CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP014953	Mycobacteroides abscessus strain FLAC007 chromosome, complete genome	2 crisprs	cas3,csa3,DinG,DEDDh,cas4,WYL	0	1	6	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP014953_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP014953_1

38788-38955

Orphan

Consensus_repeat	Method
CTGAGGCGGAGCACCGTAGCCGCC	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP014953_1

>merge|NZ_CP014953|1|38788-38955|PILER-CR
CCATAGCCGCCACCCTGCTCGTACTCGCCGTAGTTGGGGCGCGGAGGCTCGCCGTAGCCGCCCTGCTGAGGCGGAGCACCGTAGCCGCCACCCTGCTGCGGCGGGGCGGGCGGACGTCCGTAGTCGCCACCGCCCTGCGGTGCCTGAGGCGGAGCACCGTATCCGCCC

>NZ_CP014953|1|1|38788-38955|PILER-CR
CCATAGCCGCCACCCTGCTCGTACTCGCCGTAG	TTGGGGCGCGGAGGCTCGCCGTAGCCGCCCTGCTGAGGCGGAGCAC
CGTAGCCGCCACCCTGCTGCGGCGGGGCGGGCG	GACGTCCGTAGTCGCCACCGCCCTGCGGTGCCTGAGGCGGAGCACCGTATCCGC
CC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP014953.1\|WP_005117577.1\|40885_41518_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|370676
NZ_CP014953.1\|WP_005064443.1\|37646_38111_-\|FHA-domain-containing-protein	unknown	unknown	gnl\|CDD\|224630
NZ_CP014953.1\|WP_005064427.1\|46233_47400_+\|glutathionylspermidine-synthase-family-protein	unknown	unknown	gnl\|CDD\|367631
NZ_CP014953.1\|WP_005064469.1\|28116_28380_-\|cell-division-protein-CrgA	unknown	unknown	gnl\|CDD\|178907
NZ_CP014953.1\|WP_005064444.1\|36144_37650_-\|serine/threonine-protein-phosphatase	unknown	unknown	gnl\|CDD\|223704
NZ_CP014953.1\|WP_005064436.1\|43069_43291_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014953.1\|WP_005064424.1\|47438_47876_+\|DUF350-domain-containing-protein	unknown	unknown	gnl\|CDD\|377187
NZ_CP014953.1\|WP_074336267.1\|43912_44857_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274931
NZ_CP014953.1\|WP_005064431.1\|44856_45297_+\|SdpI-family-protein	unknown	unknown	gnl\|CDD\|379303
NZ_CP014953.1\|WP_005064465.1\|28579_29296_+\|DUF881-domain-containing-protein	unknown	unknown	gnl\|CDD\|377575
NZ_CP014953.1\|WP_005064460.1\|29353_30028_+\|aminodeoxychorismate/anthranilate-synthase-component-II	unknown	unknown	gnl\|CDD\|181107
NZ_CP014953.1\|WP_005064451.1\|30034_31921_-\|Stk1-family-PASTA-domain-containing-Ser/Thr-kinase	unknown	unknown	gnl\|CDD\|270916
NZ_CP014953.1\|WP_078377752.1\|43277_43874_+\|SdpA-family-antimicrobial-peptide-system-protein	unknown	unknown	gnl\|CDD\|375183
NZ_CP014953.1\|WP_016890725.1\|45619_46234_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377691
NZ_CP014953.1\|WP_005064439.1\|42083_42512_+\|SdpI-family-protein	unknown	unknown	gnl\|CDD\|379303
NZ_CP014953.1\|WP_005064421.1\|47891_48962_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014953.1\|WP_005064448.1\|31920_33183_-\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270916
NZ_CP014953.1\|WP_005064447.1\|33179_34694_-\|D,D-transpeptidase-PbpA	unknown	unknown	gnl\|CDD\|223839
NZ_CP014953.1\|WP_153995311.1\|27967_28126_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014953.1\|WP_005117574.1\|34690_36148_-\|FtsW/RodA/SpoVE-family-cell-cycle-protein	unknown	unknown	gnl\|CDD\|223843

Protein	Function_ID	Function_description	E-value
NZ_CP014953.1\|WP_005117577.1\|40885_41518_+\|hypothetical-protein	gnl\|CDD\|370676	pfam09770, PAT1, Topoisomerase II-associated protein PAT1. Members of this family are necessary for accurate chromosome transmission during cell division.	4.79248e-08
NZ_CP014953.1\|WP_005064443.1\|37646_38111_-\|FHA-domain-containing-protein	gnl\|CDD\|224630	COG1716, COG1716, FOG: FHA domain [Signal transduction mechanisms].	1.0405e-25
NZ_CP014953.1\|WP_005064427.1\|46233_47400_+\|glutathionylspermidine-synthase-family-protein	gnl\|CDD\|367631	pfam03738, GSP_synth, Glutathionylspermidine synthase preATP-grasp. This region contains the Glutathionylspermidine synthase enzymatic activity EC:6.3.1.8. This is the C-terminal region in bi-enzymes. Glutathionylspermidine (GSP) synthetases of Trypanosomatidae and Escherichia coli couple hydrolysis of ATP (to ADP and Pi) with formation of an amide bond between spermidine and the glycine carboxylate of glutathione (gamma-Glu-Cys-Gly). In the pathogenic trypanosomatids, this reaction is the penultimate step in the biosynthesis of the antioxidant metabolite, trypanothione (N1,N8-bis-(glutathionyl)spermidine), and is a target for drug design. This region, the pre-ATP grasp region, probably carries the substrate-binding site.	0
NZ_CP014953.1\|WP_005064469.1\|28116_28380_-\|cell-division-protein-CrgA	gnl\|CDD\|178907	PRK00159, PRK00159, putative septation inhibitor protein; Reviewed.	3.44656e-47
NZ_CP014953.1\|WP_005064444.1\|36144_37650_-\|serine/threonine-protein-phosphatase	gnl\|CDD\|223704	COG0631, PTC1, Serine/threonine protein phosphatase [Signal transduction mechanisms].	8.81678e-80
NZ_CP014953.1\|WP_005064431.1\|44856_45297_+\|SdpI-family-protein	gnl\|CDD\|379303	pfam13630, SdpI, SdpI/YfhL protein family. This family of proteins includes the SdpI and YfhL proteins from B. subtilis. The SdpI protein is a multipass integral membrane protein that protects toxin-producing cells from being killed. Killing is mediated by the exported toxic protein SdpC an extracellular protein that induces the synthesis of an immunity protein.	6.86025e-06
NZ_CP014953.1\|WP_074336267.1\|43912_44857_+\|hypothetical-protein	gnl\|CDD\|274931	TIGR04033, conserved_hypothetical_protein, antimicrobial peptide system protein, SdpB family. Members of this protein family resemble SdpB (Sporulation Delaying Protein B), an integral membrane protein associated with production of the cannibalism peptide SdpC in Bacillus subtilis. Similar proteins are found in Myxococcus xanthus.	2.33079e-60
NZ_CP014953.1\|WP_005064424.1\|47438_47876_+\|DUF350-domain-containing-protein	gnl\|CDD\|377187	pfam03994, DUF350, Domain of Unknown Function (DUF350). This domain occurs in a small set of of bacterial proteins. It has two transmembrane regions, and often occurs as tandem repeats. The are no conserved catalytic residues.	1.67943e-06
NZ_CP014953.1\|WP_005064465.1\|28579_29296_+\|DUF881-domain-containing-protein	gnl\|CDD\|377575	pfam05949, DUF881, Bacterial protein of unknown function (DUF881). This family consists of a series of hypothetical bacterial proteins. One of the family members YlxW from Bacillus subtilis is thought to be involved in cell division and sporulation.	4.93408e-50
NZ_CP014953.1\|WP_005064460.1\|29353_30028_+\|aminodeoxychorismate/anthranilate-synthase-component-II	gnl\|CDD\|181107	PRK07765, PRK07765, aminodeoxychorismate/anthranilate synthase component II.	1.16439e-150
NZ_CP014953.1\|WP_005064451.1\|30034_31921_-\|Stk1-family-PASTA-domain-containing-Ser/Thr-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	3.88232e-132
NZ_CP014953.1\|WP_078377752.1\|43277_43874_+\|SdpA-family-antimicrobial-peptide-system-protein	gnl\|CDD\|375183	pfam17418, SdpA, Sporulation delaying protein SdpA. Spore formation by the bacterium Bacillus subtilis is an elaborate developmental process that is triggered by nutrient limitation. Cells that have entered the pathway to sporulate produce and export a killing factor and a signaling protein that act cooperatively to block sister cells from sporulating and to cause them to lyse. The sporulating cells feed on the nutrients thereby released, which allows them to keep growing rather than to complete morphogenesis. Entry into sporulation is governed by the regulatory protein Spo0A (master regulator of sporulation). Upon Spo0A phosphorylation, it represses the expression of abrB, a negative regulator of skfABCEFGH and sdpAB, leading to the transcriptional activation of sdpAB operon. The production of SdpAB is essential for the SDP toxin. SDP is a 42-amino-acid, ribosomally synthesized AMP which contains a disulfide bond between two cysteine residues located at the N-terminus. SDP acts by rapidly collapsing the proton motive force thereby inducing autolysin mediated lysis on neighboring species and non-biofilm producing B. subtilis cells (which do not produce SdpI) to respond by moving away, while autolysis would release nutrients that can be readily used to promote biofilm growth. SdpAB proteins are required to produce SDP from SdpC33-203. This domain family is found in SdpA proteins which are predicted to be a 158-amino-acid proteins suggest to be primarily cytoplasmic.	1.03064e-35
NZ_CP014953.1\|WP_016890725.1\|45619_46234_+\|hypothetical-protein	gnl\|CDD\|377691	pfam06693, DUF1190, Protein of unknown function (DUF1190). This family consists of several hypothetical Enterobacterial proteins of around 212 residues in length and is known as YjfM in Escherichia coli. The function of this family is unknown.	0.000542188
NZ_CP014953.1\|WP_005064439.1\|42083_42512_+\|SdpI-family-protein	gnl\|CDD\|379303	pfam13630, SdpI, SdpI/YfhL protein family. This family of proteins includes the SdpI and YfhL proteins from B. subtilis. The SdpI protein is a multipass integral membrane protein that protects toxin-producing cells from being killed. Killing is mediated by the exported toxic protein SdpC an extracellular protein that induces the synthesis of an immunity protein.	5.98928e-06
NZ_CP014953.1\|WP_005064448.1\|31920_33183_-\|serine/threonine-protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	3.75626e-117
NZ_CP014953.1\|WP_005064447.1\|33179_34694_-\|D,D-transpeptidase-PbpA	gnl\|CDD\|223839	COG0768, FtsI, Cell division protein FtsI/penicillin-binding protein 2 [Cell envelope biogenesis, outer membrane].	1.43631e-92
NZ_CP014953.1\|WP_005117574.1\|34690_36148_-\|FtsW/RodA/SpoVE-family-cell-cycle-protein	gnl\|CDD\|223843	COG0772, FtsW, Bacterial cell division membrane protein [Cell division and chromosome partitioning].	1.1556e-95

>NZ_CP014953.1|WP_005064443.1|37646_38111_-|FHA-domain-containing-protein
MQGLVLQLTRGGFLLLLWVFIWSVLRILRTDIYAPTGQLMANRGLNLRSIRPAKTNRRQMQYLLVTEGALAGTRITLGTQPILIGRADDSTLVLTDDYSSTRHARLSPRGSDWYVEDLGSTNGTYLDREKVTTALRVPQGTPVRIGKTVIELRS
>NZ_CP014953.1|WP_005064444.1|36144_37650_-|serine/threonine-protein-phosphatase
MTLVLRYAARSDRGLVRSNNEDSVYAGARLLALADGMGGHAAGEVASQLVIAALAPLDDDEPGGDLLDALADAVHAGNGAIADHVRAEPELDGMGTTLTAFLFAGKRLGMVHIGDSRAYLMRDGELTQISKDDTFVQTLVDEGRITPEQAHNHPQRSLIMRALTGAPVEPTLIMREAHAGDRYLLCSDGLSDPVSHETIAEALEIPDVSAAADRLIELALRSGGPDNVTVVVADVVELDYGQTRPIVAGAVSTDADTDTPPPNTAAGRAAAIQRALKEPEPAEDESDSETTESENSKPKKRRLRWLIAAVLVVLIALAGLAIARRVVLNNYYVSAHEGNVSIMQGVQGSLLGYRLQRPDLVGCLDSRGDMSLVSYGEAASNLSCKYLKVSDLRPSERQQVETGLPGGTLDEAIGQLRQLSKNALPPCPPPAPKTPPPPAPPTAGRTPTTTSGTPTTTPSKPSPTTSASPGVSTTPTTTSTPAPAPLPAPPQEPGVTCRTVS
>NZ_CP014953.1|WP_005117574.1|34690_36148_-|FtsW/RodA/SpoVE-family-cell-cycle-protein
MTTAPQTAVGPSGRGSGAVSAPPTQSTRRSAELGLLGFAAAITTVALVLVEANLERGLSWDLLGYGFAYLVLFVLAHMAVRRWAPYADPLLLPCVALLNGLGLVMIHRLDLVHSYNDGDADQVGDNNATQQMLWTMVGLIALAAVLATLKDHRVLARYGYTFGIVGCVLLAIPALLPTSMSEQYGAKIWIELPFLSIQPAEAAKILLLIFFAAFLMTKRTLFRTAGRNYLGIELPRPRDLGPLLAIWGISVGVMVFEKDLGASLLFYSSFLIVLYVATARISWVLIGLALFAAGSVIAYFLFGHVRVRVQNWWDPFTDPDGAGYQMVQSLFSFATGGIFGTGLGNGQPGTVPAASTDFIIAAVGEELGLVGLAGVLMLYTIVIIRGFRTALAVRDSFGKLLAVGLSAALAMQLFIVVGGVTKLIPQTGLTTPWMSYGGSSLIANYVLLAILLRISHIARRPLSPHASSSPAAPLAEARTELIDRV
>NZ_CP014953.1|WP_005064447.1|33179_34694_-|D,D-transpeptidase-PbpA
MNTSIRRVSLAVMGLVVLLLANATITQVFTAPGLRADPRNQRILLDEYSRQRGQISASGQLLASSVATDSRFRFLRQYADPEVYAPVTGFYSLNYSSTGLERAEDTMLNGSDPRLFGRRLADFFTGRDPRGGSVVTTIRPDVQQAAYDAMHRGCKDGCRGAVVALEPSTGKILAMVSTPSYDPNLLASQDPEKENASWKRLTEDPAQPMLNRAIAQTYPPGSTFKVITTAAALADGKTVNTEVTASPTIFLPGSNATLENYNRASCGGGDTTSLKEAFARSCNTAFAKLGAEQLKRDKLVKAAQAFGLDRELDSIPLQVATSTVGPMSDDAAVAMSSIGQKDVAMTPLQNAMVAAAVANKGVLMQPHLVDSLKGPDLSNLSTTTPDDIGQAVTPAIANTLTELMIASEQRTAQTGALPGVQIASKTGTAEHGTDPRNTPPHAWYIAFAPAQGTTTDPQATAVTPKVAIAVLVEDGGDRALAATGGSVAAPIGRQVIAAALQGAS
>NZ_CP014953.1|WP_005064448.1|31920_33183_-|serine/threonine-protein-kinase
MTVRVGETLSGRYRLQRLIATGGMGQVWEGTDSRLGRKVAVKVLKAEFSSDPEFIERFRAEARTVAMLNHPGIASVYDYGETDIDSEGRTAYLVMELIHGEPLNSVLKRTGRLSLRHSLDMLEQTGRALQVAHAAGLVHRDVKPGNILITPTGQVKLTDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDATPASDVYSLGVVGYEAVSGKRPFSGDGALTVAMKHIKETPSPLPADLPPNVRELIEITLVKNPQNRYTSGGPFADAVAAVRAGRRPPRPNQAPTISRATPAAIPPATQVRPAVGAPSRVAPPTSRTRQPTGSHRPPPPRRGTFSPGQKALMWAAAVLGIFAIIIAALILLQASEKKNQTPSIPATVSGSETPSSPGSASPGALAPANIVALLPDAEPDPIPGTKSP
>NZ_CP014953.1|WP_005064451.1|30034_31921_-|Stk1-family-PASTA-domain-containing-Ser/Thr-kinase
MTTPQHLSDRYELGEILGYGGMSEVHLARDLRLNRDVAIKVLRADLARDPSFYLRFRREAQNAAALNHPAIVAVYDTGEAETATGPLPYIVMEYVDGITLRDIVKDDGPMPIRRAIEVIADSCQALNFSHQHGIIHRDVKPANIMISKTGAVKVMDFGIARAVSDAGNSVTQTAAVIGTAQYLSPEQARGETVDARSDVYSLGCVLYELLTGEPPFVGDSPVAVAYQHVREDPVAPSKHNPEIPPGLDSVVLKALSKNPDNRYQNAAEMRADLMRVYQGEQPEAPKVLTDAERSTMLSTPANTRAFPASGPQTSPLPSQYEEPRRNPLSRWLVGLAALVVLTIIVTFAIILGNGPSRDVQVPDVTGKSQSDAVAALQNLGFKTKVQKNTSSKVAPEKVIDTDPAKGSTVSAGAEVTVNVSIGPENQQVPDCHGLSFGDAVKKLQAAGFKGTFTQSETKSLPEDKGRVMATNPPAGQYSAVTNNITIVVGKGPGEKPVPDLGGQNIDVAIKNLPTYGFTAPPTVIPVPSPESKGQILSTNPPANTMFPEDGVIEIRVSNGGQFRMPNIMGKFWTDAEPMLYQAGWQGGGLSTEDVPSDGNNRARVVFQDPPAGAGVGYNGPIKLRFGAG
>NZ_CP014953.1|WP_005064460.1|29353_30028_+|aminodeoxychorismate/anthranilate-synthase-component-II
MRILVVDNYDSFVFNLVQYLGQLGVDATVWRNDDPRLADTDAVAADFDGVLISPGPGTPESAGASIAMVHSCAKTGTPLLGVCLGHQAIGVAFGGTVDRAPELLHGKTSTVEHEDAGVLRGLPNPFTATRYHSLTILPDTVPEGLRVIARTASGVIMGVMHTEHPIHGVQFHPESILTEGGHRMLANWLTYCGAPLDEPLVRSLEAEVAAALNGVTGRVAALGG
>NZ_CP014953.1|WP_005064465.1|28579_29296_+|DUF881-domain-containing-protein
MPLVCALAGFLLAATHTVSGGSEIRRGDSPSPRLVDLVRETQKSVDKLSGTRDGLANEMAAAREQSAGGDSQVAAALAETAEVADAAGVRPVTGPGLVVTLTDAKRDAYGRFPRDASPDDLVVHQQDVEGVLNALWSAGAEAIQMQDDQRLVASSVPRCVGNTLLLHGRTYSPPYVITAIGDADAMQAALDAAPLVTLYRQYVARFGLGYTVTRGHHLEVAGYRDAVGPGRAVPLQGH
>NZ_CP014953.1|WP_005064469.1|28116_28380_-|cell-division-protein-CrgA
MPKSKVRKKSTFNATTVSRTPVKVKAGPSSVWFVAFFLTLMLIGLAWLMVFQLAAQHITWMLDLGPWNYAIAFAFMITGLLLTMRWR
>NZ_CP014953.1|WP_153995311.1|27967_28126_-|hypothetical-protein
MALTSGVVAPMLSSALWNAPRVSGSSIWLARVSIESTHQTPNHNDVIYPHCG
>NZ_CP014953.1|WP_005117577.1|40885_41518_+|hypothetical-protein
MAIAVAGWQLGTDPALDVGVFGLPGATAEPTGPPGPTGGGMTDGGGSQFQPPQIPNQMPDYQSGNQPPLDQSNGISIYNTGSPGAQQVPSQQGAQQAPQQAQQPAHGTQIPDYQTAAPYTQGPGQANPDYQAPQQQPPEQGHEQFSQQQQAQQTQVPQQTAQPTQPPKQAQPNPEPKQQQPAKPPSQQPPPKGEISKPAQVQPSDNAGCA
>NZ_CP014953.1|WP_005064439.1|42083_42512_+|SdpI-family-protein
MYGAGTEIEETNIMTPTIFAGALFLVALVFNIAFLLRTYRQAQRGEIPRNPRKGIRTLATMRSDAAWYEGQKVGTKILVQTGVPLHILGGVVMVAAMVYQKDTALWPTVAILGLWVVGYVIIAVLAATKASTAANGVNGGMV
>NZ_CP014953.1|WP_005064436.1|43069_43291_+|hypothetical-protein
MAAAAVSVTVLGVINVAVAALQAALVATTVVVGAELVFVPILITYQFERQPAQFDTDEAIARLASELKFDASA
>NZ_CP014953.1|WP_078377752.1|43277_43874_+|SdpA-family-antimicrobial-peptide-system-protein
MLRRERRQRPIHGRRAVMVLWLYSTVLMVAFLSTLIATMPSNVLVSEADTVTARVYLNTLASQNFAFFTRPPQSDQFDIYRKDSSGTFHSLLVTPQGRSENLFGIGRRQRAQGPEVADLTRAMPRWESCSGLYDECLSALSNKEPFHLVNNSPVATVCGDVIFTVESTVKWSYRSLVDYDHRITRAAHSIVSCEATEK
>NZ_CP014953.1|WP_074336267.1|43912_44857_+|hypothetical-protein
MRFDHRNLWFAVGRVSLALATLSEVIFTSPRALFVPVGGVEGPYCRLGEYLSIYCLGSPDSHLEFKRIAVAAILGVVVSGYRPRYLALPHLWATYSVSTSITLPDGGDSIALICLILLTPLCLIDPRRWIWNAPGHRMSLDCRAIGLASQWALRIQFAFIYADSALTKVGVADWANGSAFYYFVRDKMFGTTGPLSPFFYWSSATPLGSVAATWGTIAIELVIALFIMGGPRLRRISLYSTVALHLAIYVTLGLFSFSLVMIAGAVLVANTDRVQPLGMFHAKPAGVLVRRWRLRDLQLQRAGSRTQERKVREL
>NZ_CP014953.1|WP_005064431.1|44856_45297_+|SdpI-family-protein
MRQNNAVGDGRGPTLSRMVVAGCFLILSVVVVVLIIRGYYLAMNDQLPSNLTFGFRSPSTLSSESAWYASQRTGFSWLLFGVCPVLVIGSILTLVSIGFRKSFIELVGISTASWLLVVGIGVIAHIQAENAAEKASSASAQPLTAK
>NZ_CP014953.1|WP_016890725.1|45619_46234_+|hypothetical-protein
MPDPLSDGPGTGRPDVPPGRGAMRWQEPGITLPRPPTVAEARARDKAQRAREAAQRLAEVQAQKAEERRRTRNKVLMGSAVVAGIAAVVAVGYAVIDRDDDVEATCVQQGSNVVAPEEYCERGTPSSGGTFIYAGSPYQYYYGGQNRGIGTVATGGSLELPRGTTARTSSGTRISKSDGSGSVSRSPSVSRGGFGSSSSGSSGS
>NZ_CP014953.1|WP_005064427.1|46233_47400_+|glutathionylspermidine-synthase-family-protein
MRRERGRPRPGWEQTVASQGMCYGTPARMADGSDRPYWDESVHYVFDMDEVLSLEATVEVLHSMCLEAVERVVLLGRYHDFGLPEWTWEHIEKSWRRSDPHLYGRFDLRYDGQRPPVLLEYNADTPTSLLEAAILQWHWKTDVFPDDDQWNSLHDQLVARWKHIGGQLPGAETHFTWSSADQTGEDHVTLAYLQECAAEAGLNTVGLPIEQIGWDHDLNRLVDLEEAPIESIFKLYPWEWMIDDDFGRHAVELLPETLWIEPLWKTLLSNKAILAILWEMYPGHPNLLPAYLDSPRELTEYVRKPKLGREGANITVVGAGFETATGGVYGEEGFVYQLLDPLPRFDGMRPVLGAWIVGDESAGVGIRETAGLITDDGAAFVPHRIPLS
>NZ_CP014953.1|WP_005064424.1|47438_47876_+|DUF350-domain-containing-protein
MNTAGYWSIVAHGAAAIWLYAAVGFVLMTLGFFVLDWTTPGPLRQMVRAGLPNAAVIAAAGLLSQAFVIVLAIYTASGNIAEGLIRTLVFGLIGIAAQTICIRLIEWVMGVDVGELLAHRRFASATLVVAAAYIAVGLVIATAIL
>NZ_CP014953.1|WP_005064421.1|47891_48962_-|hypothetical-protein
MTGQVISRAISRVIVDGLLPRLDHRLEASRKPFTDPGILRPHAGDGLWAATHYGVFIPDLDSPHRYLNTMTLIGAIGAELFDNDYLSASDARNTATVLSSTAADDQHHYRAYDSARDCDFAKDGSVLRWGDDLRMEVAYPHVTVRGRYQRFSADIELTVTDQVSYFIKTPVYDHLSLLAEYRGIIADAAGAAPIKGLGTFEYARFLSHQRLFRRPLPRRLKLPVDFFTYQIINLGNETQVLLTHVRARGSVACLLAHVRVLGKSTAVYTDVRLDVAEYRDNPAVDEEGRPMRVPHRLNWTVRDDHGHLVLSIDGLVDAPLRYGHGRGYVGAYSYTGFYQGNPVGGSAYIEWVDTQL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP014953_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP014953_2

945857-945944

Orphan

Consensus_repeat	Method
CGGCTGCTACAACGGCGTGTGCGGTGGCTGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP014953_2

>merge|NZ_CP014953|2|945857-945944|CRISPRCasFinder
CGGCTGCTACAACGGCGTGTGCGGTGGCTGGAACCCCGGCCAGGGTGGTTGGGGCCACGGCTGCTACAACGGCGTGTGCGGTGGCTGG

>NZ_CP014953|2|1|945857-945944|CRISPRCasFinder
CGGCTGCTACAACGGCGTGTGCGGTGGCTGG	AACCCCGGCCAGGGTGGTTGGGGCCA
CGGCTGCTACAACGGCGTGTGCGGTGGCTGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP014953.1\|WP_005063556.1\|943717_943933_+\|antitoxin	unknown	unknown	gnl\|CDD\|379416
NZ_CP014953.1\|WP_005063565.1\|936097_936679_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014953.1\|WP_005063553.1\|945128_945572_+\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|378454
NZ_CP014953.1\|WP_005063558.1\|940397_942800_+\|cation-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319795
NZ_CP014953.1\|WP_005063554.1\|943955_945092_+\|lipase	unknown	unknown	gnl\|CDD\|367570
NZ_CP014953.1\|WP_005066003.1\|949679_949835_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|239527
NZ_CP014953.1\|WP_005063564.1\|936658_937747_-\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224983
NZ_CP014953.1\|WP_005063548.1\|947506_949519_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340868
NZ_CP014953.1\|WP_005119283.1\|942829_943663_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|225852
NZ_CP014953.1\|WP_074232589.1\|946959_947556_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225767
NZ_CP014953.1\|WP_005063559.1\|939602_940280_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP014953.1\|WP_005063540.1\|955400_956606_-\|DNA-polymerase-IV	unknown	unknown	gnl\|CDD\|179663
NZ_CP014953.1\|WP_005063550.1\|945980_946901_-\|LLM-class-flavin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274648
NZ_CP014953.1\|WP_005063541.1\|954591_955374_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319911
NZ_CP014953.1\|WP_005063545.1\|951411_951846_+\|DUF779-domain-containing-protein	unknown	unknown	gnl\|CDD\|377532
NZ_CP014953.1\|WP_005063562.1\|937771_938503_+\|enoyl-CoA-hydratase	unknown	unknown	gnl\|CDD\|236115
NZ_CP014953.1\|WP_005066010.1\|953719_954466_-\|peroxide-stress-protein-YaaA	unknown	unknown	gnl\|CDD\|234999
NZ_CP014953.1\|WP_005118343.1\|938505_939606_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|293841
NZ_CP014953.1\|WP_062865457.1\|949910_951431_+\|aldehyde-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|143434
NZ_CP014953.1\|WP_005063544.1\|951939_953730_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223021

Protein	Function_ID	Function_description	E-value
NZ_CP014953.1\|WP_005063556.1\|943717_943933_+\|antitoxin	gnl\|CDD\|379416	pfam14013, MT0933_antitox, MT0933-like antitoxin protein. This family of proteins contains the MT0933 protein, which has been identified as an antitoxin to /protein MT0934. This family of proteins is found in bacteria. Proteins in this family are typically between 61 and 90 amino acids in length.	4.21227e-08
NZ_CP014953.1\|WP_005063553.1\|945128_945572_+\|SRPBCC-family-protein	gnl\|CDD\|378454	pfam10604, Polyketide_cyc2, Polyketide cyclase / dehydrase and lipid transport. This family contains polyketide cylcases/dehydrases which are enzymes involved in polyketide synthesis. It also includes other proteins of the START superfamily.	2.25822e-13
NZ_CP014953.1\|WP_005063558.1\|940397_942800_+\|cation-translocating-P-type-ATPase	gnl\|CDD\|319795	cd02609, P-type_ATPase, uncharacterized subfamily of P-type ATPase transporter, similar to uncharacterized Streptococcus pneumoniae exported protein 7, Exp7. This subfamily contains P-type ATPase transporters of unknown function, similar to Streptococcus pneumoniae Exp7. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids. They are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle. A general characteristic of P-type ATPases is a bundle of transmembrane helices which make up the transport path, and three domains on the cytoplasmic side of the membrane. Members include pumps that transport various light metal ions, such as H(+), Na(+), K(+), Ca(2+), and Mg(2+), pumps that transport indispensable trace elements, such as Zn(2+) and Cu(2+), pumps that remove toxic heavy metal ions, such as Cd(2+), and pumps such as aminophospholipid translocases which transport phosphatidylserine and phosphatidylethanolamine.	0
NZ_CP014953.1\|WP_005063554.1\|943955_945092_+\|lipase	gnl\|CDD\|367570	pfam03583, LIP, Secretory lipase. These lipases are expressed and secreted during the infection cycle of these pathogens. In particular, C. albicans has a large number of different lipases, possibly reflecting broad lipolytic activity, which may contribute to the persistence and virulence of C. albicans in human tissue.	4.81964e-17
NZ_CP014953.1\|WP_005066003.1\|949679_949835_+\|hypothetical-protein	gnl\|CDD\|239527	cd03443, PaaI_thioesterase, PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria. Although orthologs of PaaI exist in archaea and eukaryotes, their function has not been determined. Sequence similarity between PaaI, E. coli medium chain acyl-CoA thioesterase II, and human thioesterase III suggests they all belong to the same thioesterase superfamily. The conserved fold present in these thioesterases is referred to as an asymmetric hot dog fold, similar to those of 4-hydroxybenzoyl-CoA thioesterase (4HBT) and the beta-hydroxydecanoyl-ACP dehydratases (FabA/FabZ).	1.90021e-05
NZ_CP014953.1\|WP_005063564.1\|936658_937747_-\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224983	COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism].	8.48428e-35
NZ_CP014953.1\|WP_005063548.1\|947506_949519_-\|MFS-transporter	gnl\|CDD\|340868	cd06179, MFS_TRI12_like, Fungal trichothecene efflux pump (TRI12) of the Major Facilitator Superfamily of transporters. This family includes Fusarium sporotrichioides trichothecene efflux pump (TRI12), which may play a role in F. sporotrichioides self-protection against trichothecenes. TRI12 belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.84197e-66
NZ_CP014953.1\|WP_005119283.1\|942829_943663_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|225852	COG3315, COG3315, O-Methyltransferase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism].	1.99456e-48
NZ_CP014953.1\|WP_074232589.1\|946959_947556_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|225767	COG3226, COG3226, Uncharacterized protein conserved in bacteria [Function unknown].	7.56192e-08
NZ_CP014953.1\|WP_005063559.1\|939602_940280_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	1.17233e-21
NZ_CP014953.1\|WP_005063540.1\|955400_956606_-\|DNA-polymerase-IV	gnl\|CDD\|179663	PRK03858, PRK03858, DNA polymerase IV; Validated.	0
NZ_CP014953.1\|WP_005063550.1\|945980_946901_-\|LLM-class-flavin-dependent-oxidoreductase	gnl\|CDD\|274648	TIGR03560, F420_Rv1855c, probable F420-dependent oxidoreductase, Rv1855c family. Coenzyme F420 has a limited phylogenetic distribution, including methanogenic archaea, Mycobacterium tuberculosis and related species, Colwellia psychrerythraea 34H, Rhodopseudomonas palustris HaA2, and others. Partial phylogenetic profiling identifies protein subfamilies, within the larger family called luciferase-like monooxygenanases (pfam00296), that appear only in F420-positive genomes and are likely to be F420-dependent. This model describes one such subfamily, exemplified by Rv1855c from Mycobacterium tuberculosis. [Unknown function, Enzymes of unknown specificity].	6.9961e-72
NZ_CP014953.1\|WP_005063541.1\|954591_955374_+\|VOC-family-protein	gnl\|CDD\|319911	cd07247, SgaA_N_like, N-terminal domain of Streptomyces griseus SgaA and similar domains. SgaA suppresses the growth disturbances caused by high osmolarity and a high concentration of A-factor, a microbial hormone, during the early growth phase in Streptomyces griseus. A-factor (2-isocapryloyl-3R-hydroxymethyl-gamma-butyrolactone) controls morphological differentiation and secondary metabolism in Streptomyces griseus. It is a chemical signaling molecule that at a very low concentration acts as a switch for yellow pigment production, aerial mycelium formation, streptomycin production, and streptomycin resistance. The structure and amino acid sequence of SgaA are closely related to a group of antibiotics resistance proteins, including bleomycin resistance protein, mitomycin resistance protein, and fosfomycin resistance proteins. SgaA might also function as a streptomycin resistance protein.	1.84839e-40
NZ_CP014953.1\|WP_005063545.1\|951411_951846_+\|DUF779-domain-containing-protein	gnl\|CDD\|377532	pfam05610, DUF779, Protein of unknown function (DUF779). This family consists of several bacterial proteins of unknown function.	2.62965e-69
NZ_CP014953.1\|WP_005063562.1\|937771_938503_+\|enoyl-CoA-hydratase	gnl\|CDD\|236115	PRK07854, PRK07854, enoyl-CoA hydratase; Provisional.	5.5316e-136
NZ_CP014953.1\|WP_005066010.1\|953719_954466_-\|peroxide-stress-protein-YaaA	gnl\|CDD\|234999	PRK02101, PRK02101, peroxide stress protein YaaA.	1.51257e-69
NZ_CP014953.1\|WP_005118343.1\|938505_939606_+\|hypothetical-protein	gnl\|CDD\|293841	cd16283, RomA-like_MBL-fold, Enterobacter cloacae RomA and related proteins; MBL-fold metallo hydrolase domain. Derepression of the romA-ramA locus results in a multidrug-resistance phenotype. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	7.12276e-68
NZ_CP014953.1\|WP_062865457.1\|949910_951431_+\|aldehyde-dehydrogenase-family-protein	gnl\|CDD\|143434	cd07116, ALDH_ACDHII-AcoD, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like. Included in this CD is the NAD+-dependent, acetaldehyde dehydrogenase II (AcDHII, AcoD, EC=1.2.1.3) from Ralstonia (Alcaligenes) eutrophus H16 involved in the catabolism of acetoin and ethanol, and similar proteins, such as, the dimeric dihydrolipoamide dehydrogenase of the acetoin dehydrogenase enzyme system of Klebsiella pneumonia. Also included are sequences similar to the NAD+-dependent chloroacetaldehyde dehydrogenases (AldA and AldB) of Xanthobacter autotrophicus GJ10 which are involved in the degradation of 1,2-dichloroethane. These proteins apparently require RpoN factors for expression.	0
NZ_CP014953.1\|WP_005063544.1\|951939_953730_+\|hypothetical-protein	gnl\|CDD\|223021	PHA03247, PHA03247, large tegument protein UL36; Provisional.	0.000103621

>NZ_CP014953.1|WP_005063553.1|945128_945572_+|SRPBCC-family-protein
MAAKLNSSIDVPLPPEEAWAHASDLRRFDEWLSVHTAWRSALPETLEKGTVIDSIVCVKGMYNRVRWTLQKYDPPTGLFLDGQGRGGVKVKLRVAISPKGSGSVVDFNLHLGGPAMFGPIGAVVAAALRSDIDASLAKFVQVFAAAP
>NZ_CP014953.1|WP_005063554.1|943955_945092_+|lipase
MLVLIMAACARVEAEGVAPQPPSPPPGEVLSDVPLSLAPDLDAIADGHLIRYMSTSGATGTPTEVTGVVFAPKGEPPQAGWPIVSVGHGTTGLDDECAVSRAPDLRGYIWLVRNLSKRGWVVAITDYEGLGVPGPHPYLEPRSEGFNVIDAARAAVSLIPGASTKWAAIGASQGGQATWAASELAGNYASELEFVGSANLSPAADLTDMATHVGDGRYHWSQLSMMPTLLTGLSVTVPELRPENFLHGSFQDIPQDKALLLGCHNGLDPARSAAIGRLRAKDFHGTSPADPIVFAAALKRIALPLGPASGPMFVYAGGADRLIEAGWIHAAVRRACALGDTVQEVVSPGKGHVDPEGERLGVQWIADRFAGLPAPSNC
>NZ_CP014953.1|WP_005063556.1|943717_943933_+|antitoxin
MADFKGLIDKLKSLLAGNKDKVNEAVDKVGDTIDSKTGGKYSAVVDKVQDAAKSAVEKVEGAAAPKDGDAQ
>NZ_CP014953.1|WP_005119283.1|942829_943663_-|class-I-SAM-dependent-methyltransferase
MLVRVTDPVKITLTGAPETMLATLYGRAQDATSPNSVLHDHYAAEAVARIDYDFSKTKIKGTQAIGVALRARQLDDWTSEFLTAHREATVLHLACGLDTRVFRINPSETVRWVDVDYPDVIALRRALLPCREGDYRMIGSSVSEATWLDSIPADRPTLAVFEGLTMYLTEAEGQSLIRRITGRFPSGQLAFDCYGSIGIKLQKLVPAVRNAGATLHWGIDDPGQIEALHPGLRCVSDLRSTDVAGEEYLPLSGRIQMKVISHLPALRDIGRIMRFSF
>NZ_CP014953.1|WP_005063558.1|940397_942800_+|cation-translocating-P-type-ATPase
MATIEGLTISGLTAAEVAERVAQGKTNDVPSRAARSVSDIVRANVFTRINAILGVLLIIVLSTGSIINGAFGLLIIANSAVGIIQELRAKQTLDKLAIVGQTRPLVRRDGAATALAPNEVVLDDIIELGPGDQIVVDGEVIEESALEIDESLLTGEADAIEKTIGSQVLSGSFVVAGSGAYRATKVGREAYAAKLAEEASKFTLVHSELRNGINKILQFITYLLLPAGALIIYTQLFTTDDSWQESVLRMVGALVPMVPEGLVLMTSIAFAVGVIRLGRRQCLVQELPAIEGLARVDTVCADKTGTLTENGMRLADVRFPDRDGDEDALAVLAQLAADDPRPNASIAAIAEAYDTPPGWETTAIAPFSSAKKWSGASYGDHGNWVIGAPDVLLDPADAIATAAEEIGARGLRVLLLASAELSVDDAYAPGAVTPRALVVLEQKIRPDARETLDYFASQHVSIKVISGDNAVSVSAVAQTLGLTGAAVDARTLPTDTDKLAATLADATTFGRVRPDQKRAMVKALQSHGHTVAMTGDGVNDVLALKDADIGVAMGAGSSASRAVAQIVLLDNKFATLPYVVAEGRRVIGNIERVSNLFLTKTVYSVLLALTVGLAGLGSKIFHYGAVPFPFQPIHVTIAAWFTIGIPAFILSLAPNNERAQTGFVRRVMLSAIPSGLTVGIATFLSYLLARQILHVSGNSTQASTAALITELVAAVWVLAVVARPYQWWRVVLVALSGLGYVAIFAIPLARKAFMLDPGNLAVTGPALGIGIAAAAVIEAVWWLQGKWSGQPRHFWATGED
>NZ_CP014953.1|WP_005063559.1|939602_940280_-|class-I-SAM-dependent-methyltransferase
MTSNELPDWDATYQGKGELFQGEPPWNIGEPQPELAALIDAGKFHGTVLDVGCGHAETSLRLAALGHTTVGLDLSPTAIEAARAAAAERGLTNATFEVADITDFSGYDGRFNTIVDSTLFHSIPVEAREAYLQSISRAAAPDASYFVLVFAVGAFPPGIGPNAVTEDELRAAVEPYWAIDELSSAYIHSNIPEVIPGANFEMPVFHKDEKGRNKQPAFLLQAHKR
>NZ_CP014953.1|WP_005118343.1|938505_939606_+|hypothetical-protein
MRALWVGAGAAIASTWIGRALRDVPQTLGASKGRIAEVAKGSPQYRGGTFHNAEPARQFSPDAETTTVVWDVLTRRSVGTPKGQVPLAVPEFAGPPADLAATWFGHSSVLVEIDGYRVLTDPVWSDRCSPSRVVGPHRQHPVPVELSALPALDAVVISHDHYDHLDMDSIIALTRSQNAVFVVPLGVGAHLRGWGVSPARVIELDWDQSHQLGKLTLTCTQARHFSGRSIARNTTLWASWAFAGPKHKVFFGGDTGYTKAFKVIGDTYGPFDLTLLPVGAYNTSWADIHMNPEEAVQTHLDLATAQAPLLPIHWATFNLALHPWAEPIERVLAAAEEQGVTVVTPRPGQRADARRPAAPDDWWRLS
>NZ_CP014953.1|WP_005063562.1|937771_938503_+|enoyl-CoA-hydratase
MIGVTSDGPVTTIELQRPERRNAVTYELALAFAEEVKKAAETARAIVVTGQGTSFCAGADLSSGAPDPDKFADAWQHSIKSVDAADIPVIAAVNGPAIGAGVMLAMVADLRVVSETARFQFPVAKYGIALDNWSIRRLTSLVGYGRARAMLLAAEPLDAQTALQTGMANRIGELADAQAWAAELAGFAPLALKHAKRVLNDDGAFEDQWPEHKELFDKAWGSQDIIEAQVARIQKRPPNFQGA
>NZ_CP014953.1|WP_005063564.1|936658_937747_-|NAD(P)/FAD-dependent-oxidoreductase
MTTVAVIGGGQAGIAAGYFLRRRGLEPLSRRQPADAPGHGFVILDHSPGPGGAWQFRWPTLTLDNTNRIYQLPGLPFDEMGAIRASTAMPRYFGEYEDRYALDVRRPVHVRAVRPARGGFTIDTSVGEFPVDGLINATGTWDKPFVPFVPGAGTFRGRQLHTHDYQRPEEFTGQHVLVVGGGISAVQLLIEIAGIDSVTTSWVTRREPVFVTDLTVDRLRAAVAGVDERSRRGEPQRSVVSATGLPWTAETAEAARRGVLTRRPMFSRITPTGVTWPDGSALEVDVILWCTGFRHALDHLAPLHLRNGRGGITMTGRLLTQVAGQPAIHLLGYGSSASTIGANRASRAAVVELMNYLEGRTA
>NZ_CP014953.1|WP_005063565.1|936097_936679_+|hypothetical-protein
MCAALGVGLLSGGAAVAHADPAFPDLSGFAVVPPDGFFVTNENSSVRSIHFSTPDGIGCMFRASPNMTPTSRQRLSCDGAVPGIPGDAPNAPNVPGIGGASANVPGLGGVNIPGVGTCPMGTVAQKGDGAFEISKGAWSCGTKPEAPLLNVGQKLTYGNVTCAVGAGSVTACQVVTGDQKHGFVLQPSGSTSF
>NZ_CP014953.1|WP_005063550.1|945980_946901_-|LLM-class-flavin-dependent-oxidoreductase
MRFSIWGQTNQSWADLLDIAQYADDGTWRAFYAADHFMSHADTAEERTDFHEATALFAALAAATSRIRLAPLVLSMTFRHPAVLANWAATVDHVSQGRFTLGLGAGWQENEHQRYGLELGKPGARVDRFSEGLQVITGLLSEPATTVDGQYYRLAEGICEPKPLQRPLPILIGATQPRMLALTARYAHEWNQWSSPGTFREVSGRLDAAAEKIGRDPATIWRSTQARVIVTDGPQSEARAAETAAASPIPVLYGTAERIAEQMAPWAQEGVDEVILPDHLLGSGSARRDAYDALAQALRPLSNEKG
>NZ_CP014953.1|WP_074232589.1|946959_947556_+|TetR-family-transcriptional-regulator
MEEQPRGRRAEVIAAAIEVAGTMGIGGLTYRSVDAAANVPSGTTSNHFRTRDALLLGAILEIEKLRRAFWRALVTEINPTTVSDLVGIGTAYANGAVGAMSTRVRAYMALLMEGWSHPELREPLQRGRDAQIPRTLHLMCKVDPKTPQLHAEIFQDYLTGIIYQQLANPVADFNPRPGIEALLTALVTPPQTPRAAQR
>NZ_CP014953.1|WP_005063548.1|947506_949519_-|MFS-transporter
MISVQRRNLIFVAVLLGMLLAALDGTIVATALPTVVADLGDAGHQSWVVTSYLLASTVATAVMGKFGDLFGRRTVFITCIVIFAGGSLLCGMAGSMAMLVGARAIQGLGSGGLMVTATALIGEIIPMRERGRYQGILGAVFGVTTVIGPLLGGLFTDHLGWRWAFYINLPISVVVIMVAAGAIPALAKATHPVIDYWGIVLIGLGASALTLATSWGGTTYPWSSPVIIGLFASSIAAIGTFVWVESRVPEPILPPRLFRDPVFTICCVLSFVVGFAMLGVMTYLPTFMQFVNGVSATVSGLRTLPMVAGMLITSTGTGTLVGRTGRYKRYPVAGTAIMAIALVLLSRMDDSTPFVLQSLYLFILGVGIGASMQVLTLIVQNTARFDDLGVATSGVTFFRTIGSSFGAAIFGSLFSNFLTRELSSVNTPPQATQSPQALHALPHDAAVPVIHAYADSLDLVFLCAAPVAAVGFVLALFLKEVPLRGADTSLAVDMGEGFGMPNSVSPDKLLEIAIGNAMRGFPHVGLRKLREHAGVSMPIAPLWALVQANRFLRATGSAEVSRIAQWYRIPPEIVDPAFNELVANGYALRTNDHIWLTDSGREEVDKISEAINQYLIERLSRTPDFEDRADREQIQAALERISRRIVTDTDWRENPIAALPAASGAASPAR
>NZ_CP014953.1|WP_005066003.1|949679_949835_+|hypothetical-protein
MCGYGCLASLPEGASGCTTVELKTNFLGAAREGKLTAAVFRCTQLVLWPRG
>NZ_CP014953.1|WP_062865457.1|949910_951431_+|aldehyde-dehydrogenase-family-protein
MAKYAAPGTEGSAVTFAPRYENFIGGEWVAPADGQYFENASPIDGKVFTQVARGTAPDIEKALDAAHAAAEGWGNTSAAERSNALLRIADRMEQHIERLAVAETWDNGKPIRESLNADIPLAIDHFRYFAGVLRAQEGSISEIDHDTVAYHFHEPLGVVGQIIPWNFPLLMAVWKLAPALAAGNCVVLKPAEQTPASILVLMELIADLLPSGTVNVVNGFGVEAGKPLASSPRIAKIAFTGETTTGRLIMQYATENIIPVTLELGGKSPNIFMPDVMAADDAFLDKALEGFTMFALNQGEVCTCPSRALVHASIYDEFIARAITRVEAIVGGDPLDEDTMIGAQASNDQYEKILSYIDIGRQEGAQVLTGGDARKVAEYPDGAYIQPTVFAGTNNMRIFQEEIFGPVLSVAQFDSLDEALKIANDTLYGLGAGVWSRDMTNAYRLGRGIKAGRVWTNCYHQYPAHAAFGGYKKSGIGRENHKMMLDHYQQTKNILVSYSPDAAGFF
>NZ_CP014953.1|WP_005063545.1|951411_951846_+|DUF779-domain-containing-protein
MPRASSDEGSPGESRILINRVELTPAAAELLASLVAKHGPVMFHQSGGCCDGSAPMCYPRGEFRVGASDVLLGEVSRDTPFWMSADQFEYWSHTHLTVDVVPGRGSGFSLEAPEGVRFLIRSRLFTDDEVLALANQPVRTGADG
>NZ_CP014953.1|WP_005063544.1|951939_953730_+|hypothetical-protein
MHVGIRTVAVAAVCGLCVGAGVDARAVRPNLSIAGTPTTRSVSSQAVSLASFSDLLAAAAPQNDAAAQMNSVGGGAVSSTDLIGTVAKLLAAPNITQSSVTPGINTAAVDTVDSPSSEPVDPPTGQPADPPAADEPAPPTNFPGERPAFGTPSYFAQLAFAVFHVVALPITVPVQFFLGSAEGVPTVIAAAINDLSGLLGQIPGLSPQQPTEPQPQQTAQSSSPLQKQAAAETGPTTDPEPPAEPLPTNFPGPRPAFGTPSYFAQLAFAVLHVLALPITVPVQAIIGKTEGVPSVIVAALNDLSSLLGQVPKLSAPVTDTKTTPQDSTSRQADKAAPTLDSASEKPETATSGADAKTSKIERNEHEGKTADKAAEAPKAEHETKPGAASEGTPKTDSAKEVVESKADPTKVVESKADPTKAVEPKADPTKVVEPKVDPAKVVEPKTDPAKAVEPKADTVAEPAKPESSKAEVAKPVTAKPETKVQPAKPESAGPVKVTRDSLKSTPGETGTTGGTKTTEGSKGSVTDSKTPAASTDTKVHDGLKPAVGAKPDKPADKPSTEKSSSEKSGSSSEGSSHSSESKSHSSEGKSHSGSKD
>NZ_CP014953.1|WP_005066010.1|953719_954466_-|peroxide-stress-protein-YaaA
MIVLLPPSETKHEGGDGPPLRLNELATPTLNPLREALVDELIALAAEPDACRQALGISASQDAEIQRNAELRISPTMPALHRYTGVLYDNLDVTSLRGASATRARERLAVGSALFGLLRADDPVPAYRLSASSKLPGKPTLAARWRPVLEPVLAELAAGELVVDLRSGSYAGLGRLPHAVTVDCLTEHPDGRRTVITHFNKAHKGKLARILAGSRAEPNDAASVATVARRAGLHVERDGNTLTIVVSP
>NZ_CP014953.1|WP_005063541.1|954591_955374_+|VOC-family-protein
MPTRDETPLGAPAWIDLASSDLEKSKAFYSALFGWTLQDAGPEYGGYINAHKDGKAVAGMITNNPEWNAPDAWTTYFATDDIDATLQKAVAHGGTNCLPPMEVPQLGYMALFADPAGAMVGLWQPLAHKGFQLVGEGGAPAWHELNTREYDRAVDFYTTVLGWNTKTEGDSADFRYACAQHDGAPIAGINDASVGQWALPEGVPAHWAVYFGTDDTDAGAAKATELGGVVLAPAQDTPYGRMALIRDTTGATFWLCSVDS
>NZ_CP014953.1|WP_005063540.1|955400_956606_-|DNA-polymerase-IV
MTGTASILHADLDSFYASVEQRDTPALRDRPVIVGGGVVLAASYEAKHCGVRTAMGGRQALRLCPHAVVVPPRFDAYSAASKLVFEVFRDTTPLVEPLSIDEAFLDVSGLLRISGAPRDIAAALRVEVRRRAGLPITVGIARTKFLAKVASRQGKPDGLLVVEPHEELSFLRPLPVQALWGVGSVTAEKLRVYGIRTVADVADLGESTLASMVGRAMGHQLHCLANNIDPRRVDGGRRRRSIGAQCALGRGPRADSEIDAIATQLMERIARRMRGTGRSCRTVVLRLRFGDYARATRSRTMPRPTTSTERLLSVARELVKDAGPLIKERGITLIGFSVSNFDPCGAAQLELPFSDAAENTLALDSTLDGLRNRFGTRSVTRANLLHGGGREEWGIPTFEDL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP014953_2	2.1\|945888\|26\|NZ_CP014953\|CRISPRCasFinder	945888-945913	26	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	418376-418401	5	0.808
NZ_CP014953_2	2.1\|945888\|26\|NZ_CP014953\|CRISPRCasFinder	945888-945913	26	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	678153-678178	5	0.808
NZ_CP014953_2	2.1\|945888\|26\|NZ_CP014953\|CRISPRCasFinder	945888-945913	26	NZ_CP029333	Mycobacterium avium subsp. hominissuis strain MAC109 plasmid pMAC109a, complete sequence	54049-54074	6	0.769
NZ_CP014953_2	2.1\|945888\|26\|NZ_CP014953\|CRISPRCasFinder	945888-945913	26	NC_022654	Mycobacterium kansasii ATCC 12478 plasmid pMK12478, complete sequence	143457-143482	6	0.769

1. spacer 2.1|945888|26|NZ_CP014953|CRISPRCasFinder matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 5, identity: 0.808

aaccccggccagggtggttggggcca	CRISPR spacer
gaccccggccagggtggtcgcggcgg	Protospacer
.*****************.* *** .

2. spacer 2.1|945888|26|NZ_CP014953|CRISPRCasFinder matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 5, identity: 0.808

aaccccggccagggtggttggggcca	CRISPR spacer
gaccccggccagggtggtcgcggcgg	Protospacer
.*****************.* *** .

3. spacer 2.1|945888|26|NZ_CP014953|CRISPRCasFinder matches to NZ_CP029333 (Mycobacterium avium subsp. hominissuis strain MAC109 plasmid pMAC109a, complete sequence) position: , mismatch: 6, identity: 0.769

aaccccggccagggtggttggggcca	CRISPR spacer
ttgcccggcgagggtggttggggcac	Protospacer
   ****** **************

4. spacer 2.1|945888|26|NZ_CP014953|CRISPRCasFinder matches to NC_022654 (Mycobacterium kansasii ATCC 12478 plasmid pMK12478, complete sequence) position: , mismatch: 6, identity: 0.769

aaccccggccagggtggttggggcca	CRISPR spacer
ttgcccggcgagggtggttggggcac	Protospacer
   ****** **************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

413512 : 475232

Gordonia_phage(28.57%)

protease,holin,integrase

attL 409428:409443|attR 486622:486637

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
409428:409443	attL	NA	NA	NA	NA
WP_052526162.1\|413512_414727_+\|integrase	site-specific integrase	A0A0E3XBN7	Gordonia_phage	4.8e-63	42.1
WP_005117687.1\|415031_416102_-	PLP-dependent cysteine synthase family protein	NA	NA	NA	NA
WP_005083536.1\|416103_417066_-	metallophosphoesterase	NA	NA	NA	NA
WP_014850223.1\|417172_419608_-	transglycosylase/D,D-transpeptidase PonA2	NA	NA	NA	NA
WP_012296305.1\|419846_420185_+	WhiB family transcriptional regulator	A0A220NS58	Mycobacterium_phage	8.4e-10	45.3
WP_005063253.1\|420271_421393_-	ArsA family ATPase	NA	NA	NA	NA
WP_031600036.1\|421389_422433_-	ArsA family ATPase	NA	NA	NA	NA
WP_005063257.1\|422491_422653_+	DUF4177 domain-containing protein	NA	NA	NA	NA
WP_005063259.1\|422649_423123_+	RidA family protein	M1I5B0	Acanthocystis_turfacea_Chlorella_virus	4.3e-12	31.6
WP_005063262.1\|423122_423908_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_005063266.1\|423914_424760_+	DMT family transporter	NA	NA	NA	NA
WP_005063269.1\|424771_425446_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_005065409.1\|425541_425904_-	hypothetical protein	NA	NA	NA	NA
WP_012296307.1\|426070_426868_+	endonuclease III	NA	NA	NA	NA
WP_005117958.1\|426869_427523_+	TlpA family protein disulfide reductase	NA	NA	NA	NA
WP_005063279.1\|427526_428291_+	CoA pyrophosphatase	NA	NA	NA	NA
WP_005063282.1\|428287_429553_+\|protease	acid resistance serine protease MarP	NA	NA	NA	NA
WP_005063284.1\|429526_430489_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_005065415.1\|430521_431043_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_005063288.1\|431292_431988_+	hypothetical protein	NA	NA	NA	NA
WP_005063290.1\|432077_434054_-	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	7.7e-79	37.3
WP_005117690.1\|434237_435857_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_005064981.1\|435853_436825_+	ABC transporter permease	NA	NA	NA	NA
WP_005064980.1\|436817_437732_+	ABC transporter permease	NA	NA	NA	NA
WP_005064979.1\|437732_439382_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.2e-21	32.8
WP_005064978.1\|439406_440150_+	hypothetical protein	NA	NA	NA	NA
WP_005064977.1\|440565_441447_-	HAD-IB family hydrolase	NA	NA	NA	NA
WP_005064976.1\|441830_442904_+	helicase	NA	NA	NA	NA
WP_005117693.1\|443537_444926_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_005117695.1\|444891_446814_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_005064971.1\|446810_449297_+	hypothetical protein	NA	NA	NA	NA
WP_005064970.1\|449283_449682_+	hypothetical protein	NA	NA	NA	NA
WP_005064969.1\|449830_453229_+	hypothetical protein	NA	NA	NA	NA
WP_005117698.1\|453265_453523_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_005064967.1\|453584_454274_+	hypothetical protein	NA	NA	NA	NA
WP_005064966.1\|454721_456404_+	hypothetical protein	NA	NA	NA	NA
WP_005064965.1\|456774_458580_+	AAA family ATPase	NA	NA	NA	NA
WP_005117954.1\|459140_459794_+	amidohydrolase family protein	NA	NA	NA	NA
WP_005064963.1\|460367_460718_+	hypothetical protein	G8I4H6	Mycobacterium_phage	7.1e-12	40.2
WP_005064962.1\|460871_462476_+	RNA polymerase sigma factor	NA	NA	NA	NA
WP_005117700.1\|462872_464060_+	hypothetical protein	NA	NA	NA	NA
WP_079462486.1\|464112_464460_+	DUF4279 domain-containing protein	NA	NA	NA	NA
WP_005117701.1\|464708_465077_+	hypothetical protein	NA	NA	NA	NA
WP_005064957.1\|465506_465932_+	hypothetical protein	NA	NA	NA	NA
WP_005117704.1\|466241_466742_+	type II/IV secretion system family protein	NA	NA	NA	NA
WP_005113881.1\|467091_468534_-	hypothetical protein	NA	NA	NA	NA
WP_005117920.1\|468671_468929_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_005113024.1\|468991_469678_+	hypothetical protein	NA	NA	NA	NA
WP_005113025.1\|469818_470100_-	DUF3892 domain-containing protein	NA	NA	NA	NA
WP_005117706.1\|470234_471014_-	hypothetical protein	NA	NA	NA	NA
WP_005113028.1\|471147_471366_+	hypothetical protein	NA	NA	NA	NA
WP_005113031.1\|471566_471788_-	hypothetical protein	NA	NA	NA	NA
WP_005113033.1\|471990_472710_+	hypothetical protein	NA	NA	NA	NA
WP_005113034.1\|472762_474004_+	ImmA/IrrE family metallo-endopeptidase	A0A0U4JD08	Gordonia_phage	2.8e-10	33.8
WP_012296311.1\|473930_475232_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
486622:486637	attR	NA	NA	NA	NA

DBSCAN-SWA_2

1688285 : 1696483

Mycobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_052525304.1\|1688285_1689209_+	hypothetical protein	A0A2P1N2T8	Gordonia_phage	1.0e-89	57.7
WP_052525305.1\|1690132_1690474_+	hypothetical protein	G8I4S2	Mycobacterium_phage	9.0e-36	68.1
WP_052525306.1\|1690501_1691338_+	DUF2303 family protein	G8I4S3	Mycobacterium_phage	3.1e-106	68.3
WP_128867312.1\|1691341_1691551_+	hypothetical protein	NA	NA	NA	NA
WP_052525307.1\|1691547_1692081_+	hypothetical protein	NA	NA	NA	NA
WP_052525389.1\|1692080_1692749_+	site-specific DNA-methyltransferase	G1D312	Mycobacterium_virus	2.0e-111	84.2
WP_128867313.1\|1692957_1693533_-	hypothetical protein	NA	NA	NA	NA
WP_052525309.1\|1693717_1694167_+	hypothetical protein	Q6JIG5	Burkholderia_virus	2.1e-40	59.9
WP_005131879.1\|1694166_1694565_+	hypothetical protein	G8I4T1	Mycobacterium_phage	2.1e-52	81.0
WP_052525310.1\|1694615_1695524_+	hypothetical protein	A0A1B3B1T0	Gordonia_phage	4.5e-42	63.3
WP_052525311.1\|1695520_1696483_+	hypothetical protein	A0A1J0MBY0	Mycobacterium_phage	4.2e-14	25.4

DBSCAN-SWA_3

1705157 : 1734832

Mycobacterium_phage(59.09%)

portal,terminase,integrase

attL 1732801:1732815|attR 1739459:1739473

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_052525319.1\|1705157_1705628_+	hypothetical protein	A0A0K1Y761	Mycobacterium_phage	4.2e-23	39.9
WP_052525320.1\|1705637_1707290_+\|terminase	terminase	A0A159B6A7	Gordonia_phage	1.6e-194	60.7
WP_052525390.1\|1707336_1708761_+\|portal	phage portal protein	A0A161C2E3	Gordonia_phage	6.0e-150	60.9
WP_052525337.1\|1708744_1709920_+	hypothetical protein	A0A159B6A6	Gordonia_phage	1.7e-65	48.0
WP_100484602.1\|1709992_1710709_+	hypothetical protein	A0A159B6A8	Gordonia_phage	2.2e-28	45.9
WP_052525341.1\|1710723_1711137_+	hypothetical protein	A0A162E0Z2	Gordonia_phage	3.4e-29	52.2
WP_052525344.1\|1711151_1712210_+	hypothetical protein	A0A159B6B2	Gordonia_phage	1.2e-65	38.2
WP_052525345.1\|1712209_1712644_+	hypothetical protein	A0A159B6B3	Gordonia_phage	1.7e-07	31.8
WP_052525348.1\|1712643_1713066_+	hypothetical protein	A0A162E0Z9	Gordonia_phage	2.2e-23	46.9
WP_052525350.1\|1713056_1713380_+	hypothetical protein	NA	NA	NA	NA
WP_052525352.1\|1713382_1713769_+	hypothetical protein	A0A2P1CGB5	Mycobacterium_phage	1.1e-13	43.7
WP_052525355.1\|1713765_1714239_+	hypothetical protein	A0A2P1CG68	Mycobacterium_phage	1.4e-39	52.5
WP_052525358.1\|1714257_1715184_+	hypothetical protein	A0A2P1CG50	Mycobacterium_phage	5.6e-80	54.1
WP_052525361.1\|1715259_1715751_+	hypothetical protein	NA	NA	NA	NA
WP_052525364.1\|1715807_1716167_+	hypothetical protein	NA	NA	NA	NA
WP_052525367.1\|1716170_1721144_+	hypothetical protein	A0A076G771	Mycobacterium_phage	4.7e-165	39.2
WP_052525369.1\|1721140_1722091_+	hypothetical protein	A0A2P1CGB7	Mycobacterium_phage	3.3e-112	58.7
WP_052525371.1\|1722087_1723803_+	hypothetical protein	A0A097EWG8	Mycobacterium_phage	2.3e-204	59.4
WP_052525372.1\|1723829_1724804_+	hypothetical protein	A0A076GDQ8	Mycobacterium_phage	2.4e-57	42.7
WP_052525374.1\|1724796_1725204_+	hypothetical protein	NA	NA	NA	NA
WP_052525377.1\|1727396_1727732_+	hypothetical protein	A0A0F6WE28	Mycobacterium_phage	1.7e-31	64.5
WP_052528319.1\|1727801_1728782_+	hypothetical protein	A0A0A7RWR1	Mycobacterium_phage	9.3e-09	42.0
WP_052525381.1\|1728800_1729172_+	hypothetical protein	A0A2L1IWK7	Gordonia_phage	7.6e-20	51.7
WP_052525382.1\|1729314_1730706_+	chitinase	A0A097EYN8	Mycobacterium_phage	1.3e-128	76.0
WP_052525383.1\|1730702_1731158_+	hypothetical protein	A0A142K517	Mycobacterium_phage	1.7e-05	39.8
WP_052525384.1\|1731192_1731444_+	hypothetical protein	NA	NA	NA	NA
WP_079457598.1\|1732121_1732886_-	radical SAM protein	NA	NA	NA	NA
1732801:1732815	attL	NA	NA	NA	NA
WP_052528317.1\|1733104_1733428_+	hypothetical protein	NA	NA	NA	NA
WP_052525386.1\|1733572_1734832_-\|integrase	tyrosine-type recombinase/integrase	A0A059VKS6	Mycobacterium_phage	6.0e-117	51.9
1739459:1739473	attR	NA	NA	NA	NA

DBSCAN-SWA_4

2767594 : 2776155

Streptococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005057568.1\|2767594_2768266_-	MBL fold metallo-hydrolase	A0A1X9I5D3	Streptococcus_phage	4.9e-17	31.1
WP_005057567.1\|2768379_2769303_+	peptidylprolyl isomerase	A0A1V0SCU1	Indivirus	1.1e-08	31.6
WP_005057566.1\|2769304_2770174_+	class A beta-lactamase	A0A1B0VBP7	Salmonella_phage	1.3e-54	46.0
WP_005057565.1\|2770277_2772644_-	RelA/SpoT family protein	A0A291L9W9	Bordetella_phage	1.8e-13	38.4
WP_005057563.1\|2772674_2773208_-	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	1.4e-14	36.4
WP_005057561.1\|2773204_2774881_-	hypothetical protein	NA	NA	NA	NA
WP_014850614.1\|2774880_2776155_-	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.5e-22	28.6

DBSCAN-SWA_5

4264356 : 4273855

Burkholderia_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005062155.1\|4264356_4265481_-	acyltransferase	A9YX16	Burkholderia_phage	7.1e-21	29.0
WP_005062156.1\|4265477_4266746_-	glycosyltransferase	A0A1L3KK54	Shahe_endorna-like_virus	3.3e-06	40.3
WP_012296730.1\|4266795_4267602_-	macrocin O-methyltransferase	A0A2R8FDY2	Brazilian_cedratvirus	4.9e-56	52.6
WP_005062158.1\|4267812_4268505_-	class I SAM-dependent methyltransferase	Q98VI8	Paramecium_bursaria_Chlorella_virus	3.7e-12	30.2
WP_005062160.1\|4268737_4269871_-	acyltransferase	A9YX16	Burkholderia_phage	1.2e-15	26.4
WP_005062162.1\|4270038_4271100_-	NAD-dependent epimerase/dehydratase family protein	A0A0E3IB24	Synechococcus_phage	1.6e-17	25.8
WP_005101662.1\|4271263_4272523_-	glycosyltransferase	A0A1L3KK54	Shahe_endorna-like_virus	1.6e-05	39.2
WP_005062164.1\|4272665_4272845_-	hypothetical protein	NA	NA	NA	NA
WP_005062166.1\|4272988_4273855_+	glucose-1-phosphate thymidylyltransferase RfbA	H9NC64	Sphingomonas_phage	2.8e-89	57.5

DBSCAN-SWA_6

4979820 : 4988192

Mycobacterium_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005117533.1\|4979820_4981290_+	serine hydrolase	A0A1J0GRK9	Mycobacterium_phage	9.4e-13	28.5
WP_005064642.1\|4981417_4982230_+	DUF1906 domain-containing protein	A0A2D1GEF2	Gordonia_phage	3.1e-50	49.1
WP_016894503.1\|4982278_4983475_-	LysM peptidoglycan-binding domain-containing protein	A0A1W6JL93	Lactococcus_phage	2.6e-05	47.3
WP_005064639.1\|4983904_4984753_+	N-acetylmuramoyl-L-alanine amidase	A0A2D1GEV9	Mycobacterium_phage	2.9e-67	56.1
WP_005101057.1\|4984919_4985222_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_005064637.1\|4985513_4985963_+	hypothetical protein	NA	NA	NA	NA
WP_005064636.1\|4985983_4987435_+	HAMP domain-containing histidine kinase	Q8QKV4	Ectocarpus_siliculosus_virus	2.9e-06	33.6
WP_005064635.1\|4987514_4988192_-	response regulator transcription factor	W8CYM9	Bacillus_phage	4.4e-26	31.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP014953

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection