	NA	NA	NA	NA
WP_011880277.1\|3758739_3760284_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	8.6e-134	47.3
WP_011880276.1\|3760335_3760683_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	7.0e-36	64.5
WP_043291487.1\|3760679_3761111_-\|transposase	transposase	A0A0P0ZCV4	Stx2-converting_phage	6.5e-07	29.1
WP_062910605.1\|3761332_3762277_+	hypothetical protein	NA	NA	NA	NA
WP_062910606.1\|3762354_3762759_+	hypothetical protein	NA	NA	NA	NA
WP_062910607.1\|3762755_3763406_+	hypothetical protein	NA	NA	NA	NA
WP_154817394.1\|3763513_3764770_+	hypothetical protein	NA	NA	NA	NA
WP_062910609.1\|3764970_3766002_-\|integrase	site-specific integrase	W6MYA3	Pseudomonas_phage	7.7e-54	41.2
WP_062910610.1\|3766252_3767221_-\|integrase	site-specific integrase	W6MYA3	Pseudomonas_phage	4.1e-49	39.6
WP_058901506.1\|3767621_3768371_+	hypothetical protein	E3SJ86	Synechococcus_phage	9.6e-22	32.0
WP_058901505.1\|3768371_3769370_+	hypothetical protein	NA	NA	NA	NA
WP_058901504.1\|3769371_3770250_+	4Fe-4S cluster-binding domain-containing protein	NA	NA	NA	NA
WP_059723807.1\|3770246_3771314_+	asparagine synthase	NA	NA	NA	NA
WP_062910611.1\|3771321_3772530_+	glycosyltransferase family 1 protein	NA	NA	NA	NA
WP_034201728.1\|3772486_3773176_-	cephalosporin hydroxylase	NA	NA	NA	NA
WP_062910612.1\|3773201_3774167_+	phosphotransferase	NA	NA	NA	NA
WP_006485231.1\|3774163_3774760_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_062911426.1\|3774776_3775289_-	hypothetical protein	NA	NA	NA	NA
WP_006493163.1\|3775579_3776068_+	DUF2501 domain-containing protein	NA	NA	NA	NA
WP_006488152.1\|3776219_3776585_-	hypothetical protein	NA	NA	NA	NA
WP_006488133.1\|3776853_3778290_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_060210674.1\|3778413_3779604_+	nitronate monooxygenase	NA	NA	NA	NA
WP_006488120.1\|3779669_3780308_+	OmpW family protein	NA	NA	NA	NA
WP_154817395.1\|3780368_3782813_-	fimbria/pilus outer membrane usher protein	NA	NA	NA	NA
3780947:3780966	attR	NA	NA	NA	NA
WP_062910614.1\|3782841_3783519_-	fimbria/pilus periplasmic chaperone	NA	NA	NA	NA
WP_006488135.1\|3783633_3784314_-	DUF1120 domain-containing protein	NA	NA	NA	NA
WP_006493160.1\|3784906_3785110_-	DUF1289 domain-containing protein	NA	NA	NA	NA
WP_006497200.1\|3785529_3786624_+	polyamine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_006488129.1\|3786710_3787871_+	polyamine ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	6.0e-23	33.2
WP_006488137.1\|3787867_3788794_+	ABC transporter permease subunit	Q6GZ02	Mycoplasma_phage	4.4e-08	24.3
WP_006488141.1\|3788790_3789612_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_059723798.1\|3789704_3790511_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_062910615.1\|3790529_3792200_-	TIGR01244 family phosphatase	NA	NA	NA	NA
WP_062910616.1\|3792228_3793113_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_006497206.1\|3793366_3794749_+	PAS domain-containing protein	NA	NA	NA	NA
WP_006488126.1\|3794979_3795540_+	DUF2975 domain-containing protein	NA	NA	NA	NA
WP_006488139.1\|3795548_3795773_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_062910617.1\|3795747_3796446_+	hypothetical protein	NA	NA	NA	NA
WP_006497208.1\|3796494_3797523_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_062910618.1\|3797647_3799213_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_006489712.1\|3799215_3802362_-	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_062910619.1\|3802358_3803468_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_006491184.1\|3803657_3804278_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_012492640.1\|3804314_3806084_-	ClcB-like voltage-gated chloride channel protein	NA	NA	NA	NA
WP_034201738.1\|3806151_3807228_-	YeiH family putative sulfate export transporter	NA	NA	NA	NA
WP_006491186.1\|3807340_3808234_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006491175.1\|3808395_3809160_+	TIM barrel protein	NA	NA	NA	NA
WP_006491178.1\|3809188_3810181_+	sugar kinase	NA	NA	NA	NA
WP_006493476.1\|3810296_3811577_+	MFS transporter	NA	NA	NA	NA
WP_062911427.1\|3811581_3812547_+	D-glycerate dehydrogenase	M1I1Q8	Acanthocystis_turfacea_Chlorella_virus	1.4e-17	27.0
WP_006491185.1\|3812868_3813912_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	4.8e-11	24.7
WP_060264951.1\|3813967_3814756_+\|protease	YhfC family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_6

4012663 : 4063612

Burkholderia_virus(24.0%)

head,tRNA,tail,terminase,portal,plate,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034201819.1\|4012663_4013794_-\|tRNA	tRNA 2-selenouridine(34) synthase MnmH	NA	NA	NA	NA
WP_060211538.1\|4013858_4014812_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_062910669.1\|4014974_4016396_+	M20 family metallopeptidase	NA	NA	NA	NA
WP_006495224.1\|4016431_4017718_+	MFS transporter	Q6JIH2	Burkholderia_virus	1.5e-86	43.4
WP_062910670.1\|4017795_4018848_-	NADP(H)-dependent aldo-keto reductase	NA	NA	NA	NA
WP_006484216.1\|4018995_4019433_-	PaaI family thioesterase	NA	NA	NA	NA
WP_059723600.1\|4019620_4020109_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_034201824.1\|4020452_4021076_+	phospholipase D family protein	A0A1B2LRT6	Wolbachia_phage	2.4e-18	35.0
WP_048986581.1\|4021236_4021455_-	hypothetical protein	NA	NA	NA	NA
WP_006495229.1\|4021719_4022691_+	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	2.3e-12	30.2
WP_006484195.1\|4022769_4023243_-	VOC family protein	A0A2K9L1J4	Tupanvirus	2.4e-18	37.6
WP_062910671.1\|4023403_4023637_-	hypothetical protein	NA	NA	NA	NA
WP_006484170.1\|4023640_4023889_-	hypothetical protein	NA	NA	NA	NA
WP_006484174.1\|4023929_4024238_-	hypothetical protein	NA	NA	NA	NA
WP_043204865.1\|4024421_4025165_+	DUF695 domain-containing protein	NA	NA	NA	NA
WP_080466888.1\|4025559_4025910_+	hypothetical protein	NA	NA	NA	NA
WP_062910672.1\|4025938_4026334_-	hypothetical protein	NA	NA	NA	NA
WP_062910673.1\|4026635_4027100_+	hypothetical protein	NA	NA	NA	NA
WP_006495234.1\|4027183_4027699_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_154817398.1\|4028119_4028494_+	hypothetical protein	NA	NA	NA	NA
WP_124492672.1\|4028810_4029164_-	hypothetical protein	NA	NA	NA	NA
WP_062910676.1\|4029182_4029803_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_154817399.1\|4029799_4030285_-	hypothetical protein	NA	NA	NA	NA
WP_062910678.1\|4030340_4030547_-	hypothetical protein	NA	NA	NA	NA
WP_062910679.1\|4030550_4031183_-	hypothetical protein	NA	NA	NA	NA
WP_154817400.1\|4031260_4031965_-	lysozyme	A0A059VA40	Pseudomonas_phage	1.5e-29	42.2
WP_062910681.1\|4032288_4034220_-	hypothetical protein	Q6UKA1	Burkholderia_virus	1.4e-27	26.8
WP_080466889.1\|4034226_4034772_-	DUF4376 domain-containing protein	NA	NA	NA	NA
WP_154817401.1\|4034782_4035706_-	hypothetical protein	NA	NA	NA	NA
WP_080466890.1\|4035715_4036357_-	DUF2313 domain-containing protein	NA	NA	NA	NA
WP_062910683.1\|4036357_4037518_-\|plate	baseplate J/gp47 family protein	A0A2P9JZK6	Alteromonadaceae_phage	2.4e-35	32.4
WP_062910684.1\|4037517_4037958_-	hypothetical protein	A0A2P9JZK5	Alteromonadaceae_phage	3.0e-23	40.0
WP_062910685.1\|4038017_4038641_-\|plate	phage baseplate assembly protein V	NA	NA	NA	NA
WP_062910686.1\|4038637_4039792_-	hypothetical protein	U5P0H6	Shigella_phage	7.5e-34	32.1
WP_080466891.1\|4039788_4041225_-	hypothetical protein	NA	NA	NA	NA
WP_062910688.1\|4041230_4043144_-	lytic transglycosylase domain-containing protein	A0A2H4J9N7	uncultured_Caudovirales_phage	2.9e-22	51.3
WP_154817402.1\|4043279_4043624_-	hypothetical protein	NA	NA	NA	NA
WP_062910690.1\|4043632_4044004_-\|tail	phage tail protein	NA	NA	NA	NA
WP_062910691.1\|4044065_4045550_-\|tail	phage tail protein	Q8W623	Enterobacteria_phage	3.6e-89	42.0
WP_062910692.1\|4045546_4045747_-	DUF2635 domain-containing protein	NA	NA	NA	NA
WP_062910693.1\|4045756_4046320_-	hypothetical protein	NA	NA	NA	NA
WP_062910694.1\|4046316_4046640_-	hypothetical protein	NA	NA	NA	NA
WP_062910695.1\|4046641_4046908_-	hypothetical protein	NA	NA	NA	NA
WP_062910696.1\|4046907_4047978_-\|capsid	major capsid protein	V5Q8G6	Xylella_phage	4.5e-49	32.9
WP_062910697.1\|4048059_4048737_-	DUF3859 domain-containing protein	NA	NA	NA	NA
WP_062910698.1\|4048773_4049388_-	hypothetical protein	NA	NA	NA	NA
WP_062910699.1\|4049408_4050299_-	S49 family peptidase	Q6UYI0	Burkholderia_phage	2.5e-45	41.7
WP_062910700.1\|4050298_4051933_-\|portal	phage portal protein	A0A286MNI7	Klebsiella_phage	1.6e-74	33.9
WP_017918055.1\|4051932_4052181_-\|head,tail	phage head-tail adapter protein	NA	NA	NA	NA
WP_080466892.1\|4052191_4054393_-\|terminase	terminase	V5YTA4	Pseudomonas_phage	9.2e-89	32.8
WP_062910701.1\|4054325_4055003_-	hypothetical protein	NA	NA	NA	NA
WP_062910702.1\|4055118_4055739_-	hypothetical protein	A0A291AUT0	Sinorhizobium_phage	1.1e-07	36.1
WP_062910703.1\|4055947_4056262_-	hypothetical protein	NA	NA	NA	NA
WP_062910704.1\|4056261_4056690_-	hypothetical protein	NA	NA	NA	NA
WP_062910705.1\|4056686_4056947_-	hypothetical protein	Q6V7S5	Burkholderia_virus	3.2e-17	51.2
WP_062910706.1\|4056946_4057186_-	hypothetical protein	A4JX60	Burkholderia_virus	9.5e-16	49.4
WP_062910707.1\|4057182_4057671_-	hypothetical protein	K7ZPX8	Xanthomonas_citri_phage	1.4e-13	34.0
WP_080466893.1\|4057667_4058000_-	hypothetical protein	Q6JIF6	Burkholderia_virus	4.5e-40	81.2
WP_080466894.1\|4058002_4058431_-	DUF1364 family protein	Q3HR02	Burkholderia_phage	3.9e-52	70.1
WP_062910709.1\|4058427_4059012_-	helix-turn-helix transcriptional regulator	Q3HR01	Burkholderia_phage	5.8e-75	72.8
WP_063822409.1\|4059011_4059635_-	DUF1064 domain-containing protein	A4JX56	Burkholderia_virus	8.2e-43	49.3
WP_062910711.1\|4059804_4061070_-	replication protein	A0A1W6JNY0	Morganella_phage	2.0e-11	31.0
WP_154817403.1\|4061071_4061371_-	hypothetical protein	NA	NA	NA	NA
WP_062910713.1\|4061466_4061784_-	hypothetical protein	NA	NA	NA	NA
WP_154817404.1\|4061951_4062248_-	hypothetical protein	NA	NA	NA	NA
WP_062910715.1\|4062249_4062624_-	hypothetical protein	NA	NA	NA	NA
WP_062910716.1\|4062625_4062877_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_080466896.1\|4062949_4063612_+	helix-turn-helix transcriptional regulator	A0A0R6PHL1	Moraxella_phage	4.2e-21	33.3

DBSCAN-SWA_7

4383647 : 4413108

Pseudomonas_phage(18.18%)

tail,transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006492556.1\|4383647_4384916_+\|transposase	IS256-like element ISBcen18 family transposase	A0A218MNI5	uncultured_virus	3.8e-39	42.8
WP_146211671.1\|4386212_4386572_-	hypothetical protein	NA	NA	NA	NA
WP_080465509.1\|4386603_4387095_-	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_080465510.1\|4387132_4388932_-	DUF4150 domain-containing protein	NA	NA	NA	NA
WP_060263189.1\|4388924_4390268_-	DUF2169 domain-containing protein	NA	NA	NA	NA
WP_034200755.1\|4390279_4392391_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	2.0e-64	31.1
WP_062910791.1\|4392530_4394408_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_043205777.1\|4394409_4394982_-	hypothetical protein	NA	NA	NA	NA
WP_012492498.1\|4395006_4395384_-	DUF3592 domain-containing protein	NA	NA	NA	NA
WP_062910792.1\|4396174_4396375_-	hypothetical protein	Q3HQV3	Burkholderia_phage	8.7e-23	70.5
WP_062910793.1\|4396409_4397225_-	patatin-like phospholipase family protein	A0A0H3TN97	Faustovirus	1.8e-10	29.9
WP_062910794.1\|4397224_4397830_-	hypothetical protein	NA	NA	NA	NA
WP_062910795.1\|4397840_4398170_-	hypothetical protein	NA	NA	NA	NA
WP_154817407.1\|4398711_4399482_-	lysozyme	A0A059VA40	Pseudomonas_phage	3.7e-29	43.9
WP_154817408.1\|4399805_4401737_-	hypothetical protein	Q6UKA1	Burkholderia_virus	1.3e-33	30.8
WP_080466905.1\|4401743_4402289_-	DUF4376 domain-containing protein	NA	NA	NA	NA
WP_154817409.1\|4402299_4403223_-	hypothetical protein	NA	NA	NA	NA
WP_080466906.1\|4403232_4403874_-	DUF2313 domain-containing protein	NA	NA	NA	NA
WP_062910683.1\|4403874_4405035_-\|plate	baseplate J/gp47 family protein	A0A2P9JZK6	Alteromonadaceae_phage	2.4e-35	32.4
WP_062910800.1\|4405034_4405475_-	hypothetical protein	A0A2P9JZK5	Alteromonadaceae_phage	1.5e-22	40.0
WP_063822412.1\|4405534_4406158_-\|plate	phage baseplate assembly protein V	NA	NA	NA	NA
WP_062910802.1\|4406154_4407309_-	hypothetical protein	U5P0H6	Shigella_phage	2.6e-34	31.6
WP_080466907.1\|4407305_4408742_-	hypothetical protein	NA	NA	NA	NA
WP_062910804.1\|4408747_4410697_-	hypothetical protein	Q2NP98	Xanthomonas_phage	6.2e-12	23.2
WP_062910805.1\|4410829_4411177_-\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_062910806.1\|4411185_4411560_-	hypothetical protein	NA	NA	NA	NA
WP_062910807.1\|4411623_4413108_-\|tail	phage tail protein	B5TK67	Pseudomonas_phage	2.1e-89	42.0

DBSCAN-SWA_8

4416972 : 4428635

Burkholderia_virus(33.33%)

head,portal,tail,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_062910813.1\|4416972_4417863_-	S49 family peptidase	Q6UYI0	Burkholderia_phage	2.5e-45	45.2
WP_062910814.1\|4417862_4419497_-\|portal	phage portal protein	A0A286MNI7	Klebsiella_phage	7.3e-75	34.1
WP_062910815.1\|4419496_4419745_-\|head,tail	phage head-tail adapter protein	NA	NA	NA	NA
WP_080466908.1\|4419755_4421957_-\|terminase	terminase	V5YTA4	Pseudomonas_phage	3.2e-89	32.8
WP_062910816.1\|4421889_4422567_-	hypothetical protein	NA	NA	NA	NA
WP_062910817.1\|4422683_4423304_-	hypothetical protein	A0A291AUT0	Sinorhizobium_phage	1.1e-07	36.1
WP_154817410.1\|4423500_4423764_-	hypothetical protein	NA	NA	NA	NA
WP_062910819.1\|4423826_4424255_-	hypothetical protein	NA	NA	NA	NA
WP_062910705.1\|4424251_4424512_-	hypothetical protein	Q6V7S5	Burkholderia_virus	3.2e-17	51.2
WP_062910706.1\|4424511_4424751_-	hypothetical protein	A4JX60	Burkholderia_virus	9.5e-16	49.4
WP_062910707.1\|4424747_4425236_-	hypothetical protein	K7ZPX8	Xanthomonas_citri_phage	1.4e-13	34.0
WP_080466909.1\|4425232_4425565_-	hypothetical protein	Q6JIF6	Burkholderia_virus	1.0e-39	80.2
WP_080466894.1\|4425567_4425996_-	DUF1364 family protein	Q3HR02	Burkholderia_phage	3.9e-52	70.1
WP_062910821.1\|4425992_4426577_-	ArsR family transcriptional regulator	Q3HR01	Burkholderia_phage	2.6e-75	73.3
WP_063822413.1\|4426576_4427200_-	DUF1064 domain-containing protein	A4JX56	Burkholderia_virus	1.1e-42	47.8
WP_062910823.1\|4427369_4428635_-	replication protein	A0A1W6JNY0	Morganella_phage	8.9e-12	31.7

DBSCAN-SWA_9

5041287 : 5047854

Enterobacteria_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_062911447.1\|5041287_5042082_-	ABC transporter ATP-binding protein	Q66093	Chlorella_virus	2.1e-06	26.3
WP_062910952.1\|5042087_5042906_-	ABC transporter permease	NA	NA	NA	NA
WP_062910953.1\|5042907_5044323_-	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	2.9e-59	31.2
WP_154817414.1\|5044459_5045359_-	dTDP-4-dehydrorhamnose reductase	I7HXC9	Enterobacteria_phage	4.7e-23	34.2
WP_062910955.1\|5045351_5045903_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	2.5e-51	56.2
WP_062910956.1\|5045887_5046781_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	4.1e-96	58.1
WP_062910957.1\|5046792_5047854_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.1e-87	48.3

DBSCAN-SWA_10

5173953 : 5183003

unidentified_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006484964.1\|5173953_5175504_+	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	9.5e-24	31.3
WP_006476832.1\|5175539_5176082_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_006484932.1\|5176078_5176765_+	deoxynucleoside kinase	A0A0M3UL55	Enterococcus_phage	7.2e-08	26.4
WP_006485002.1\|5176808_5177624_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	1.8e-37	34.2
WP_062911000.1\|5177734_5179657_-	bifunctional anthranilate synthase component I family protein/class IV aminotransferase	S4VT78	Pandoravirus	3.1e-56	37.0
WP_006476837.1\|5179660_5180797_-	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	5.0e-22	26.9
WP_006484920.1\|5181050_5183003_-	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	2.5e-146	50.3

DBSCAN-SWA_11

5458645 : 5520861

Acidithiobacillus_phage(20.0%)

transposase,plate,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006482047.1\|5458645_5459944_+\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_006494405.1\|5460014_5461097_+	peptide chain release factor 1	A0A0S4KWG0	Pseudomonas_phage	6.7e-08	46.6
WP_006482071.1\|5461104_5461947_+	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_006477066.1\|5462014_5462326_+	Grx4 family monothiol glutaredoxin	NA	NA	NA	NA
WP_006482052.1\|5462350_5462947_+	UbiX family flavin prenyltransferase	NA	NA	NA	NA
WP_062911035.1\|5463149_5463941_+	dioxygenase	NA	NA	NA	NA
WP_006482046.1\|5464052_5465651_-	APC family permease	NA	NA	NA	NA
WP_006477070.1\|5466071_5466275_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.4e-20	71.6
WP_006494125.1\|5466376_5467627_-	Hsp70 family protein	NA	NA	NA	NA
WP_006482064.1\|5467816_5468422_-	nitroreductase family protein	NA	NA	NA	NA
WP_012492315.1\|5468577_5469861_-	MFS transporter	NA	NA	NA	NA
WP_006481919.1\|5470080_5470701_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_048991979.1\|5470777_5471350_+	DUF1415 domain-containing protein	NA	NA	NA	NA
WP_034201872.1\|5471410_5472301_-	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_006494412.1\|5472390_5473524_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_034201067.1\|5473661_5473994_-	YegP family protein	NA	NA	NA	NA
WP_062911036.1\|5474147_5474642_-	Water stress and hypersensitive response domain-containing protein	NA	NA	NA	NA
WP_006481916.1\|5475284_5477453_+	peptidase M1	A0A0P0IY26	Acinetobacter_phage	2.2e-50	26.7
WP_006481915.1\|5477575_5478496_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_034201070.1\|5478657_5479635_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_006481917.1\|5479659_5479812_+	DUF1427 family protein	NA	NA	NA	NA
WP_006481924.1\|5479839_5480868_-	transporter	NA	NA	NA	NA
WP_006494415.1\|5481079_5482072_-	hypothetical protein	NA	NA	NA	NA
WP_062911037.1\|5482193_5483039_+	M15 family metallopeptidase	NA	NA	NA	NA
WP_062911038.1\|5483340_5487285_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_006483243.1\|5487281_5488271_+	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_006494417.1\|5488275_5489226_+	OmpA family protein	NA	NA	NA	NA
WP_006484398.1\|5489319_5490441_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_062911039.1\|5490485_5493155_-	type VI secretion system ATPase TssH	A0A223W0B1	Agrobacterium_phage	1.2e-90	32.2
WP_006494420.1\|5493196_5494297_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_048986026.1\|5494260_5496096_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_006477092.1\|5496172_5496658_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_006477093.1\|5496720_5497224_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_062911040.1\|5497294_5498785_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_006484395.1\|5498800_5499316_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_043204524.1\|5499362_5499989_-	hypothetical protein	NA	NA	NA	NA
WP_034178609.1\|5500363_5500975_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_006477098.1\|5501080_5502427_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_006494424.1\|5502423_5503206_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_062911459.1\|5503321_5503657_-	hypothetical protein	NA	NA	NA	NA
WP_048986020.1\|5503738_5504056_-	hypothetical protein	NA	NA	NA	NA
WP_006485337.1\|5504337_5505138_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_006485326.1\|5505247_5505451_-	hypothetical protein	NA	NA	NA	NA
WP_062911041.1\|5506552_5507260_-	hypothetical protein	NA	NA	NA	NA
WP_035973142.1\|5507343_5508108_-	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	7.8e-11	29.3
WP_062911042.1\|5508246_5509164_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006397350.1\|5509784_5510534_-	Insertion sequence IS408 ATP-binding protein	K4HZD4	Acidithiobacillus_phage	4.8e-82	60.7
WP_011875599.1\|5510550_5512107_-\|transposase	IS21-like element IS408 family transposase	K4I413	Acidithiobacillus_phage	1.4e-160	55.1
WP_062911043.1\|5512408_5513197_+	hypothetical protein	A0A097ZIH2	Ralstonia_phage	2.1e-35	44.0
WP_080466926.1\|5513198_5513414_+	DUF4224 domain-containing protein	NA	NA	NA	NA
WP_012213993.1\|5513819_5514608_-	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	8.8e-34	34.1
WP_154817420.1\|5517097_5517733_-	hypothetical protein	NA	NA	NA	NA
WP_063822418.1\|5517791_5518907_-	hypothetical protein	NA	NA	NA	NA
WP_063822419.1\|5518903_5519572_-	hypothetical protein	NA	NA	NA	NA
WP_105848424.1\|5519699_5520861_+\|transposase	IS3 family transposase	Q716C2	Shigella_phage	9.5e-85	53.2

DBSCAN-SWA_12

5695415 : 5807749

102

Burkholderia_phage(62.86%)

tail,transposase,holin,plate,integrase

attL 5745103:5745133|attR 5768001:5768031

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006477367.1\|5695415_5695769_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_006484031.1\|5695871_5697290_-	adenosylhomocysteinase	S4VPF6	Pandoravirus	9.9e-44	30.1
WP_006484033.1\|5697541_5698276_-	RNA polymerase sigma factor FliA	NA	NA	NA	NA
WP_006491878.1\|5698298_5699117_-	flagellar biosynthesis protein FlhG	NA	NA	NA	NA
WP_062911064.1\|5699109_5700909_-	flagellar biosynthesis protein FlhF	NA	NA	NA	NA
WP_006485892.1\|5700905_5703008_-	flagellar biosynthesis protein FlhA	NA	NA	NA	NA
WP_006485884.1\|5703004_5704204_-	flagellar type III secretion system protein FlhB	NA	NA	NA	NA
WP_006485888.1\|5704633_5705131_-	VOC family protein	NA	NA	NA	NA
WP_006497451.1\|5705295_5706534_-	DUF3443 family protein	NA	NA	NA	NA
WP_012492269.1\|5706550_5707054_-	DUF2844 domain-containing protein	NA	NA	NA	NA
WP_006497453.1\|5707313_5708045_-	protein phosphatase CheZ	NA	NA	NA	NA
WP_006485893.1\|5708047_5708443_-	chemotaxis protein CheY	Q56AR1	Bacillus_thuringiensis_phage	6.0e-07	31.9
WP_062911065.1\|5708510_5709602_-	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
WP_006497454.1\|5709598_5710357_-	chemoreceptor glutamine deamidase CheD	NA	NA	NA	NA
WP_006493442.1\|5710353_5711346_-	chemotaxis protein CheR	NA	NA	NA	NA
WP_062911066.1\|5711349_5713308_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.5e-10	45.0
WP_006486165.1\|5713345_5713861_-	chemotaxis protein CheW	NA	NA	NA	NA
WP_062911067.1\|5713908_5716170_-	chemotaxis protein CheA	NA	NA	NA	NA
WP_006482646.1\|5716203_5716581_-	response regulator	NA	NA	NA	NA
WP_006482647.1\|5716605_5717625_-	flagellar motor protein MotB	NA	NA	NA	NA
WP_006482649.1\|5717638_5718499_-	flagellar motor stator protein MotA	NA	NA	NA	NA
WP_006493184.1\|5718679_5719234_-	flagellar transcriptional regulator FlhC	NA	NA	NA	NA
WP_006477348.1\|5719326_5719680_-	flagellar transcriptional regulator FlhD	NA	NA	NA	NA
WP_062911068.1\|5720311_5721376_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_006489320.1\|5721479_5721776_-	H-NS histone family protein	F8TUP5	EBPR_podovirus	1.9e-10	41.1
WP_006489324.1\|5722075_5722819_+	aquaporin Z	A0A1B1ISL4	uncultured_Mediterranean_phage	8.1e-05	50.8
WP_006496246.1\|5722949_5723774_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_062911069.1\|5723935_5724817_-	ATPase	NA	NA	NA	NA
WP_006489711.1\|5724958_5725561_+	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_062911070.1\|5725659_5726895_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_062911071.1\|5727124_5729248_+	TonB-dependent receptor	NA	NA	NA	NA
WP_006401410.1\|5729414_5729627_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_034201118.1\|5730157_5731312_+	flagellin	NA	NA	NA	NA
WP_062911072.1\|5731444_5732953_+	flagellar filament capping protein FliD	NA	NA	NA	NA
WP_034201120.1\|5732978_5733278_+	flagellar protein FliT	NA	NA	NA	NA
WP_062911073.1\|5733534_5735880_+	glycosyltransferase family 41 protein	NA	NA	NA	NA
WP_034201122.1\|5735908_5737054_+	DegT/DnrJ/EryC1/StrS family aminotransferase	A0A2D2W2B8	Stenotrophomonas_phage	2.3e-11	31.1
WP_034201123.1\|5737055_5737754_+	WbqC family protein	NA	NA	NA	NA
WP_062911074.1\|5737750_5738713_+	hypothetical protein	NA	NA	NA	NA
WP_034201125.1\|5738768_5740046_+	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_034201126.1\|5740357_5741050_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_062911075.1\|5743349_5744969_-	TIGR04222 domain-containing membrane protein	NA	NA	NA	NA
5745103:5745133	attL	NA	NA	NA	NA
WP_006484103.1\|5745532_5745739_+\|tail	tail protein	E5E3W5	Burkholderia_phage	5.1e-18	64.7
WP_006484093.1\|5745755_5746100_+	membrane protein	A4JWU2	Burkholderia_virus	5.7e-38	77.9
WP_006484102.1\|5746101_5746368_+\|holin	phage holin family protein	E5E3W3	Burkholderia_phage	6.2e-24	65.5
WP_063822421.1\|5746364_5747222_+	DUF3380 domain-containing protein	A4JWZ0	Burkholderia_virus	2.9e-91	65.8
WP_062911076.1\|5747218_5747659_+	protein lysB	K4NXJ2	Burkholderia_phage	3.2e-17	44.4
WP_058901998.1\|5747775_5748225_+\|tail	phage tail protein	E5E3V9	Burkholderia_phage	1.5e-30	54.2
WP_006484112.1\|5748733_5749420_+\|plate	phage baseplate assembly protein V	K4NXJ5	Burkholderia_phage	2.0e-82	69.2
WP_034201129.1\|5749416_5749779_+\|plate	baseplate assembly protein	K4PAX6	Burkholderia_phage	3.4e-41	69.2
WP_006484106.1\|5749775_5750690_+\|plate	baseplate assembly protein	E5FFH3	Burkholderia_phage	1.5e-117	72.6
WP_006484097.1\|5750682_5751225_+\|tail	phage tail protein I	E5FFH2	Burkholderia_phage	5.2e-70	70.9
WP_006496266.1\|5751231_5753802_+	hypothetical protein	E5E3V2	Burkholderia_phage	6.8e-269	63.9
WP_034201130.1\|5753818_5754508_+\|tail	caudovirales tail fiber assembly protein	E5E3V1	Burkholderia_phage	1.3e-86	81.2
WP_062911077.1\|5754562_5755735_+\|tail	phage tail sheath protein	A4JWS7	Burkholderia_virus	1.3e-185	81.2
WP_077175722.1\|5755769_5756273_+\|tail	phage major tail tube protein	E5E3U9	Burkholderia_phage	2.2e-70	74.3
WP_006484110.1\|5756348_5756720_+\|tail	phage tail assembly protein	K4NXA3	Burkholderia_phage	2.2e-27	65.5
WP_006484104.1\|5756728_5756842_+\|tail	GpE family phage tail protein	A0A089FGX3	Burkholderia_phage	1.1e-09	85.7
WP_062911078.1\|5756857_5759428_+	hypothetical protein	E5E3U6	Burkholderia_phage	2.6e-135	46.8
WP_034201134.1\|5759450_5759882_+\|tail	phage tail protein	K4NXK5	Burkholderia_phage	8.2e-42	67.4
WP_006485451.1\|5759878_5760949_+	phage late control D family protein	K4PAY4	Burkholderia_phage	1.1e-135	70.6
WP_006485449.1\|5761136_5761433_-	hypothetical protein	E5E3U3	Burkholderia_phage	1.6e-12	50.5
WP_077175721.1\|5761750_5762206_-	helix-turn-helix transcriptional regulator	E5E3U2	Burkholderia_phage	3.2e-44	62.9
WP_006485450.1\|5762332_5762548_+	hypothetical protein	E5E3U1	Burkholderia_phage	4.4e-20	80.0
WP_006485448.1\|5762729_5762978_+	ogr/Delta-like zinc finger family protein	K4PAZ0	Burkholderia_phage	3.5e-37	91.5
WP_034201136.1\|5763105_5763363_+	hypothetical protein	A4JWQ9	Burkholderia_virus	2.1e-13	56.0
WP_034201137.1\|5763368_5766161_+	hypothetical protein	E5E3N5	Burkholderia_phage	0.0e+00	91.0
WP_080466928.1\|5766157_5766529_+	hypothetical protein	NA	NA	NA	NA
WP_059721111.1\|5766580_5766853_-	hypothetical protein	NA	NA	NA	NA
WP_006484045.1\|5766855_5767932_+\|integrase	site-specific integrase	A0A1S5NNJ1	Burkholderia_phage	7.2e-164	81.7
WP_006496275.1\|5768313_5769201_+	cytochrome c5 family protein	NA	NA	NA	NA
5768001:5768031	attR	NA	NA	NA	NA
WP_062911079.1\|5769307_5771395_-	AAA family ATPase	A7KV33	Bacillus_phage	4.0e-102	35.7
WP_058902305.1\|5771705_5772413_+	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_006485682.1\|5772686_5773739_+	oxidoreductase	NA	NA	NA	NA
WP_006485676.1\|5773942_5774305_+	hypothetical protein	NA	NA	NA	NA
WP_059721115.1\|5774772_5775891_+	glycine cleavage system aminomethyltransferase GcvT	NA	NA	NA	NA
WP_006485673.1\|5776017_5776398_+	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_006485677.1\|5776456_5779384_+	aminomethyl-transferring glycine dehydrogenase	M4QFZ1	Prochlorococcus_phage	6.2e-258	51.0
WP_062911464.1\|5779535_5780678_+	alginate lyase family protein	NA	NA	NA	NA
WP_006485681.1\|5780708_5782097_+	L-serine ammonia-lyase	NA	NA	NA	NA
WP_058902008.1\|5782163_5782565_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_034201144.1\|5782564_5782801_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_059721116.1\|5783516_5785220_+	thiamine pyrophosphate-binding protein	NA	NA	NA	NA
WP_062884188.1\|5785216_5786314_+	hypothetical protein	NA	NA	NA	NA
WP_006493582.1\|5786408_5787425_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_062884189.1\|5787630_5788179_-	hypothetical protein	NA	NA	NA	NA
WP_006489874.1\|5788355_5789882_-	aldehyde dehydrogenase	NA	NA	NA	NA
WP_034178592.1\|5790203_5790632_+	pyridoxamine 5'-phosphate oxidase	NA	NA	NA	NA
WP_062911080.1\|5790742_5792365_-	MFS transporter	NA	NA	NA	NA
WP_012492249.1\|5792520_5793405_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_034201150.1\|5793397_5794195_-	ethanolamine ammonia-lyase subunit EutC	NA	NA	NA	NA
WP_006489528.1\|5794191_5795589_-	ethanolamine ammonia-lyase subunit EutB	NA	NA	NA	NA
WP_006496293.1\|5795728_5797141_-	ethanolamine permease	NA	NA	NA	NA
WP_034201881.1\|5797330_5798794_-	mechanosensitive ion channel	NA	NA	NA	NA
WP_062911465.1\|5799070_5799952_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_062884192.1\|5800110_5800488_-	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_062911081.1\|5800498_5803009_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.8e-133	45.5
WP_006490878.1\|5803090_5803522_+	Cd(II)/Pb(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_006490876.1\|5803590_5804163_+	PadR family transcriptional regulator	NA	NA	NA	NA
WP_062884194.1\|5804208_5805639_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_006488477.1\|5805654_5806443_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_012493617.1\|5806729_5807749_-\|transposase	IS110-like element ISBcen5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_13

6769334 : 6825032

Bacillus_virus(20.0%)

coat,transposase,integrase,protease

attL 6787015:6787031|attR 6830907:6830923

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006484009.1\|6769334_6769871_-\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_012492815.1\|6770167_6771163_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_006476181.1\|6771368_6772334_+\|transposase	IS110-like element ISBcen8 family transposase	Q75QL1	Wolbachia_phage	1.3e-23	34.2
WP_006492931.1\|6772350_6773160_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_006497169.1\|6773378_6774131_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_062911229.1\|6774254_6777269_-	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
WP_012492813.1\|6777477_6778482_+	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_034201471.1\|6778481_6780452_+	fused uroporphyrinogen-III synthase HemD/membrane protein HemX	NA	NA	NA	NA
WP_062911230.1\|6780454_6781642_+	heme biosynthesis protein HemY	NA	NA	NA	NA
WP_062911231.1\|6781739_6782966_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_006489657.1\|6782962_6783376_-	helix-turn-helix domain-containing protein	C8CHN0	Thermus_virus	9.0e-06	51.8
WP_006489648.1\|6783632_6784937_-	MFS transporter	NA	NA	NA	NA
WP_058901699.1\|6785082_6785841_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_062911232.1\|6785928_6787368_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
6787015:6787031	attL	NA	NA	NA	NA
WP_006489643.1\|6787703_6788231_+	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	6.5e-49	52.0
WP_062911233.1\|6788285_6789137_-	GIY-YIG nuclease family protein	W8W2G4	Invertebrate_iridovirus	1.1e-08	45.8
WP_062911234.1\|6789186_6790221_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_048985781.1\|6790372_6792619_+	glycoside hydrolase family 3 protein	NA	NA	NA	NA
WP_006489664.1\|6792690_6793869_-	N-acetyltransferase	NA	NA	NA	NA
WP_062911235.1\|6793978_6795697_+	NAD+ synthase	A0A2L0UZF5	Agrobacterium_phage	2.3e-87	35.5
WP_006398637.1\|6795780_6796119_+	P-II family nitrogen regulator	NA	NA	NA	NA
WP_006491862.1\|6796264_6797341_-	porin	NA	NA	NA	NA
WP_012492810.1\|6797888_6798815_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006489651.1\|6798949_6799447_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_058901695.1\|6799513_6800293_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.6e-16	31.8
WP_006489646.1\|6800311_6801025_-	ABC transporter permease	NA	NA	NA	NA
WP_006489645.1\|6801021_6801711_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_012492809.1\|6801940_6802723_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_012492808.1\|6803089_6803794_+	pirin family protein	NA	NA	NA	NA
WP_058901693.1\|6803863_6804418_-	periplasmic heavy metal sensor	NA	NA	NA	NA
WP_006493394.1\|6804642_6805368_+	response regulator	W8CYM9	Bacillus_phage	3.8e-31	36.3
WP_058901692.1\|6805351_6806668_+	HAMP domain-containing protein	NA	NA	NA	NA
WP_011545926.1\|6806710_6806977_-	hypothetical protein	NA	NA	NA	NA
WP_062884173.1\|6807553_6808576_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_062911236.1\|6808875_6810633_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_006497149.1\|6810655_6811993_+	nitrate/sulfonate/bicarbonate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.4e-31	38.5
WP_006497148.1\|6812057_6812552_-	hypothetical protein	NA	NA	NA	NA
WP_006497146.1\|6812548_6813100_-	hypothetical protein	NA	NA	NA	NA
WP_006487640.1\|6813388_6813598_+	hypothetical protein	NA	NA	NA	NA
WP_006497145.1\|6813736_6815158_+	alpha,alpha-trehalose-phosphate synthase (UDP-forming)	NA	NA	NA	NA
WP_060267035.1\|6815150_6815744_+	AAA family ATPase	A0A219VHB7	Ochrobactrum_phage	3.0e-26	64.0
WP_006497144.1\|6815785_6817153_-	MFS transporter	NA	NA	NA	NA
WP_062911237.1\|6817338_6817719_-	hypothetical protein	NA	NA	NA	NA
WP_043206388.1\|6817836_6818241_+	hypothetical protein	NA	NA	NA	NA
WP_006478153.1\|6818439_6818766_-	hypothetical protein	NA	NA	NA	NA
WP_006497142.1\|6818909_6819410_+\|protease	serine protease inhibitor ecotin	NA	NA	NA	NA
WP_059721374.1\|6819431_6820055_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_006487647.1\|6820170_6820911_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_006487649.1\|6820964_6821297_-	hypothetical protein	NA	NA	NA	NA
WP_153260051.1\|6821630_6821774_-	hypothetical protein	NA	NA	NA	NA
WP_006497139.1\|6821799_6822354_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_006487637.1\|6822366_6822675_+	hypothetical protein	NA	NA	NA	NA
WP_006487655.1\|6822677_6822974_+	4Fe-4S dicluster domain-containing protein	NA	NA	NA	NA
WP_062911238.1\|6823080_6823797_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_062911239.1\|6824021_6825032_+\|integrase	site-specific integrase	A0A0A0YR56	Pseudomonas_phage	4.0e-71	51.9
6830907:6830923	attR	NA	NA	NA	NA

DBSCAN-SWA_14

6831558 : 6868036

Burkholderia_phage(97.14%)

head,tail,terminase,portal,holin,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_062911247.1\|6831558_6831765_-	hypothetical protein	C7BGF3	Burkholderia_phage	6.9e-23	85.3
WP_062911248.1\|6831894_6832119_-	hypothetical protein	NA	NA	NA	NA
WP_062911249.1\|6832654_6833119_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_154817426.1\|6833333_6833597_-	hypothetical protein	NA	NA	NA	NA
WP_050012102.1\|6833655_6834207_+	hypothetical protein	C7BGG0	Burkholderia_phage	1.7e-47	63.4
WP_062911251.1\|6834233_6835601_+	replicative DNA helicase	C7BGG1	Burkholderia_phage	1.4e-151	60.2
WP_063822423.1\|6835639_6836611_+	helix-turn-helix domain-containing protein	C7BGG2	Burkholderia_phage	2.6e-67	43.6
WP_062911253.1\|6836623_6837022_+	hypothetical protein	C7BGG3	Burkholderia_phage	4.6e-31	49.2
WP_154817427.1\|6837181_6837415_+	hypothetical protein	NA	NA	NA	NA
WP_154817428.1\|6837425_6837659_+	hypothetical protein	NA	NA	NA	NA
WP_080466948.1\|6837854_6838223_+	HNH endonuclease	C7BGG5	Burkholderia_phage	5.1e-61	91.8
WP_062911255.1\|6838418_6838922_+	hypothetical protein	C7BGG6	Burkholderia_phage	1.4e-85	90.4
WP_062911256.1\|6838966_6840631_+\|terminase	terminase large subunit	C7BGG7	Burkholderia_phage	2.5e-288	85.8
WP_062911257.1\|6840627_6841917_+\|portal	phage portal protein	C7BGG8	Burkholderia_phage	3.7e-215	84.6
WP_080466949.1\|6841945_6842698_+	peptidase S14	C7BGG9	Burkholderia_phage	2.2e-111	93.6
WP_062911259.1\|6842766_6844032_+\|capsid	phage major capsid protein	C7BGH0	Burkholderia_phage	2.1e-231	97.1
WP_062911260.1\|6844082_6844667_+	hypothetical protein	C7BGH1	Burkholderia_phage	7.1e-97	92.3
WP_062911261.1\|6844677_6845004_+\|head	phage head closure protein	C7BGH2	Burkholderia_phage	1.4e-54	97.2
WP_062911262.1\|6844996_6845419_+	HK97 gp10 family phage protein	C7BGH3	Burkholderia_phage	2.3e-65	95.0
WP_062911263.1\|6845415_6845760_+	DUF3168 domain-containing protein	Q3HQT5	Burkholderia_phage	3.0e-39	73.7
WP_023477143.1\|6845820_6846285_+	hypothetical protein	Q4FAS7	Burkholderia_phage	1.1e-71	90.9
WP_062911264.1\|6846313_6846781_+\|tail	phage tail protein	C7BGC7	Burkholderia_phage	2.5e-73	89.7
WP_060127033.1\|6846777_6847056_+	DUF4035 domain-containing protein	Q4FAS6	Burkholderia_phage	4.0e-42	95.7
WP_062911265.1\|6847069_6851170_+\|tail	phage tail tape measure protein	C7BGC8	Burkholderia_phage	0.0e+00	96.9
WP_062911266.1\|6851169_6851508_+\|tail	phage tail protein	C7BGC9	Burkholderia_phage	7.0e-57	92.9
WP_154817429.1\|6851516_6852731_+	hypothetical protein	Q3HQU1	Burkholderia_phage	8.2e-55	39.5
WP_062911268.1\|6852733_6853417_+\|tail	phage minor tail protein L	C7BGD1	Burkholderia_phage	1.6e-124	93.8
WP_062911269.1\|6853466_6854219_+	C40 family peptidase	C7BGD2	Burkholderia_phage	1.6e-146	95.6
WP_062911270.1\|6854215_6854779_+\|tail	tail assembly protein	C7BGD3	Burkholderia_phage	2.0e-93	96.8
WP_062911271.1\|6854775_6858681_+	DUF1983 domain-containing protein	C7BGD4	Burkholderia_phage	0.0e+00	96.4
WP_080466950.1\|6858674_6858989_+	hypothetical protein	C7BGD5	Burkholderia_phage	5.5e-48	92.2
WP_059499153.1\|6858988_6859705_+	hypothetical protein	C7BGD6	Burkholderia_phage	2.8e-127	91.6
WP_027808735.1\|6859760_6860045_+\|holin	holin	C7BGD7	Burkholderia_phage	1.0e-40	97.9
WP_062911272.1\|6860047_6860497_+	peptidase M15	C7BGD8	Burkholderia_phage	1.4e-73	95.3
WP_062911273.1\|6860493_6860976_+	DUF2514 family protein	C7BGD9	Burkholderia_phage	2.6e-57	75.0
WP_059499155.1\|6861114_6861906_+	DNA adenine methylase	C7BGE1	Burkholderia_phage	1.0e-154	98.9
WP_062911274.1\|6862008_6862905_+	hypothetical protein	C7BGE2	Burkholderia_phage	1.2e-151	91.9
WP_062911275.1\|6863006_6863432_-	hypothetical protein	NA	NA	NA	NA
WP_062911276.1\|6863490_6863982_-	hypothetical protein	C7BGE3	Burkholderia_phage	1.1e-69	75.9
WP_062911277.1\|6864034_6864739_+	DUF159 family protein	A0A1S5NTJ1	Burkholderia_phage	9.1e-115	82.3
WP_006478164.1\|6865034_6865217_-	rubredoxin	NA	NA	NA	NA
WP_012328968.1\|6865415_6865820_+	DUF4399 domain-containing protein	NA	NA	NA	NA
WP_006487664.1\|6866086_6868036_+	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	6.3e-49	29.1

DBSCAN-SWA_15

6963276 : 6975155

uncultured_Caudovirales_phage(37.5%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_154817430.1\|6963276_6964725_+	hypothetical protein	A0A2H4J165	uncultured_Caudovirales_phage	3.4e-39	29.9
WP_124492126.1\|6964696_6966613_+	hypothetical protein	A0A2H4J9J6	uncultured_Caudovirales_phage	1.9e-21	23.3
WP_011880278.1\|6967013_6967610_-	plasmid pRiA4b ORF-3 family protein	NA	NA	NA	NA
WP_011880277.1\|6967617_6969162_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	8.6e-134	47.3
WP_011880276.1\|6969213_6969561_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	7.0e-36	64.5
WP_043291487.1\|6969557_6969989_-\|transposase	transposase	A0A0P0ZCV4	Stx2-converting_phage	6.5e-07	29.1
WP_154817431.1\|6970091_6970940_+	hypothetical protein	NA	NA	NA	NA
WP_105848424.1\|6970943_6972106_-\|transposase	IS3 family transposase	Q716C2	Shigella_phage	9.5e-85	53.2
WP_154817432.1\|6972193_6972970_+	hypothetical protein	A0A2H4J185	uncultured_Caudovirales_phage	4.0e-23	32.2
WP_080466951.1\|6972966_6973335_+	hypothetical protein	NA	NA	NA	NA
WP_060343153.1\|6973436_6973679_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_060343152.1\|6974039_6974285_+	hypothetical protein	NA	NA	NA	NA
WP_080466952.1\|6974348_6975155_+	hypothetical protein	A0A291L9W7	Bordetella_phage	2.2e-40	39.6

DBSCAN-SWA_16

7214576 : 7224156

Burkholderia_virus(50.0%)

integrase

attL 7207564:7207578|attR 7217915:7217929

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
7207564:7207578	attL	NA	NA	NA	NA
WP_080466958.1\|7214576_7215638_-\|integrase	site-specific integrase	A0A077KGX2	Edwardsiella_phage	6.0e-78	42.1
WP_062911317.1\|7215935_7216223_-	hypothetical protein	Q6J1P7	Burkholderia_virus	9.0e-13	48.3
WP_062911318.1\|7216215_7216395_-	hypothetical protein	NA	NA	NA	NA
WP_062911319.1\|7216397_7218560_-	DNA polymerase I	Q6J1P5	Burkholderia_virus	0.0e+00	75.3
7217915:7217929	attR	NA	NA	NA	NA
WP_062911320.1\|7218566_7218833_-	hypothetical protein	NA	NA	NA	NA
WP_080466959.1\|7218829_7219552_-	HNH endonuclease	NA	NA	NA	NA
WP_154817436.1\|7219548_7219902_-	hypothetical protein	A0A172JFU7	Citrobacter_phage	4.2e-12	37.4
WP_154817437.1\|7220085_7220259_-	hypothetical protein	NA	NA	NA	NA
WP_062911324.1\|7220270_7220861_-	DUF2815 family protein	Q775A5	Bordetella_phage	8.0e-40	49.2
WP_062911325.1\|7220866_7221046_-	hypothetical protein	NA	NA	NA	NA
WP_154817456.1\|7221042_7222395_-	DUF2800 domain-containing protein	Q6J1N8	Burkholderia_virus	1.3e-165	66.8
WP_062911327.1\|7222391_7222952_-	hypothetical protein	Q6J1N6	Burkholderia_virus	1.2e-16	51.0
WP_062911328.1\|7222980_7224156_-	hypothetical protein	A0A0M4REI4	Salmonella_phage	4.0e-22	49.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP015038

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP015037

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP015036

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection