CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP011162	Xanthomonas citri pv. aurantifolii strain FDC 1559 plasmid pXfc38, complete sequence	0 crisprs	NA	0	0
NZ_CP011160	Xanthomonas citri pv. aurantifolii strain FDC 1559 chromosome, complete genome	2 crisprs	cas3,DinG,csa3,DEDDh,WYL	5	27
NZ_CP011161	Xanthomonas citri pv. aurantifolii strain FDC 1559 plasmid pXfc43, complete sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP011160_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011160_1

29114-29410

Orphan

Consensus_repeat	Method
GTGGAAACGGTCAACGGCAGCATC	CRISPRCasFinder

5 spacers

WYL

The CRISPR arrays of NZ_CP011160_1

>merge|NZ_CP011160|1|29114-29410|CRISPRCasFinder
GTCAGCAAGGTCAACGGCAAGATCAGCGCAGATGCCGGCAAGACCTATGGCGCCCTGGAAACGGTCAACGGCTCCATCGAGATCGGTGCCGGTGCGCAAACCAAGAACGTGGAAACCGTCAACGGCGGCATCCGCATCGGCGACAACGCGCGTACCGGGGGCGTGGAAACGGTCAACGGCAGCATCCTCGCCGAGCGCGGCAGCCAGATCAGTGGCGGGGTGGAAACGGTCAACGGCAGCATCGGGCTGGTGGGAACCGAGCTCGGCAAGGGCATCGAGACGGTCAATGGCGACATC

>NZ_CP011160|1|1|29114-29410|CRISPRCasFinder
GTCAGCAAGGTCAACGGCAAGATC	AGCGCAGATGCCGGCAAGACCTATGGCGCC
CTGGAAACGGTCAACGGCTCCATC	GAGATCGGTGCCGGTGCGCAAACCAAGAAC
GTGGAAACCGTCAACGGCGGCATC	CGCATCGGCGACAACGCGCGTACCGGGGGC
GTGGAAACGGTCAACGGCAGCATC	CTCGCCGAGCGCGGCAGCCAGATCAGTGGCGGG
GTGGAAACGGTCAACGGCAGCATC	GGGCTGGTGGGAACCGAGCTCGGCAAGGGC
ATCGAGACGGTCAATGGCGACATC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011160.1\|WP_007968187.1\|22187_23528_-\|outer-membrane-protein-transport-protein	unknown	unknown	gnl\|CDD\|367457
NZ_CP011160.1\|WP_007971907.1\|26022_27549_-\|S41-family-peptidase	unknown	unknown	gnl\|CDD\|223864
NZ_CP011160.1\|WP_042805569.1\|24548_24869_+\|DUF1820-family-protein	unknown	unknown	gnl\|CDD\|370154
NZ_CP011160.1\|WP_042805567.1\|19419_19785_+\|DUF1330-domain-containing-protein	unknown	unknown	unknown
NZ_CP011160.1\|WP_088370743.1\|29806_31603_+\|M28-family-peptidase	unknown	unknown	gnl\|CDD\|349910
NZ_CP011160.1\|WP_007970250.1\|38832_39276_+\|PepSY-domain-containing-protein	unknown	unknown	gnl\|CDD\|379323
NZ_CP011160.1\|WP_007975321.1\|41835_42798_-\|IS1595-family-transposase	unknown	unknown	gnl\|CDD\|372298
NZ_CP011160.1\|WP_007970254.1\|35535_36609_+\|glycoside-hydrolase-family-5-protein	unknown	unknown	gnl\|CDD\|365907
NZ_CP011160.1\|WP_088370746.1\|43289_44377_+\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP011160.1\|WP_007971893.1\|18645_19371_+\|YafY-family-transcriptional-regulator	WYL	COG2378_WYL_CAS-I:CAS-III	gnl\|CDD\|225253
NZ_CP011160.1\|WP_162829046.1\|39673_40990_-\|type-III-effector-HopG1	unknown	unknown	unknown
NZ_CP011160.1\|WP_022557789.1\|27651_28950_-\|peptidoglycan-DD-metalloendopeptidase-family-protein	unknown	unknown	gnl\|CDD\|227278
NZ_CP011160.1\|WP_003482177.1\|23747_24440_+\|rhomboid-family-intramembrane-serine-protease	unknown	unknown	gnl\|CDD\|366759
NZ_CP011160.1\|WP_007971891.1\|16884_18345_-\|cardiolipin-synthase	unknown	unknown	gnl\|CDD\|234967
NZ_CP011160.1\|WP_007970257.1\|34167_35226_-\|NAD(P)-dependent-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176186
NZ_CP011160.1\|WP_007971897.1\|19908_21036_-\|PA0069-family-radical-SAM-protein	unknown	unknown	gnl\|CDD\|275263
NZ_CP011160.1\|WP_088370744.1\|32007_33095_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP011160.1\|WP_050780422.1\|37394_38531_+\|glycoside-hydrolase-family-5-protein	unknown	unknown	gnl\|CDD\|365907
NZ_CP011160.1\|WP_042805853.1\|45111_45459_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011160.1\|WP_007971900.1\|21221_21923_-\|2OG-Fe(II)-oxygenase	unknown	unknown	gnl\|CDD\|379309

Protein	Function_ID	Function_description	E-value
NZ_CP011160.1\|WP_007968187.1\|22187_23528_-\|outer-membrane-protein-transport-protein	gnl\|CDD\|367457	pfam03349, Toluene_X, Outer membrane protein transport protein (OMPP1/FadL/TodX). This family includes TodX from Pseudomonas putida F1 and TbuX from Ralstonia pickettii PKO1. These are membrane proteins of uncertain function that are involved in toluene catabolism. Related proteins involved in the degradation of similar aromatic hydrocarbons are also in this family, such as CymD. This family also includes FadL involved in translocation of long-chain fatty acids across the outer membrane. It is also a receptor for the bacteriophage T2.	1.79229e-134
NZ_CP011160.1\|WP_007971907.1\|26022_27549_-\|S41-family-peptidase	gnl\|CDD\|223864	COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane].	1.421e-127
NZ_CP011160.1\|WP_042805569.1\|24548_24869_+\|DUF1820-family-protein	gnl\|CDD\|370154	pfam08850, DUF1820, Domain of unknown function (DUF1820). This family includes small functionally uncharacterized proteins around 100 amino acids in length.	3.19071e-52
NZ_CP011160.1\|WP_088370743.1\|29806_31603_+\|M28-family-peptidase	gnl\|CDD\|349910	cd05660, M28_like_PA, M28 Zn-peptidase containing a protease-associated (PA) domain insert. Peptidase family M28 (also called aminopeptidase Y family), uncharacterized subfamily. The M28 family contains aminopeptidases as well as carboxypeptidases. They have co-catalytic zinc ions; each zinc ion is tetrahedrally co-ordinated, with three amino acid ligands plus activated water; one aspartate residue binds both metal ions. This subfamily is composed of uncharacterized proteins containing a protease-associated (PA) domain insert which may participate in substrate binding and/or promote conformational changes, influencing the stability and accessibility of the site to substrate.	1.09455e-120
NZ_CP011160.1\|WP_007970250.1\|38832_39276_+\|PepSY-domain-containing-protein	gnl\|CDD\|379323	pfam13670, PepSY_2, Peptidase propeptide and YPEB domain. This region is likely to have a protease inhibitory function (personal obs:C Yeats). The name is derived from Peptidase & Bacillus subtilis YPEB.	4.54103e-06
NZ_CP011160.1\|WP_007975321.1\|41835_42798_-\|IS1595-family-transposase	gnl\|CDD\|372298	pfam12762, DDE_Tnp_IS1595, ISXO2-like transposase domain. This domain probably functions as an integrase that is found in a wide variety of transposases, including ISXO2.	2.3734e-37
NZ_CP011160.1\|WP_007970254.1\|35535_36609_+\|glycoside-hydrolase-family-5-protein	gnl\|CDD\|365907	pfam00150, Cellulase, Cellulase (glycosyl hydrolase family 5).	5.54221e-62
NZ_CP011160.1\|WP_088370746.1\|43289_44377_+\|IS3-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	1.83591e-30
NZ_CP011160.1\|WP_007971893.1\|18645_19371_+\|YafY-family-transcriptional-regulator	gnl\|CDD\|225253	COG2378, COG2378, Predicted transcriptional regulator [Transcription].	2.45116e-54
NZ_CP011160.1\|WP_022557789.1\|27651_28950_-\|peptidoglycan-DD-metalloendopeptidase-family-protein	gnl\|CDD\|227278	COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning].	4.5771e-92
NZ_CP011160.1\|WP_003482177.1\|23747_24440_+\|rhomboid-family-intramembrane-serine-protease	gnl\|CDD\|366759	pfam01694, Rhomboid, Rhomboid family. This family contains integral membrane proteins that are related to Drosophila rhomboid protein. Members of this family are found in bacteria and eukaryotes. Rhomboid promotes the cleavage of the membrane-anchored TGF-alpha-like growth factor Spitz, allowing it to activate the Drosophila EGF receptor. Analysis has shown that Rhomboid-1 is an intramembrane serine protease (EC:3.4.21.105). Parasite-encoded rhomboid enzymes are also important for invasion of host cells by Toxoplasma and the malaria parasite.	1.19314e-25
NZ_CP011160.1\|WP_007971891.1\|16884_18345_-\|cardiolipin-synthase	gnl\|CDD\|234967	PRK01642, cls, cardiolipin synthetase; Reviewed.	2.63771e-151
NZ_CP011160.1\|WP_007970257.1\|34167_35226_-\|NAD(P)-dependent-alcohol-dehydrogenase	gnl\|CDD\|176186	cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CAD). Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	0
NZ_CP011160.1\|WP_007971897.1\|19908_21036_-\|PA0069-family-radical-SAM-protein	gnl\|CDD\|275263	TIGR04470, hypothetical_protein_ALIPUT_00462, radical SAM mobile pair protein B. Members of this family are the downstream member (B) of a pair of tandem-encoded radical SAM enzymes. Most of these radical SAM gene pairs have an additional upstream regulatory gene in the MarR family. Examples of high sequence identity (over 96 percent) from cassettes in several Treponema species of the oral cavity to those in multiple Firmicutes in the gut microbiome suggest recent lateral gene transfer, as might be expected for antibiotic resistance genes. The function is unknown.	8.08014e-22
NZ_CP011160.1\|WP_088370744.1\|32007_33095_-\|IS3-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	1.67693e-30
NZ_CP011160.1\|WP_050780422.1\|37394_38531_+\|glycoside-hydrolase-family-5-protein	gnl\|CDD\|365907	pfam00150, Cellulase, Cellulase (glycosyl hydrolase family 5).	2.74868e-59
NZ_CP011160.1\|WP_007971900.1\|21221_21923_-\|2OG-Fe(II)-oxygenase	gnl\|CDD\|379309	pfam13640, 2OG-FeII_Oxy_3, 2OG-Fe(II) oxygenase superfamily. This family contains members of the 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily.	1.10927e-07

>NZ_CP011160.1|WP_022557789.1|27651_28950_-|peptidoglycan-DD-metalloendopeptidase-family-protein
MPPSPAPLSRLPLAPATGRGRIWLAVGVLACTLLGSMGASAQSQRETERKLQQLRDELKTISADRRELEGKRGTAAQQLRQADEKVAKTARALSETEAAMRAQEQHLSSLQQERAQLQRGLQSQRTQLAALLRAADQVGRNAPLKVLLSQDTVGDATRMLADHRYVQNARAQRIHALTTQLDALATVEQDIATRRQALDAARAQQKAQAATLQKDRSQQAATVAQLDDRYKQRAEREKAIGQDAKALEQLLANLRAAAAKAEAERRAAARRAAAEAAAQAKRSKTERSDRPGKTPPKVIANAPAPKVGGLSWPVAGNLLARFNATLPDGHTSKGVLIGAPKGTTVTAVADGTVVFSDWMTGYGMILIVDHGNGYMSLYAHNDTLLRDAGASIKRGDAVAKVGSSGGQGVPALYFELRRNGQPVDPSSWLQRR
>NZ_CP011160.1|WP_007971907.1|26022_27549_-|S41-family-peptidase
MRVAVLSVALSLALFASPGWAQKAGPAAAQASADDPEANEAAVSKMPLDEIRRFVAVYNAVKQAYVDPVEDKKLMHAAVRGLLSDLDPHSTYFDKEDAEAFDEQATGAYDGIGVELLQQQQDNTLKVIAPIDDTPAARAGIRAGDVIVAIDGKPIDASKAMEPLRGESGSKVVLTIMRDKTPKPFDVTLQRETIRVASVRSKLLEPGYGYIRISTFQADTGADFQKNLKQLQAGGKLRGLVLDLRSNPGGLLTSAVQVADDLLDKGNIVSTRGRISISDAKFDATPGDLLNGAPVVVLVDAGSASASEVLAGALRDNKRARIIGSRTFGKGSVQTVLPLDNGDSVKLTTARYYTPSGKSIQASGIVPDVLLAPEPQPGDADAPASLTDYSEATLPGHLRGDDEGEEGYSAGDVLPGDGPITEALAELKQPGAAAKAQAARKAKAQAAQKAKAAKTGAEPKPAAARPATTDKPRSAEPAGKAKPATAPAAPAEPVQPTPPADKPAEPVN
>NZ_CP011160.1|WP_042805569.1|24548_24869_+|DUF1820-family-protein
MSKPLYKVTFLNHGKVYELYAREVTGSHLWGFNQIGELVFDVHDGLVVDPTEERLREEFGNTRTLHLPMQSIVRIEEVEKKGQSVIRDATTGGKVVTPFPSPIKPR
>NZ_CP011160.1|WP_003482177.1|23747_24440_+|rhomboid-family-intramembrane-serine-protease
MFVSLPSRKKPTPRWAVPLLFATVWLAYLWSISRPGEARNTLWLDWGALSSGVSNLGDWWATLRDGSVLRLFTALFLHADWSHLLGNLVFLLIFGLPAERILGPWRLLLLFLVGGAASNLAAIFAIGTPDRVIIGASGAVSALIGTYLALFPGAKLGVVLPLGVFLEFIRVPAPLLIGAWALLQVVFAYIGPAFGMVAWSAHIAGFVFGIVYGLYVRAAIARRLRKRHGF
>NZ_CP011160.1|WP_007968187.1|22187_23528_-|outer-membrane-protein-transport-protein
MSTASTLSRATLLAVGIAGVLAVGQAHGAAFQLKENSAKGLGRAFAGSGSAPDDASIIATNPAGMRQLDGRLFQADVSAISFSAKFQPDTAAYANGAPVSGGNGGDAGMIAPVPALYFHVPFGENDNMHLGTSLTVPFGFKTEYDRDWVGRYHGTKTELQAIDFNVAFSYDVNPYVSFGASVFAERLDIDLANAVDFGSVLAARRVPGFAPGSADGYSRIKGDSTEVGFTLGGLFSIDENTHIGFSYRSQVEHKITDGTADFTVPGSAAAVLSVAAPGTFVDTKGRATVKLPASATASFTHNVNEQWSIMADVTRTAWSKFDQVTVDFASNQPDSVLDFSYRDTTFASIGADYRLSDTVTLRGGLAYDQTPTTAEHRDVRVPDASRKWVSLGMSWRPSAQTEYNFGYTHLFTSDPTSDTRSATGDRLAGSYDVKGDVLAASINYKF
>NZ_CP011160.1|WP_007971900.1|21221_21923_-|2OG-Fe(II)-oxygenase
MSQPDFIQITDNAIAHEECVAIVQRMRQSQQLHPGRIGGGVFPDLKHSRDLRISGMAEWAEVENRLQQAVFEGVLTYLRQYPQALISPLMLQVTTADGTPHRLVAEDIVQMSDQALGDLARTCLRPGAINLQWYTADQGGYPYWHCELYPRDANADTLHRHLLWTLYLNDDFAQGETEFLFQQRKARPRTGSLLIAPTAFTHTHRGNRPVGGDKFIATSWILFQSAQALYGGE
>NZ_CP011160.1|WP_007971897.1|19908_21036_-|PA0069-family-radical-SAM-protein
MQKNSSPSASAAAERDVRSSRTVIKGRGTTAYVPGRFSVTTAVEIDDGWGALDADGETALRPKTVVAEEIARSIISRNNSPDIGFSQSVNPYRGCEHGCVYFFARPSHAYLDLSPGLDFETRIFAKPNAAALLRAEIARPSYQCSPIALGINTDAYQPAERRLHISRQCLEVLAQARHPVSFVTKAALIERDIDVLAEMAQHNLVSVYFSVTTLDNRLAAKMEPRAAAPHARLRAMQALHAAGVPVGVLVAPVIPMINDKELERILDAAAAHGARSAGYVLLRLPHELTQLWREWLELHYPDRAKHVMSLIQQMRGGKDYDSRFGKRMVGEGPFAELIAQRFSIAYRRLGFGRLPRLDTTQFRPPRPDTPQLDLF
>NZ_CP011160.1|WP_042805567.1|19419_19785_+|DUF1330-domain-containing-protein
MVAFSPNALSAFLDNQDTSAIVMLNLIRFQADGGRERYHRYLRLATPILARFDAHIVFSGDGLPVLTAGQAQAWDAVTLVQYPGRSAFKQMIADVEYQHAFEVGRSAIAEIVLQPFHGITL
>NZ_CP011160.1|WP_007971893.1|18645_19371_+|YafY-family-transcriptional-regulator
MSRTTRLFELLGLLRAHRRPVSAAALASELGVSQRSLYRDIDTLRALGAPLEGQAGVGYYLKPGFFLPSLAFSQEELDAVMLGLDWVKQRADPALARCGESALAKILSARKHGDGTGIDVAPPAILTAASTSEAVDHPQTAVLRDAIRRQCKLAIGYVDAQDTPSERIVWPIALVYFDDVRVLAAWCERRSAFRHFRVDRLQVRAVLKARYPQSRQALVKQWRQHDRDWRSLLTVSDTAQR
>NZ_CP011160.1|WP_007971891.1|16884_18345_-|cardiolipin-synthase
MLALAQGAWEWLATIPHLEALLLAAYVLYLLWIAGWIVLQKREPVATLSWVLSLAALPYLGLLIYYWLGPQKVKRQRLRRGRSRSGMESYSSVCPPDADCTELAKIAQSTTGLAPSSATEVHWLVDGAATYAAIIEAIRGARDHIHLEYYIFQPDQSGTAICAALMERARAGVKVRLLMDAIGSSAMTRRALRTLREAGVETAWFHPSQLLKPFKRPWLNLRTHRKVIVIDGRIGFTGGINVTDDENEQVRKQAYRDLHVRLQGHVVRSLQLVFLEDWLYATSQGRAAFHGQQLWPDDVPTRAQGTVDAQVLVSGPDSSWEAIHRLMVAAIHEAKHRVWLVTPYFVPGEAARMALTSAALGGLDVRLLVPRVSDSRLVTYAARSYFDELLEAGVRIYEYGPRMLHTKALLADDDVCIVGSANFDSRSFRLNFELSMLFRDQAVAAEMAGLIGTDLQQAQEVQFARHRPLWRSRLPEAFARLLSPLL
>NZ_CP011160.1|WP_088370743.1|29806_31603_+|M28-family-peptidase
MPRKILLCLAATLALAGCKREPADAPGAPAAQTPTESAPSAPVSRHTFSPDMTTGDFAELVKTLASDDFEGRGPGTPGEEKTVTYIRDQMQRIGLQPGNGDSWFQEVPMVETTADASTAPSLRSGEQTRTLAFGTDIVVGTRTGQAEVKLDNSELVFVGYGVDAPEQQWNDYAGQEWKGKTVVMFVNDPGFHTDDAKLFDGKRMTYYGRWTYKFEEAARKGAAAALIVHDTPGASYGWDVVKHSWSGPQYDLPAKDDPDPRLPVQGWISAETAKQLFADAGLDLAQAYKDASKRGFKPVPLKASWSVDLKSTIAQKTSRNVVGVLPGTSHADEAVLYMAHWDHLGKHPGESGDNIYNGAVDNATGVAGILEIADAFAHQDPKPARSVVFLAVTLEESGLLGSKYYVANPSFPLDKIAVVINLDAMSVAGRARDVTVVGMGSSELEDILKPLAAMQGRTLHAEATPQSGSYFRSDHFNFAKAGVPALYADGGEDLREGGTAAGRAAAEDYGRHRYHAPGDEYDAATWKLDGTIEDLQVVYGVGKEVAAGDRWPNWYPGNPFKAARDRMMAGRPGASAATAQPAEAASTAPQTNKAKSPH
>NZ_CP011160.1|WP_088370744.1|32007_33095_-|IS3-family-transposase
MKKSRFTDSQIIAVLKQAQAGAPVPELCREHGISSATFYKWRSKFGGMDVSMVARMKELEEENRRLKKMYAEAQLSTDLLKEALGKKMVRPSQRREMAQSAVTSGRTNIRHACQAFAVSETCFRYQAKASEQNARIADWLVRLTTAHRDWGFGLCYLYLRNVKGFGWNHKRVYRIYRELELNLRIKPKKRLVRERPEPLAVPEAINQVWSMDFMHDQLADGRSFRLFNVLDDFNREGLGIEVDLSLPSARVIRSLEQIIEWRGKPAVIRCDNGPEYISGALLSWAQRHGIRVEHIQPGKPQQNAYVERYNRTIRYAWLAQTLFDTIDQVQDKATRWLWTYNHERPNMALGGITPAMKLAMAA
>NZ_CP011160.1|WP_007970257.1|34167_35226_-|NAD(P)-dependent-alcohol-dehydrogenase
MSTAHAYAAQAADQPLAPFVFERRAPGPNDVQIDIAYCGVCHSDLHTARNEWHNTRYPSVPGHEIVGRVTAVGDAVTGFKVGDLAGVGCMVDSCRSCASCQEGEEQYCEQGFTGTYNGPMFGGGENTYGGYSDHIVVDQKYVLRITHSDNLAAVAPLLCAGITTYSPLAHWKVGPGQKVGVVGLGGLGHMAVKIAKAMGATVVLFTTSESKRADAMRLGASEVVISKDEAQMAAQYNTLDFILNTVAAPHNLDPFLNALKRDGAMVLVGVPEQSHPSPAVFNLVMKRRTLAGSLIGGIRQTQEMLDFCAKHNIVSDIETIRADQINEAYERMLKSDVKYRFVIDMATLDKAA
>NZ_CP011160.1|WP_007970254.1|35535_36609_+|glycoside-hydrolase-family-5-protein
MFRNPPHLSRLRTAALALTLIAAIPLVQAKEPAGPKKETAGLKYVGVNLSGAEFNSRKKPGTLFKDYTDPAASDFSYFAGKGMNTIRLPFLWERVQPELNGQLDQAQLGLIKKSLEAAKANKQYLILDLHNYATYSGKRIGTSDVPASALADLWRRLALEFKDDKAVIFGLMNEPNGISAPDWANAAQGTINAIRKTGAKNLILVPGTAYTGAHSWRSTSYGVSNAKALEILKDPGNNLAFEAHQYLDKDYSGTKPVCTSDSVGQEKLQGFTSWLRENKQKGFLGEFATANNPVCDKALEGMLTYMEKNSDVWLGWTWWAAGSWWKPDYPFTVQPGKDGSDKPQMAILSKYARRAGK
>NZ_CP011160.1|WP_050780422.1|37394_38531_+|glycoside-hydrolase-family-5-protein
MKFSITRTRRPRCRALSLLLLAAMPLAQAQSTTSLKYAGINLSGAEIKSSQRPGVLNIDYRYPAADEYAYFAGKHMNTVRLPILWERLQPTARGELDPAQLALLQQAVARAKAAGMYLVIDIHNYAKYYGYKIGSAEVPVATFTDLWRRLALAFNSDNAVMFGLMNEPNNISASEWAGAAQAAIDAIRRTGANNLILVPGALWTGAHSWYSPTTDGYSNATALTSIYDPLNRYAFEVHQYLDADSSGTSSTCVSSTIGAERLRNFTQWLRTNGKRGFLAEFGTANNAVCNQALQGMLAHMEANADVWLGWTWWAAGSWWNLSYAYNVHPNKDGTDKPQMAILSPQAALATRAPVAAAAARSAAASTSATRTSAARTTR
>NZ_CP011160.1|WP_007970250.1|38832_39276_+|PepSY-domain-containing-protein
MTQRLMKTALIGALALLSQGALAQAADKPTKALTSGEVTSMLTAKGYTKVHDVKFEHGVWTADARSGDGKDVDVHIDPVTGRIHGDQTTSKLSEADVRASLSTGGYADVHDLKFKDGLWKADAKRNGQKVELHVDPEDGHVVSVDND
>NZ_CP011160.1|WP_162829046.1|39673_40990_-|type-III-effector-HopG1
MKYVAGTAGAAYVYDNTANRFFLSTTSLHDGKQGFTSDARLQEAEKKAEAIYAEYHAHECPDKIEVKRTSLWPKLVGENAFVTMLDFRSATKVHLKELINTKEARDSIALNISCILGERIKPALLTEHGVVQAPVAFDITKQDDFELKNKYSLLGVPNNDTGSYGYASRSILNPFIEKGEKHHAQAIASDQALAPRDCVAALQPMLKNSQSLIPEAQFRAGQALLILRPLYCGPKTWGDAHKVLMPFLESKGLASTRENQRLGETRPFTPSDMEKGVARRNTSVAGPLLHELNMLIQKSIYKKDEEGMSDLRSKNLREMKYIPISHFRMNDDCTGFEDSSGLADSFTGYNVAAYINHARLLSGEDRLSKQDVVAVVGCLNAVYDNASSERHTLREIAHGCFVGAGYTVEDAEAFYKDVCKDSAREFYGGEALRAAKSN
>NZ_CP011160.1|WP_007975321.1|41835_42798_-|IS1595-family-transposase
MGINIVQFQPGLSLTEFVDRYGTEAKCYRALYRWRWPKGSRCPQCDGRARSRFRRDGQVYYQCRACRHQTTLRASTLLQSSKLPLRLWMQAIYLLTSSKTNLAALELKRHLGVTYKAAWRMKHKIMQAMTEREEPRKLKGFVQIDDAYLGGERNGGKRGRGSENKQPFVIAVQVDHNHEHPVFAVIEPVKAFDNASLKDWIARRLEPGCEVYSDGLACFRRLEEAGHAHTTLDTDGARAATEVQGARWLNVVLGNVKRAISGTYHAVRQAKYARRYLAEAAYRFNRRFRLEQMLPRLATALMRCTPCPESVLRMASNFHG
>NZ_CP011160.1|WP_088370746.1|43289_44377_+|IS3-family-transposase
MKKSRFTDSQIIAVLKQAQAGAPVPELCREHGISSATFYKWRSKFGGMDVSMVARMKELEQENRRLKKMYAEAQLSTDLLKEALGKKMVRPSQRREMAQSAVTSGRTNIRHACQAFAVSETCFRYQAKASEQNARIADWLVRLTTAHRDWGFGLCYLYLRNVKGFGWNHKRVYRIYRELELNLRIKPKKRLVRERPEPLAVPEAINQVWSMDFMHDQLADGRSFRLFNVLDDFNREGLGIEVDLSLPSARVIRSLEQIIEWRGKPAVIRCDNGPEYISGALLSWAQRHGIRVEHIQPGKPQQNAYVERYNRTIRYAWLAQTLFDTIDQVQDKATRWLWTYNHERPNMALGGITPAMKLAMAA
>NZ_CP011160.1|WP_042805853.1|45111_45459_-|hypothetical-protein
MNNYEQRIRWAIGLTMALAGASLIVTLILFIFYFAELHYSKVFFVTGSATATILAVIAQDRYNRFKALLVPNTFSTQEFNAILGKYKKYQTLGSPILLVLVIMGVVIGALGSLSN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP011160_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011160_2

247058-247158

Orphan

Consensus_repeat	Method
TCGGCCGAAGGGCGCACCTGCAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP011160_2

>merge|NZ_CP011160|2|247058-247158|CRISPRCasFinder
TCGGCCGAAGGACGCACCTGCACGGCGGCCAGGGTGCGGATGTCGCTGGTGCGTTCCAGGGTCTGCTGGGCGATCTGGTCGGCGGCCGGACGCACCTGGAC

>NZ_CP011160|2|2|247058-247158|CRISPRCasFinder
TCGGCCGAAGGACGCACCTGCAC	GGCGGCCAGGGTGCGGATGTCGCTGGTGCGTTCCAGGGTCTGCTGGGCGATCTGG
TCGGCGGCCGGACGCACCTGGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011160.1\|WP_007972044.1\|253896_255444_+\|winged-helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|294013
NZ_CP011160.1\|WP_005912222.1\|248068_249085_+\|3-oxoacyl-ACP-synthase-III	unknown	unknown	gnl\|CDD\|181732
NZ_CP011160.1\|WP_007972033.1\|244716_245946_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340883
NZ_CP011160.1\|WP_007972027.1\|237449_238046_-\|Ax21-family-protein	unknown	unknown	gnl\|CDD\|275096
NZ_CP011160.1\|WP_022557907.1\|243151_243904_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011160.1\|WP_007974735.1\|234756_235782_+\|NAD(P)-dependent-glycerol-3-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|234629
NZ_CP011160.1\|WP_007972045.1\|255643_256606_-\|serine-hydrolase	unknown	unknown	gnl\|CDD\|224594
NZ_CP011160.1\|WP_003488348.1\|246295_246772_-\|tRNA-(cytidine(34)-2'-O)-methyltransferase	unknown	unknown	gnl\|CDD\|349967
NZ_CP011160.1\|WP_173362038.1\|238419_240129_+\|ubiquinone-dependent-pyruvate-dehydrogenase	unknown	unknown	gnl\|CDD\|181661
NZ_CP011160.1\|WP_007972032.1\|244006_244624_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011160.1\|WP_007972029.1\|240178_241621_+\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP011160.1\|WP_007972030.1\|241605_242961_+\|sigma-54-dependent-Fis-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225114
NZ_CP011160.1\|WP_007972042.1\|252238_253888_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|236443
NZ_CP011160.1\|WP_007972041.1\|251534_251918_-\|YkgJ-family-cysteine-cluster-protein	unknown	unknown	gnl\|CDD\|223799
NZ_CP011160.1\|WP_007966372.1\|247646_247967_+\|DUF4156-domain-containing-protein	unknown	unknown	gnl\|CDD\|372679
NZ_CP011160.1\|WP_003468167.1\|258089_258248_+\|DUF1328-domain-containing-protein	unknown	unknown	gnl\|CDD\|227774
NZ_CP011160.1\|WP_007972046.1\|257014_258025_+\|NAD-dependent-epimerase/dehydratase-family-protein	unknown	unknown	gnl\|CDD\|187552
NZ_CP011160.1\|WP_088370753.1\|249196_250354_+\|Fic-family-protein	unknown	unknown	gnl\|CDD\|225718
NZ_CP011160.1\|WP_007972039.1\|250479_251382_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|179147
NZ_CP011160.1\|WP_088370746.1\|236059_237147_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|366234

Protein	Function_ID	Function_description	E-value
NZ_CP011160.1\|WP_007972044.1\|253896_255444_+\|winged-helix-turn-helix-domain-containing-protein	gnl\|CDD\|294013	cd00383, trans_reg_C, DNA-binding effector domain of two-component system response regulators. Bacteria and some eukaryotes use two-component signal transduction systems to detect and respond to changes in the environment. The systems consists of a sensor histidine kinase and a response regulator. The former autophosphorylates a histidine residue on detecting an external stimulus. The phosphate is then transferred to an invariant aspartate residue in a highly conserved receiver domain of the response regulator. Phosphorylation activates a variable effector domain of the response regulator, which triggers the cellular response. This C-terminal effector domain belongs to the winged helix-turn-helix family of transcriptional regulators and contains DNA and RNA polymerase binding sites. Several dimers or monomers bind head to tail to small tandem repeats upstream of the genes. The RNA polymerase binding sites interact with the alpha or sigma subunit of RNA polymerase.	4.67473e-19
NZ_CP011160.1\|WP_005912222.1\|248068_249085_+\|3-oxoacyl-ACP-synthase-III	gnl\|CDD\|181732	PRK09258, PRK09258, 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed.	0
NZ_CP011160.1\|WP_007972033.1\|244716_245946_+\|MFS-transporter	gnl\|CDD\|340883	cd17325, MFS_MdtG_SLC18_like, bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters. This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	5.52073e-20
NZ_CP011160.1\|WP_088370753.1\|249196_250354_+\|Fic-family-protein	gnl\|CDD\|225718	COG3177, COG3177, Fic family protein [Function unknown].	2.98125e-63
NZ_CP011160.1\|WP_007974735.1\|234756_235782_+\|NAD(P)-dependent-glycerol-3-phosphate-dehydrogenase	gnl\|CDD\|234629	PRK00094, gpsA, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase.	4.57783e-180
NZ_CP011160.1\|WP_007972045.1\|255643_256606_-\|serine-hydrolase	gnl\|CDD\|224594	COG1680, AmpC, Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms].	1.35734e-34
NZ_CP011160.1\|WP_003488348.1\|246295_246772_-\|tRNA-(cytidine(34)-2'-O)-methyltransferase	gnl\|CDD\|349967	cd18094, SpoU-like_TrmL, SAM-dependent tRNA methylase related to TrmL. tRNA (Um34/Cm34) methyltransferase TrmL catalyzes the methyl transfer from S-adenosyl-L-methionine (AdoMet) to the 2'-OH at position 34 in both tRNA(Leu)(CmAA) and tRNA(Leu)(cmnm5UmAA). It is part of the SpoU family of MTases, a subfamily of the SPOUT methyltransferase superfamily. The SPOUT methyltransferase superfamily is a large class of S-adenosyl-L-methionine (AdoMet or SAM)-dependent RNA MTases which are structurally characterized by a deep trefoil knot.	2.47465e-81
NZ_CP011160.1\|WP_173362038.1\|238419_240129_+\|ubiquinone-dependent-pyruvate-dehydrogenase	gnl\|CDD\|181661	PRK09124, PRK09124, ubiquinone-dependent pyruvate dehydrogenase.	0
NZ_CP011160.1\|WP_007972029.1\|240178_241621_+\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	1.62309e-31
NZ_CP011160.1\|WP_007972030.1\|241605_242961_+\|sigma-54-dependent-Fis-family-transcriptional-regulator	gnl\|CDD\|225114	COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms].	2.85809e-174
NZ_CP011160.1\|WP_007972042.1\|252238_253888_+\|AMP-binding-protein	gnl\|CDD\|236443	PRK09274, PRK09274, peptide synthase; Provisional.	0
NZ_CP011160.1\|WP_007972041.1\|251534_251918_-\|YkgJ-family-cysteine-cluster-protein	gnl\|CDD\|223799	COG0727, COG0727, Predicted Fe-S-cluster oxidoreductase [General function prediction only].	2.27067e-20
NZ_CP011160.1\|WP_007966372.1\|247646_247967_+\|DUF4156-domain-containing-protein	gnl\|CDD\|372679	pfam13698, DUF4156, Domain of unknown function (DUF4156). The function of this family is unknown but members are annotated as putative lipoprotein outer membrane proteins.	1.76533e-09
NZ_CP011160.1\|WP_003468167.1\|258089_258248_+\|DUF1328-domain-containing-protein	gnl\|CDD\|227774	COG5487, COG5487, Small integral membrane protein [Function unknown].	0.00222793
NZ_CP011160.1\|WP_007972046.1\|257014_258025_+\|NAD-dependent-epimerase/dehydratase-family-protein	gnl\|CDD\|187552	cd05241, 3b-HSD-like_SDR_e, 3beta-hydroxysteroid dehydrogenases (3b-HSD)-like, extended (e) SDRs. Extended SDR family domains belonging to this subgroup have the characteristic active site tetrad and a fairly well-conserved NAD(P)-binding motif. 3b-HSD catalyzes the NAD-dependent conversion of various steroids, such as pregnenolone to progesterone, or androstenediol to testosterone. This subgroup includes an unusual bifunctional 3b-HSD/C-4 decarboxylase from Arabidopsis thaliana, and Saccharomyces cerevisiae ERG26, a 3b-HSD/C-4 decarboxylase, involved in the synthesis of ergosterol, the major sterol of yeast. It also includes human 3 beta-HSD/HSD3B1 and C(27) 3beta-HSD/ [3beta-hydroxy-delta(5)-C(27)-steroid oxidoreductase; HSD3B7]. C(27) 3beta-HSD/HSD3B7 is a membrane-bound enzyme of the endoplasmic reticulum, that catalyzes the isomerization and oxidation of 7alpha-hydroxylated sterol intermediates, an early step in bile acid biosynthesis. Mutations in the human NSDHL (NAD(P)H steroid dehydrogenase-like protein) cause CHILD syndrome (congenital hemidysplasia with ichthyosiform nevus and limb defects), an X-linked dominant, male-lethal trait. Mutations in the human gene encoding C(27) 3beta-HSD underlie a rare autosomal recessive form of neonatal cholestasis. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid sythase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	2.51368e-82
NZ_CP011160.1\|WP_007972027.1\|237449_238046_-\|Ax21-family-protein	gnl\|CDD\|275096	TIGR04273, activator_of_XA21-mediated_immunity_Ax21, sulfation-dependent quorum factor, Ax21 family. This family consists of proteins closely related to Ax21 (Activator of XA21-mediated immunity), a protein that is secreted by a type I secretion system (RaxABC), and that appears to be sulfated on an N-terminal region tryosine in a motif LSYN. Ax21 acts in a quorum-sensing system. Homologous peptide-mediated quorum-sensing systems appear to exist in other species, such as the emerging opportunistic pathogen Stenotrophomonas maltophilia. Intriguingly, the rice genome encodes a receptor (XA21) for this protein that triggers innate immunity. [Cellular processes, Pathogenesis].	4.49673e-108
NZ_CP011160.1\|WP_007972039.1\|250479_251382_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|179147	PRK00870, PRK00870, haloalkane dehalogenase; Provisional.	3.47808e-47
NZ_CP011160.1\|WP_088370746.1\|236059_237147_-\|IS3-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	1.83591e-30

>NZ_CP011160.1|WP_003488348.1|246295_246772_-|tRNA-(cytidine(34)-2'-O)-methyltransferase
MSAPVLDVILFQPEIPPNTGNVIRLCANTGARLHLIEPLGFDLSDKQLKRAGLDYHEYAPLQVHADLPSALAAIAPKRVFALSTRSTVRYDTPQFADGDAFLFGPETRGLPAEVLESIPPQHRLRLPMRPDNRSLNLSNTVAVMVFEAWRQWNFAGGQ
>NZ_CP011160.1|WP_007972033.1|244716_245946_+|MFS-transporter
MPMTKARPRGTRALEALHFSVADVQDGLGPFLSVFLQSKGWSVAAIGTVMSVGGIAGMLATTPAGALVDATRRKRAVVVIGCLAILLATALIWLRPTSSGVVAAQIASALAAAGIGPALTGITLGLVHARGFDHQLARNQVANHAGNVLAAVLAGWLGWRYGFAAVFLLTAFFGALALMAVLAIPAAAIDHRAARGLASTNGGDALSGWRVLLTCRPLALLAVTLGLFHLGNAAMLPLYGMAIVAAHAGDPSALTATTIVVAQATMVVVALLAMRWIRVHGHWWVLLVAFMALPLRALVAASVIHGWGVFPVQILDGLGAGLQSVVVPALVARLLQGTGRVNVGQGAVMTVQGVGAALSPAFGGWLAHAFGYRIAFLSLGAIALLAVALWAGCRGMLQAGASVQAETML
>NZ_CP011160.1|WP_007972032.1|244006_244624_+|hypothetical-protein
MHWVDPDFLPATRGTLARFLLNPKADIDGLLLTDGTEVHTPPHLSEALLKALKPGSALTVRGLKPRDVEMLVALAIDPEGGKRILDEGPHGPHAKPKPKPPGKPSKPEVAQHSGTITRLLHGPHGQVHGVLLDDAVTVRFPPHAGGDFAKQLVVGKPLVAEGETKATPHGVLIHAHALGGKAATLKQIEHPPHGPAHKPKPKPKH
>NZ_CP011160.1|WP_022557907.1|243151_243904_+|hypothetical-protein
MMRQTVLAIALACTIGAAAAQVAAPPPPPAPNGPIGGPPAPPTPVAATPVSVSGTVERFLLNPNGDVDGLWLRDGTQVGFPPHLSSEVKAAVRAGDSVVVKGFRLGNLPVLQVSSIRSGRSGREVVDRPPTFGAAPPPPPTPGQLTPLQSDGTIHRLVYGPAGEVNGALVSDGTVVRMPPHLALQFADLLRVGAPLSASGLGVATPDGRAIEATQLGRDRSSLRALFTAPRPDGPLPPPPPGAPVPPAGR
>NZ_CP011160.1|WP_007972030.1|241605_242961_+|sigma-54-dependent-Fis-family-transcriptional-regulator
MARILIIDDDAAFRTTLQATLRSLGHTAVAAENGPDGLARLSEGGIDMAFVDFRMPGMDGIAVLRARLDDAQARQARQVPLVMLTAHVSSGNTIEAMTLGAFDHLVKPVGRADIVEVVERALLGRADAQAAATDALSASAEDDDALVGHSPAMRTVHKRIGLAAASDLPVLITGETGTGKELAARALHRASPRASAPFVAVNCAAIPLELMESELFGHRKGAFSGASSDRRGLIREADGGTLFLDEIGDMPLPMQAKLLRFLQEGEVTPLGGSGPQKVDVRVLAATHRDLAACVADGRFRSDLRYRLNVVPIELPPLRERGQDILLLAQHFLSVNAARAQSLSPAAQERLLAHRWPGNVRELRNVMQRSQVLVRGASIDAADLEEALGEAGEAPSNVASALTGTLPEAVAQLEKQMIQSALEQSQGNRAEAARRLGIHRQLLYRKLEEYGL
>NZ_CP011160.1|WP_007972029.1|240178_241621_+|HAMP-domain-containing-histidine-kinase
MPRSLLRQLLLIWMVIVAACLGVATMLYGLYRQTEGVRLEEARQQLGGQCARIVQRYAGASEAARRGDDGVGLAAVVVQLVLADAPGVEGGVWDLHKGFVAYAYPTYDGSDHKTDIPAAEWANIVNTAQQSVTTKQAAQYRRDGRREVLLISACPLASGSAAWTMTRVPASKADAWRPLVVGMLLIFAMVAISAIALGVLVRRWSQRLQRIQQALAADTETPHIPPTGTPELDRLGAAVNDYAQRNAQALAQTRRLADELSRHERLAALGRMTATVAHEIRNPIATMRLALENEIARDDATPDDAAHGELMLGQIRRLDGVVESLLGMVQPIRLHLETVVVQDWLATLLEPSPLPPGTPPPRVLLPAAPLRWTLDPQQLGRAVHNLLRNAAQHADPGSEVALQAEAVEGILQLQVCNRGAPIAEPIAAHLFEPFVSGRADGNGLGLALVREIARAHGGHARYAHADGLTHFILELPWRAS
>NZ_CP011160.1|WP_173362038.1|238419_240129_+|ubiquinone-dependent-pyruvate-dehydrogenase
MARFLAETLQSAGVERIWGVTGDSLNGLTDALREMQTIEWMHVRHEEVAAFAAGAEAAVTGQLAVCAGSCGPGNLHLINGLFDCHRSRQPVLAIAAHIPSSEIGLSYFQETHPQELFRECSHFVELVTNPAQLPEVLHRAMRSAILQQGVAVVVIPGDIALLEVDKHVSSAWPALRQPRVLPAAEDVRQLAELLQQSKAVTVLCGSGCAGAHDAVVALADTLGAPVVHALRGKEYVEWDNPFDVGMTGLIGFSSGYHAMLNCDTLLMLGTDFPYRQFYPKDATIVQVDRDPSALGRRTPLQLGIVADVGETIAALLPQLQRREERGFLEKSLAHYRKAREGLDDLAVPADPGEPLHPQFVTRLISQIADQDAVFTCDVGTPTVWAARYLRMNGKRRLLGSFNHGSMANAMPQALGAQAAFPGRQVISLSGDGGFAMLMGDFISLAQLNLPVKVVVFNNASLGFVAMEMKAAGYLDTGTELRNPDFAAMSNAMGILGIRVDESSQLERALRQAFAHSGPALVDVRVATQELAVPPAIKLEQAKGMGLYLLKAVMSGRGDEVIALVKTNLR
>NZ_CP011160.1|WP_007972027.1|237449_238046_-|Ax21-family-protein
MKTSLLALGLLAVLPFAASAAENLSYNFVEGDYVRTPTEGRDADGWGVKASYAIAPNFHVFGDYSKQNADDNNNVFENTDSDFQQWGVGVGFNHEIATSTDFVARVAYRKLDLDTPNINFDGYSVEAGLRNAFGEHFEVYALAGYEDFSKKRGIDIGDNFYGRLGAQVKLNQNWGINGDIRMDGDGNKEWSVGPRFSW
>NZ_CP011160.1|WP_088370746.1|236059_237147_-|IS3-family-transposase
MKKSRFTDSQIIAVLKQAQAGAPVPELCREHGISSATFYKWRSKFGGMDVSMVARMKELEQENRRLKKMYAEAQLSTDLLKEALGKKMVRPSQRREMAQSAVTSGRTNIRHACQAFAVSETCFRYQAKASEQNARIADWLVRLTTAHRDWGFGLCYLYLRNVKGFGWNHKRVYRIYRELELNLRIKPKKRLVRERPEPLAVPEAINQVWSMDFMHDQLADGRSFRLFNVLDDFNREGLGIEVDLSLPSARVIRSLEQIIEWRGKPAVIRCDNGPEYISGALLSWAQRHGIRVEHIQPGKPQQNAYVERYNRTIRYAWLAQTLFDTIDQVQDKATRWLWTYNHERPNMALGGITPAMKLAMAA
>NZ_CP011160.1|WP_007974735.1|234756_235782_+|NAD(P)-dependent-glycerol-3-phosphate-dehydrogenase
MSDLTHKIAVLGAGSWGTALAALLARHGHPTVLWGRDAAMVDTIDRTHENARYLPGIALPDSLRATTDLQAAVADATWILVVVPSHAFTETIRLIAPLRPAGAGVAWATKGFEPGSGRFLHEVARDILGPSVPLAVVTGPSFAKEVTLGLPTAITVHGDDAAFAQVVADAMHGPTFRAYTGDDMVGAELGGAMKNVLAVATGVADGMQLGLNARAGLITRGLNEMLRLAAVIGARPETLMGLAGLGDLVLTCTGDLSRNRRLGLALGRGQSLDEAIREIGQVVESVQTADEVMRQAEHHGIELPISNAVRAVLHGEITPEAGLKELLARERKPEYPQTLFT
>NZ_CP011160.1|WP_007966372.1|247646_247967_+|DUF4156-domain-containing-protein
MRVLMLSVLVATTTAACTWVPIEQSGKGVRVLPAGPVPAGCQQQGEVVVTVKSKVGFYNRNPLRVQEELETLARNEAPGANANAVQAQGQPADGSQRFNAFRCPPR
>NZ_CP011160.1|WP_005912222.1|248068_249085_+|3-oxoacyl-ACP-synthase-III
MLFQNVSIAGLAHVDAPHTLTSKEINERLQPTYDRLGIKTDVLGDVAGIHARRLWDQDVQASDAATQAARKALIDAGIGIEKIGLLVNTSVSRDYLEPSTASIVSGNLGVGDHCVTFDVANACLAFINGMDIAARMLERGEIDYALVVDGETANLVYEKTLERMTSPDVTEEEFRNELAALTLGCGAAAMVMARTELVPDAPRYKGGVTRSATEWNKLCRGNLDRMVTDTRLLLIEGIKLAQKTFMAARQVLGWAVDELDQFVIHQVSRPHTAAFVKSFGIDPAKVMTIFGEHGNIGPASVPIVLSKLKELGRLKKGDRIALLGIGSGLNCSMAEVVW
>NZ_CP011160.1|WP_088370753.1|249196_250354_+|Fic-family-protein
MPHRTTGHYVAGALAGSRYQAFVPGPLPPVPALDFAQVELVVRKERADQALGRLEGITLMLPDPELLLHQYVRKEALLSSQIEGAQSSLSDLLLFEMDAAPGVPMDDVEEISNYVAALNHGLRRLREDDFPLSLRLIREMHALLLQGGRGASKQPGEFRRSQVWVGAASPALAHFVSPPPDAVPGTLAALEQFLHAPPGQIPPLVKAALAHVQFETIHPFSDGHGRLGRLLITLILCSEGVLRELSLYFKRRRADYYDRLNAVRLNGDWEGWLGFFLDGVAETAQQAVDAAQRLLALLARDRARIAALGKRVGNVGLVFEQFARRVVLAVPQVAPHLSLSVPTIRAAVRTLQELKIVNKLTGQQRHRIFAYQAYLDILSEGAQPL
>NZ_CP011160.1|WP_007972039.1|250479_251382_+|alpha/beta-fold-hydrolase
MNYPGYPFTPKRLDVRPGVAMSYLDEGPRDGEVVVMLHGNPSWSYLWRHLVSGLSDRYRCIVPDHIGMGLSDKPDDAPDAQPRYDYTLQSRVDDLDSLLRHLGITGAVTLAVHDWGGMIGFGWALSHHAQVKRLVITNTAAFPLPAEKPMPWQIAMGRHWRPGEWFIRTFNAFSSGASWLGVSRRMPSEVRRAYVAPYNNWRNRISTIRFMQDIPLSPADKGWSLLERSAQALASFADRPAFIAWGLRDICFDKHFLAGFRKALPQAEVTAFDDANHYVLEDKHEVLVPAIRAFLERNPL
>NZ_CP011160.1|WP_007972041.1|251534_251918_-|YkgJ-family-cysteine-cluster-protein
MAHPCLTCGACCAYFRVSFHWSEADPALGGRVPIELTEALRTHERVMRGTSQSQPRCIALDAEIGRYSRCSIHDRRPSSCAAVPASLEFGERSAQCDKSRLAHGLHALTDADWVGVDDAQRNPLPPV
>NZ_CP011160.1|WP_007972042.1|252238_253888_+|AMP-binding-protein
MTTLCNIAATLPQLARERPDQIAIRCPGGRGANGFAAYDVTLSYAELDARSDAIAAGLARHGIGRGSRAVVMVRPSPEFFLLMFALFKAGAVPVLVDPGIDKRALKQCLDEAQPQAFIGIALAQLARRLLRWARSAKQIVTVGGRYGWGGVTLARVERDGAGAGSQLADTGPDDVAAILFTSGSTGVPKGVVYRHRHFVGQIELLRNAFGMQPGGVDLPTFPPFALFDPALGLTSVIPDMDPTRPGSADPRKLHDAINRFGVTQLFGSPALMRVLADYGQPLPDVRLATSAGAPVPPDVVAKLRALLPADAQFWTPYGATECLPVAAIEGRTLDATRAATEAGAGTCVGHVVPPNQVRIIAIDDAAIADWSGVRVLATGEVGEITVAGPTATDAYFNRDAATRIAKIRERCSDGSERVVHRMGDVGYFDAEGRLWFCGRKTHRVEAASGPLYTEQVEPVFNVHPQVRRTALVGVGAPGQQQPVLCVELQPGVSASAFAQVESDLRALGAAHPHTAGVARFLRHSGFPVDIRHNAKIGRETLAVWATQQR
>NZ_CP011160.1|WP_007972044.1|253896_255444_+|winged-helix-turn-helix-domain-containing-protein
MRARYRLDDLRIDIARQRVERDGVAFEVTGLSFRLLHYLLQQGQRVVDFDELIQHVWAPALVNEETVTQRVRLLRQALGDDSRQPRYLRSVRGQGYQLCVPVQQEQVPPAMRRHYAWPVAAVAALVCIGAGVIGWLQTRDAPPAAAALVQRAAYYAGIGQRDDNDRAIDLYGQRLQQAPDDRQAQLGLSRAYSARVCQYDGDAVYAARALQLANGVVTAQPDLAAAHAARGYALDCQGRNADALAAYEQALQLDADADAVRGSAAYLYERRGKLVQALTANLAVRDPTRVRFLPIQIASNLSLLGYAGAAETRYRKNFQLYPDDPFSNLAWPTFLFEHGRAAEAETALNASLNRGTAYAGLSVLQAELAWARGDESLARQAALHAIQLRPQGSFAQTVAWAVHAQPLPTPAVLRMRAQELLNSVERGGDPFDAIDAAVLLLCADAPEVAMRALQRAETAGYRNAGYLRQSPLLKPLRRSPEFIALLARIDADLAAQRAQLRRRNLLPTDAVSGSN
>NZ_CP011160.1|WP_007972045.1|255643_256606_-|serine-hydrolase
MEQALADDLVPSTTSVLIVRDGVLVYEKYLGDATRETLHDTRSLTKSVTALLVGAAIERKLLPSAQAKVFDYFGDRQWQHPDPRKRAITVEDLLTMSSQLECNDDNEFSAGNEERMYLSADWTQFALDLPIRGYAPWMQRPEHSPYGRAFSYCTAGSFLLGALLEKATGQPLRAFAGEVLETPLGIKNVQWTVSSEGVGMGGGGTRYRSRDLAKLGQLLVAQGRWQGRQVIPADWIRAMTRVQAQAREDADYGYLTWHFRFPVHRVQRDTWAMSGNGGNYVFVVPAERLLVVLTRSAYNTRQMHQQSQRVLTDYVLKALP
>NZ_CP011160.1|WP_007972046.1|257014_258025_+|NAD-dependent-epimerase/dehydratase-family-protein
MKVLVTGGGGFLGQALCRGLRARGHEVVSFQRGDYPVLQRLGVGQIRGDLADPQAVRHAFAGIDAVFHNAAKAGAWGSYDSYHQANVVGTQNVIEACRANGVPRLIYTSTPSVTHRATNPVEGLGADEVPYGDDLRAAYAATKAIAERAVLAANDAQLATVALRPRLIWGPGDNHLLPRLAARARAGRLRMVGDGGNLVDSTYIDNAAQAHFDAFQHLAVGAACAGKAYFISNGEPLPMRELLNRLLAAVDAPAVTRSLSFNTAYRIGAVCETLWPLLRLPGEVPLTRFLVEQLCTPHWYSMEPARRDFGYVPRISIEEGLQRLRSSSSNDIAITR
>NZ_CP011160.1|WP_003468167.1|258089_258248_+|DUF1328-domain-containing-protein
MLHYAIIFFVIAIIAAVLGFSGIAGAATNIAWILFVVFLILAVISMFRRGKV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP011160_1	1.1\|29138\|30\|NZ_CP011160\|CRISPRCasFinder	29138-29167	30	NZ_CP044217	Mesorhizobium sp. NIBRBAC000500504 plasmid unnamed, complete sequence	110715-110744	6	0.8
NZ_CP011160_1	1.1\|29138\|30\|NZ_CP011160\|CRISPRCasFinder	29138-29167	30	NC_012811	Methylorubrum extorquens AM1 megaplasmid, complete sequence	847803-847832	6	0.8
NZ_CP011160_1	1.2\|29192\|30\|NZ_CP011160\|CRISPRCasFinder	29192-29221	30	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	841350-841379	6	0.8
NZ_CP011160_1	1.2\|29192\|30\|NZ_CP011160\|CRISPRCasFinder	29192-29221	30	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	841096-841125	6	0.8
NZ_CP011160_1	1.2\|29192\|30\|NZ_CP011160\|CRISPRCasFinder	29192-29221	30	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	741215-741244	6	0.8
NZ_CP011160_1	1.2\|29192\|30\|NZ_CP011160\|CRISPRCasFinder	29192-29221	30	NZ_CP023000	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence	513843-513872	6	0.8
NZ_CP011160_1	1.2\|29192\|30\|NZ_CP011160\|CRISPRCasFinder	29192-29221	30	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	811281-811310	6	0.8
NZ_CP011160_1	1.2\|29192\|30\|NZ_CP011160\|CRISPRCasFinder	29192-29221	30	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	740330-740359	6	0.8
NZ_CP011160_1	1.2\|29192\|30\|NZ_CP011160\|CRISPRCasFinder	29192-29221	30	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	742908-742937	6	0.8
NZ_CP011160_1	1.2\|29192\|30\|NZ_CP011160\|CRISPRCasFinder	29192-29221	30	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	742897-742926	6	0.8
NZ_CP011160_1	1.2\|29192\|30\|NZ_CP011160\|CRISPRCasFinder	29192-29221	30	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	741202-741231	6	0.8
NZ_CP011160_1	1.2\|29192\|30\|NZ_CP011160\|CRISPRCasFinder	29192-29221	30	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	741221-741250	6	0.8
NZ_CP011160_1	1.2\|29192\|30\|NZ_CP011160\|CRISPRCasFinder	29192-29221	30	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	741199-741228	6	0.8
NZ_CP011160_1	1.2\|29192\|30\|NZ_CP011160\|CRISPRCasFinder	29192-29221	30	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	841419-841448	6	0.8
NZ_CP011160_1	1.2\|29192\|30\|NZ_CP011160\|CRISPRCasFinder	29192-29221	30	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	841418-841447	6	0.8
NZ_CP011160_1	1.2\|29192\|30\|NZ_CP011160\|CRISPRCasFinder	29192-29221	30	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	841403-841432	6	0.8
NZ_CP011160_1	1.2\|29192\|30\|NZ_CP011160\|CRISPRCasFinder	29192-29221	30	NZ_CP032297	Rahnella aquatilis strain ZF7 plasmid pRAZF7, complete sequence	533041-533070	6	0.8
NZ_CP011160_1	1.2\|29192\|30\|NZ_CP011160\|CRISPRCasFinder	29192-29221	30	NC_017060	Rahnella aquatilis HX2 plasmid PRA1, complete sequence	112243-112272	6	0.8
NZ_CP011160_1	1.2\|29192\|30\|NZ_CP011160\|CRISPRCasFinder	29192-29221	30	NC_015062	Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence	115413-115442	6	0.8
NZ_CP011160_1	1.2\|29192\|30\|NZ_CP011160\|CRISPRCasFinder	29192-29221	30	NZ_CP034838	Rahnella aquatilis strain KM12 plasmid pKM12v1, complete sequence	115691-115720	6	0.8
NZ_CP011160_1	1.2\|29192\|30\|NZ_CP011160\|CRISPRCasFinder	29192-29221	30	NZ_CP034839	Rahnella aquatilis strain KM25 plasmid pKM12v2, complete sequence	115691-115720	6	0.8
NZ_CP011160_1	1.2\|29192\|30\|NZ_CP011160\|CRISPRCasFinder	29192-29221	30	NZ_CP034837	Rahnella aquatilis strain KM05 plasmid pKM05, complete sequence	93604-93633	6	0.8
NZ_CP011160_1	1.1\|29138\|30\|NZ_CP011160\|CRISPRCasFinder	29138-29167	30	NZ_CP028969	Aminobacter sp. MSH1 plasmid pUSP1, complete sequence	120445-120474	7	0.767
NZ_CP011160_1	1.1\|29138\|30\|NZ_CP011160\|CRISPRCasFinder	29138-29167	30	NZ_CP026266	Aminobacter sp. MSH1 plasmid pAM01, complete sequence	117739-117768	7	0.767
NZ_CP011160_1	1.1\|29138\|30\|NZ_CP011160\|CRISPRCasFinder	29138-29167	30	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	813583-813612	7	0.767
NZ_CP011160_1	1.1\|29138\|30\|NZ_CP011160\|CRISPRCasFinder	29138-29167	30	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	813131-813160	7	0.767
NZ_CP011160_1	1.3\|29246\|30\|NZ_CP011160\|CRISPRCasFinder	29246-29275	30	NZ_CP015279	Mycobacterium chimaera strain DSM 44623 plasmid unnamed 1, complete sequence	150331-150360	7	0.767
NZ_CP011160_1	1.3\|29246\|30\|NZ_CP011160\|CRISPRCasFinder	29246-29275	30	NZ_CP015280	Mycobacterium chimaera strain DSM 44623 plasmid unnamed 2, complete sequence	81611-81640	7	0.767
NZ_CP011160_1	1.4\|29300\|33\|NZ_CP011160\|CRISPRCasFinder	29300-29332	33	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1614843-1614875	7	0.788
NZ_CP011160_1	1.5\|29357\|30\|NZ_CP011160\|CRISPRCasFinder	29357-29386	30	NZ_CP023712	Rhodococcus ruber strain YC-YT1 plasmid unnamed1, complete sequence	83288-83317	7	0.767
NZ_CP011160_1	1.1\|29138\|30\|NZ_CP011160\|CRISPRCasFinder	29138-29167	30	NC_027204	Sinorhizobium phage phiM12, complete genome	74902-74931	8	0.733
NZ_CP011160_1	1.1\|29138\|30\|NZ_CP011160\|CRISPRCasFinder	29138-29167	30	KR052482	Sinorhizobium phage phiN3, complete genome	76608-76637	8	0.733
NZ_CP011160_1	1.1\|29138\|30\|NZ_CP011160\|CRISPRCasFinder	29138-29167	30	KR052481	Sinorhizobium phage phiM19, complete genome	72551-72580	8	0.733
NZ_CP011160_1	1.1\|29138\|30\|NZ_CP011160\|CRISPRCasFinder	29138-29167	30	KR052480	Sinorhizobium phage phiM7, complete genome	72291-72320	8	0.733
NZ_CP011160_1	1.1\|29138\|30\|NZ_CP011160\|CRISPRCasFinder	29138-29167	30	NZ_CP021033	Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence	58430-58459	8	0.733
NZ_CP011160_1	1.3\|29246\|30\|NZ_CP011160\|CRISPRCasFinder	29246-29275	30	NZ_CP017244	Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence	934481-934510	8	0.733
NZ_CP011160_1	1.5\|29357\|30\|NZ_CP011160\|CRISPRCasFinder	29357-29386	30	NZ_CP050094	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b4, complete sequence	380720-380749	8	0.733
NZ_CP011160_1	1.2\|29192\|30\|NZ_CP011160\|CRISPRCasFinder	29192-29221	30	NZ_CP013739	Streptomyces globisporus C-1027 plasmid SGLP1, complete sequence	114529-114558	9	0.7
NZ_CP011160_1	1.4\|29300\|33\|NZ_CP011160\|CRISPRCasFinder	29300-29332	33	MH271303	Microbacterium phage MementoMori, complete genome	20739-20771	9	0.727
NZ_CP011160_1	1.4\|29300\|33\|NZ_CP011160\|CRISPRCasFinder	29300-29332	33	MN813682	Microbacterium phage Matzah, complete genome	21015-21047	9	0.727
NZ_CP011160_1	1.4\|29300\|33\|NZ_CP011160\|CRISPRCasFinder	29300-29332	33	MK937591	Microbacterium phage Cinna, complete genome	21039-21071	9	0.727
NZ_CP011160_1	1.4\|29300\|33\|NZ_CP011160\|CRISPRCasFinder	29300-29332	33	NZ_CP023152	Mycobacterium chimaera strain FLAC0070 plasmid pFLAC0070_1, complete sequence	116466-116498	10	0.697
NZ_CP011160_1	1.4\|29300\|33\|NZ_CP011160\|CRISPRCasFinder	29300-29332	33	NZ_AP012556	Mycobacterium avium subsp. hominissuis TH135 plasmid pMAH135, complete sequence	22147-22179	10	0.697
NZ_CP011160_1	1.4\|29300\|33\|NZ_CP011160\|CRISPRCasFinder	29300-29332	33	NC_016588	Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence	72444-72476	10	0.697

1. spacer 1.1|29138|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP044217 (Mesorhizobium sp. NIBRBAC000500504 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

agcgcagatgccggcaagacctatggcgcc	CRISPR spacer
aatgacgattcaggcaagacctatggcgcc	Protospacer
*..*  *** * ******************

2. spacer 1.1|29138|30|NZ_CP011160|CRISPRCasFinder matches to NC_012811 (Methylorubrum extorquens AM1 megaplasmid, complete sequence) position: , mismatch: 6, identity: 0.8

agcgcagat----gccggcaagacctatggcgcc	CRISPR spacer
----ctgatcggggccggcaagaccgatggcgcc	Protospacer
    * ***    ************ ********

3. spacer 1.2|29192|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

4. spacer 1.2|29192|30|NZ_CP011160|CRISPRCasFinder matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

5. spacer 1.2|29192|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

6. spacer 1.2|29192|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP023000 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gcattgggtgccggtgcgcaagccaacaac	Protospacer
* . * ***************.**** ***

7. spacer 1.2|29192|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

8. spacer 1.2|29192|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

9. spacer 1.2|29192|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

10. spacer 1.2|29192|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

11. spacer 1.2|29192|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

12. spacer 1.2|29192|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

13. spacer 1.2|29192|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

14. spacer 1.2|29192|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

15. spacer 1.2|29192|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

16. spacer 1.2|29192|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

17. spacer 1.2|29192|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP032297 (Rahnella aquatilis strain ZF7 plasmid pRAZF7, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gataactttgccggtgcgcaaatcaagaaa	Protospacer
** * *  **************.******

18. spacer 1.2|29192|30|NZ_CP011160|CRISPRCasFinder matches to NC_017060 (Rahnella aquatilis HX2 plasmid PRA1, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gataactttgccggtgcgcaaatcaagaaa	Protospacer
** * *  **************.******

19. spacer 1.2|29192|30|NZ_CP011160|CRISPRCasFinder matches to NC_015062 (Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gataactttgccggtgcgcaaatcaagaaa	Protospacer
** * *  **************.******

20. spacer 1.2|29192|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP034838 (Rahnella aquatilis strain KM12 plasmid pKM12v1, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gataactttgccggtgcgcaaatcaagaaa	Protospacer
** * *  **************.******

21. spacer 1.2|29192|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP034839 (Rahnella aquatilis strain KM25 plasmid pKM12v2, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gataactttgccggtgcgcaaatcaagaaa	Protospacer
** * *  **************.******

22. spacer 1.2|29192|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP034837 (Rahnella aquatilis strain KM05 plasmid pKM05, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gataactttgccggtgcgcaaatcaagaaa	Protospacer
** * *  **************.******

23. spacer 1.1|29138|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP028969 (Aminobacter sp. MSH1 plasmid pUSP1, complete sequence) position: , mismatch: 7, identity: 0.767

agcgcagatgccggcaagacctatggcgcc	CRISPR spacer
tccggctatgtcggcaagacctatcgcgcc	Protospacer
  **   ***.************* *****

24. spacer 1.1|29138|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP026266 (Aminobacter sp. MSH1 plasmid pAM01, complete sequence) position: , mismatch: 7, identity: 0.767

agcgcagatgccggcaagacctatggcgcc	CRISPR spacer
tccggctatgtcggcaagacctatcgcgcc	Protospacer
  **   ***.************* *****

25. spacer 1.1|29138|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 7, identity: 0.767

agcgcagatgccggcaagacctatggcgcc	CRISPR spacer
cgacgaaatgccggcaagaccgatggcggc	Protospacer
 *   *.************** ****** *

26. spacer 1.1|29138|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 7, identity: 0.767

agcgcagatgccggcaagacctatggcgcc	CRISPR spacer
cgacgaaatgccggcaagaccgatggcggc	Protospacer
 *   *.************** ****** *

27. spacer 1.3|29246|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP015279 (Mycobacterium chimaera strain DSM 44623 plasmid unnamed 1, complete sequence) position: , mismatch: 7, identity: 0.767

cgcatcggcgacaacgcgcgtaccgggggc	CRISPR spacer
atcaccggcgacaacgcgcgcaccgccgcc	Protospacer
  **.***************.****  * *

28. spacer 1.3|29246|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP015280 (Mycobacterium chimaera strain DSM 44623 plasmid unnamed 2, complete sequence) position: , mismatch: 7, identity: 0.767

cgcatcggcgacaacgcgcgtaccgggggc	CRISPR spacer
atcaccggcgacaacgcgcgcaccgccgcc	Protospacer
  **.***************.****  * *

29. spacer 1.4|29300|33|NZ_CP011160|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.788

ctcgccgagcgcggcagccagatcagtggcggg	CRISPR spacer
ttcgtcgagcgcggcagccagatcatggggctg	Protospacer
.***.********************  **   *

30. spacer 1.5|29357|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP023712 (Rhodococcus ruber strain YC-YT1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gggctggtgggaaccgagctcggcaagggc	CRISPR spacer
ggcgagctgggcaccgagctcggcaaggtg	Protospacer
**   * **** ****************

31. spacer 1.1|29138|30|NZ_CP011160|CRISPRCasFinder matches to NC_027204 (Sinorhizobium phage phiM12, complete genome) position: , mismatch: 8, identity: 0.733

agcgcagatgccggcaagacctatggcgcc	CRISPR spacer
gacgaagatgacggcaagacctatgaaacg	Protospacer
..** ***** **************. .*

32. spacer 1.1|29138|30|NZ_CP011160|CRISPRCasFinder matches to KR052482 (Sinorhizobium phage phiN3, complete genome) position: , mismatch: 8, identity: 0.733

agcgcagatgccggcaagacctatggcgcc	CRISPR spacer
gacgaagatgacggcaagacctatgaaacg	Protospacer
..** ***** **************. .*

33. spacer 1.1|29138|30|NZ_CP011160|CRISPRCasFinder matches to KR052481 (Sinorhizobium phage phiM19, complete genome) position: , mismatch: 8, identity: 0.733

agcgcagatgccggcaagacctatggcgcc	CRISPR spacer
gacgaagatgacggcaagacctatgaaacg	Protospacer
..** ***** **************. .*

34. spacer 1.1|29138|30|NZ_CP011160|CRISPRCasFinder matches to KR052480 (Sinorhizobium phage phiM7, complete genome) position: , mismatch: 8, identity: 0.733

agcgcagatgccggcaagacctatggcgcc	CRISPR spacer
gacgaagatgacggcaagacctatgaaacg	Protospacer
..** ***** **************. .*

35. spacer 1.1|29138|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP021033 (Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence) position: , mismatch: 8, identity: 0.733

agcgcagatgccggcaagacctatggcgcc	CRISPR spacer
cgcaacgatgccggcgagacctatggcctt	Protospacer
 **.  *********.*********** ..

36. spacer 1.3|29246|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP017244 (Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence) position: , mismatch: 8, identity: 0.733

cgcatcggcgacaacgcgcgtaccgggggc	CRISPR spacer
cgcagcggcgacaacgcgcgcaccatcttg	Protospacer
**** ***************.***.

37. spacer 1.5|29357|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP050094 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b4, complete sequence) position: , mismatch: 8, identity: 0.733

gggctggtgggaaccgagctcggcaagggc	CRISPR spacer
ctgctggtgggaatcgagttcggcaccgca	Protospacer
  ***********.****.******  *

38. spacer 1.2|29192|30|NZ_CP011160|CRISPRCasFinder matches to NZ_CP013739 (Streptomyces globisporus C-1027 plasmid SGLP1, complete sequence) position: , mismatch: 9, identity: 0.7

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
cagagcggtgccggtgcgcatacctctggg	Protospacer
 *** *************** ***   ..

39. spacer 1.4|29300|33|NZ_CP011160|CRISPRCasFinder matches to MH271303 (Microbacterium phage MementoMori, complete genome) position: , mismatch: 9, identity: 0.727

ctcgccgagcgcggcagccagatcagtggcggg	CRISPR spacer
ctcgccgagcgcggcatcccgatcctctccctg	Protospacer
**************** ** ****  .  *  *

40. spacer 1.4|29300|33|NZ_CP011160|CRISPRCasFinder matches to MN813682 (Microbacterium phage Matzah, complete genome) position: , mismatch: 9, identity: 0.727

ctcgccgagcgcggcagccagatcagtggcggg	CRISPR spacer
ctcgccgagcgcggcatcccgatcctctccctg	Protospacer
**************** ** ****  .  *  *

41. spacer 1.4|29300|33|NZ_CP011160|CRISPRCasFinder matches to MK937591 (Microbacterium phage Cinna, complete genome) position: , mismatch: 9, identity: 0.727

ctcgccgagcgcggcagccagatcagtggcggg	CRISPR spacer
ctcgccgagcgcggcatcccgatcctctccctg	Protospacer
**************** ** ****  .  *  *

42. spacer 1.4|29300|33|NZ_CP011160|CRISPRCasFinder matches to NZ_CP023152 (Mycobacterium chimaera strain FLAC0070 plasmid pFLAC0070_1, complete sequence) position: , mismatch: 10, identity: 0.697

ctcgccgagcgcggcagccagatcagtggcggg	CRISPR spacer
gccgccgagcgcagcagcccgatcagcccgtag	Protospacer
 .**********.****** ******.    .*

43. spacer 1.4|29300|33|NZ_CP011160|CRISPRCasFinder matches to NZ_AP012556 (Mycobacterium avium subsp. hominissuis TH135 plasmid pMAH135, complete sequence) position: , mismatch: 10, identity: 0.697

ctcgccgagcgcggcagccagatcagtggcggg	CRISPR spacer
gccgccgagcgcagcagcccgatcagcccgtag	Protospacer
 .**********.****** ******.    .*

44. spacer 1.4|29300|33|NZ_CP011160|CRISPRCasFinder matches to NC_016588 (Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence) position: , mismatch: 10, identity: 0.697

ctcgccgagcgcggcagccagatcagtggcggg	CRISPR spacer
ctcggcgagcgcggcggccagatcctcctccat	Protospacer
**** **********.********  .  * .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2899 : 79046

Leptospira_phage(40.0%)

transposase,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_098477673.1\|2899_4001_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6
WP_007971883.1\|4967_6074_+	DNA replication/repair protein RecF	NA	NA	NA	NA
WP_007971884.1\|6188_8633_+	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	1.6e-113	34.7
WP_007971885.1\|8700_9537_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_005912440.1\|9721_10528_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_007968206.1\|10805_11999_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_003482203.1\|12266_12824_+	energy transducer TonB	NA	NA	NA	NA
WP_007971888.1\|12909_13671_+	MotA/TolQ/ExbB proton channel family protein	NA	NA	NA	NA
WP_005912447.1\|13717_14140_+	biopolymer transporter ExbD	NA	NA	NA	NA
WP_005912449.1\|14143_14557_+	biopolymer transporter ExbD	NA	NA	NA	NA
WP_007971889.1\|15105_15513_+	biopolymer transporter ExbD	NA	NA	NA	NA
WP_007968197.1\|15765_16533_-	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
WP_005912451.1\|16540_16810_-	hypothetical protein	NA	NA	NA	NA
WP_007971891.1\|16884_18345_-	cardiolipin synthase	NA	NA	NA	NA
WP_007971893.1\|18645_19371_+	YafY family transcriptional regulator	NA	NA	NA	NA
WP_042805567.1\|19419_19785_+	DUF1330 domain-containing protein	NA	NA	NA	NA
WP_007971897.1\|19908_21036_-	PA0069 family radical SAM protein	NA	NA	NA	NA
WP_007971900.1\|21221_21923_-	2OG-Fe(II) oxygenase	E3SK61	Synechococcus_phage	1.0e-17	47.2
WP_007968187.1\|22187_23528_-	outer membrane protein transport protein	NA	NA	NA	NA
WP_003482177.1\|23747_24440_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_042805569.1\|24548_24869_+	DUF1820 family protein	NA	NA	NA	NA
WP_007971907.1\|26022_27549_-	S41 family peptidase	A0A0R6PIZ1	Moraxella_phage	2.2e-25	28.9
WP_022557789.1\|27651_28950_-	peptidoglycan DD-metalloendopeptidase family protein	NA	NA	NA	NA
WP_007971911.1\|29047_29647_+	hypothetical protein	NA	NA	NA	NA
WP_088370743.1\|29806_31603_+	M28 family peptidase	NA	NA	NA	NA
WP_088370744.1\|32007_33095_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007970257.1\|34167_35226_-	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L339	Tupanvirus	1.3e-77	45.4
WP_007970254.1\|35535_36609_+	glycoside hydrolase family 5 protein	NA	NA	NA	NA
WP_050780422.1\|37394_38531_+	glycoside hydrolase family 5 protein	NA	NA	NA	NA
WP_007970250.1\|38832_39276_+	PepSY domain-containing protein	NA	NA	NA	NA
WP_162829046.1\|39673_40990_-	type III effector HopG1	NA	NA	NA	NA
WP_007975321.1\|41835_42798_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_088370746.1\|43289_44376_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_042805853.1\|45111_45459_-	hypothetical protein	NA	NA	NA	NA
WP_007964895.1\|45483_46965_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_007964894.1\|47161_51634_-	glutamate synthase large subunit	NA	NA	NA	NA
WP_022557799.1\|51835_52216_-	proteinase inhibitor	NA	NA	NA	NA
WP_007973056.1\|52272_53550_+	DNA topoisomerase IB	A0A0U2TSJ7	Niemeyer_virus	7.1e-41	35.1
WP_003482129.1\|53766_54111_-	hypothetical protein	NA	NA	NA	NA
WP_003482061.1\|54550_54937_+	BlaI/MecI/CopY family transcriptional regulator	NA	NA	NA	NA
WP_007973059.1\|54940_56683_+	hypothetical protein	NA	NA	NA	NA
WP_042675361.1\|57871_58381_+	hypothetical protein	NA	NA	NA	NA
WP_042805848.1\|58413_59595_+	saccharopine dehydrogenase NADP-binding domain-containing protein	NA	NA	NA	NA
WP_007964877.1\|59735_60521_-	DUF1868 domain-containing protein	NA	NA	NA	NA
WP_007973065.1\|60532_63190_-	TonB-dependent receptor	NA	NA	NA	NA
WP_042805849.1\|63292_64450_+	ROK family protein	NA	NA	NA	NA
WP_042805850.1\|64594_66748_+	avirulence protein	NA	NA	NA	NA
WP_007973071.1\|67235_68747_-	ribonuclease H-like domain-containing protein	NA	NA	NA	NA
WP_007973073.1\|68743_71239_-	DEAD/DEAH box helicase	A0A1B1IUF6	uncultured_Mediterranean_phage	1.5e-07	35.1
WP_029818121.1\|71416_72079_+	hemolysin III family protein	NA	NA	NA	NA
WP_029818122.1\|72144_72402_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_042675357.1\|72389_72689_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_007973076.1\|72868_73768_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_007973078.1\|73826_74564_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_007973080.1\|74689_75601_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_007973082.1\|75815_76868_-	hypothetical protein	NA	NA	NA	NA
WP_098477673.1\|77944_79046_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6

DBSCAN-SWA_2

98213 : 152022

Ralstonia_phage(42.86%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088370886.1\|98213_101936_-\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_042805242.1\|102219_102690_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_007970023.1\|102923_103580_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_007970025.1\|103690_104761_+	M4 family metallopeptidase	NA	NA	NA	NA
WP_005917446.1\|104757_105069_+	hypothetical protein	NA	NA	NA	NA
WP_042674615.1\|105359_105890_-	SRPBCC family protein	NA	NA	NA	NA
WP_042805243.1\|106103_107264_+	HDOD domain-containing protein	NA	NA	NA	NA
WP_042674613.1\|107506_107695_+	CsbD family protein	NA	NA	NA	NA
WP_007969091.1\|108797_109760_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_098477673.1\|109832_110935_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6
WP_049963129.1\|111484_111952_-	hypothetical protein	NA	NA	NA	NA
WP_088370749.1\|112274_113285_-	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	1.8e-47	36.9
WP_016849085.1\|113550_114753_-	aspartate/tyrosine/aromatic aminotransferase	NA	NA	NA	NA
WP_042805499.1\|114909_117048_+	TonB-dependent receptor	A0A1B0VCF0	Salmonella_phage	1.1e-67	40.9
WP_042675319.1\|117254_117551_+	hypothetical protein	NA	NA	NA	NA
WP_042805500.1\|117746_118259_+	hypothetical protein	NA	NA	NA	NA
WP_007971530.1\|118642_120172_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_007971531.1\|120349_120745_+	DUF779 domain-containing protein	NA	NA	NA	NA
WP_022557861.1\|120850_121030_-	hypothetical protein	NA	NA	NA	NA
WP_003489963.1\|121271_121580_+	hypothetical protein	NA	NA	NA	NA
WP_007971536.1\|121579_122539_+	Ku protein	NA	NA	NA	NA
WP_007971538.1\|122675_123842_-	FMN-dependent L-lactate dehydrogenase LldD	NA	NA	NA	NA
WP_007971540.1\|124089_125325_+	serine hydrolase	NA	NA	NA	NA
WP_042805505.1\|125410_126610_+	sensor histidine kinase	NA	NA	NA	NA
WP_003489973.1\|126606_127239_+	response regulator transcription factor	NA	NA	NA	NA
WP_007964731.1\|127728_128127_+	hypothetical protein	NA	NA	NA	NA
WP_042675311.1\|128415_128964_+	hypothetical protein	NA	NA	NA	NA
WP_007970760.1\|129102_129501_-	hypothetical protein	NA	NA	NA	NA
WP_007970758.1\|129497_132845_-	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_007970756.1\|133126_134335_+	trans-2-enoyl-CoA reductase family protein	NA	NA	NA	NA
WP_007970754.1\|134901_135924_-	sugar kinase	NA	NA	NA	NA
WP_007970752.1\|136209_138990_+	TonB-dependent receptor	NA	NA	NA	NA
WP_007969091.1\|142278_143241_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007969091.1\|144465_145428_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007962146.1\|145542_146523_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_162269067.1\|147127_147286_+	hypothetical protein	NA	NA	NA	NA
WP_007969199.1\|147282_147606_+	hypothetical protein	NA	NA	NA	NA
WP_088370750.1\|147738_148719_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	5.1e-100	61.3
WP_098477673.1\|149749_150852_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6
WP_007962146.1\|151041_152022_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6

DBSCAN-SWA_3

378063 : 438507

Leptospira_phage(57.14%)

tRNA,transposase,integrase

attL 379191:379250|attR 436139:437342

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088370746.1\|378063_379150_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
379191:379250	attL	NA	NA	NA	NA
WP_098477673.1\|379259_380361_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6
WP_007974272.1\|381197_383036_-	dihydroxy-acid dehydratase	NA	NA	NA	NA
WP_007974270.1\|383421_384783_+	cellulase family glycosylhydrolase	NA	NA	NA	NA
WP_082332486.1\|384831_385098_+	YkgJ family cysteine cluster protein	NA	NA	NA	NA
WP_003485643.1\|385138_385684_-	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_007974266.1\|387620_388880_+	HD-GYP domain-containing protein	NA	NA	NA	NA
WP_007974265.1\|389323_389854_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_007974262.1\|390021_391014_+	transporter	NA	NA	NA	NA
WP_007968429.1\|391047_391815_+	coniferyl-alcohol dehydrogenase	NA	NA	NA	NA
WP_007974260.1\|391845_393339_+	benzaldehyde dehydrogenase	NA	NA	NA	NA
WP_007974256.1\|394749_395934_+	4-hydroxybenzoate 3-monooxygenase	NA	NA	NA	NA
WP_039731177.1\|396386_396899_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_007968439.1\|397010_398510_-	glycerol kinase GlpK	NA	NA	NA	NA
WP_007968441.1\|398650_399472_-	aquaporin family protein	NA	NA	NA	NA
WP_042676213.1\|399646_401161_-	glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_007968445.1\|401384_402212_-	DeoR family transcriptional regulator	NA	NA	NA	NA
WP_007974253.1\|402707_403691_-	oxidoreductase	NA	NA	NA	NA
WP_007974252.1\|403791_404868_-	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_007974251.1\|405119_405983_+	CoA transferase subunit A	NA	NA	NA	NA
WP_007974250.1\|405979_406768_+	CoA-transferase subunit beta	NA	NA	NA	NA
WP_007974249.1\|406764_407973_+	3-oxoadipyl-CoA thiolase	NA	NA	NA	NA
WP_007974248.1\|408051_408786_+	protocatechuate 3,4-dioxygenase subunit beta	NA	NA	NA	NA
WP_007968458.1\|408790_409354_+	protocatechuate 3,4-dioxygenase subunit alpha	NA	NA	NA	NA
WP_042806138.1\|409711_411064_+	3-carboxy-cis,cis-muconate cycloisomerase	NA	NA	NA	NA
WP_007974245.1\|411882_412296_+	4-carboxymuconolactone decarboxylase	NA	NA	NA	NA
WP_007974244.1\|412410_413337_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_042806136.1\|413892_414753_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_007968468.1\|414901_415762_+	serine protein kinase RIO	NA	NA	NA	NA
WP_007974240.1\|416034_417003_+	alpha/beta hydrolase	A0A167RJ59	Powai_lake_megavirus	2.4e-25	29.8
WP_007974239.1\|417297_417978_-	DUF2490 domain-containing protein	NA	NA	NA	NA
WP_007974237.1\|418214_420119_-\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
WP_003485699.1\|420692_421166_-	hypothetical protein	NA	NA	NA	NA
WP_007968475.1\|421323_422283_+	pyridoxal-phosphate dependent enzyme	NA	NA	NA	NA
WP_033481400.1\|422267_422885_+	YdcF family protein	NA	NA	NA	NA
WP_007974235.1\|422927_423347_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_007974233.1\|423582_424488_-	lipid A hydroxylase LpxO	S4VR59	Pandoravirus	1.2e-37	39.5
WP_007968479.1\|424736_425621_-	malonyl-ACP O-methyltransferase BioC	NA	NA	NA	NA
WP_007968480.1\|425688_426471_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_007974230.1\|426515_427277_-	pimeloyl-ACP methyl ester esterase BioH	NA	NA	NA	NA
WP_007968484.1\|427378_427759_-	hypothetical protein	NA	NA	NA	NA
WP_007968486.1\|427946_429152_-	8-amino-7-oxononanoate synthase	NA	NA	NA	NA
WP_007968487.1\|429236_430271_-	biotin synthase BioB	NA	NA	NA	NA
WP_007974227.1\|430320_431046_+	ComF family protein	NA	NA	NA	NA
WP_007974225.1\|431294_432200_-	4-hydroxybenzoate octaprenyltransferase	NA	NA	NA	NA
WP_007974223.1\|432920_434114_+\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	6.7e-110	50.9
WP_007969091.1\|434812_435775_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_098477673.1\|436207_437309_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6
WP_088370746.1\|437420_438507_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
436139:437342	attR	NA	NA	NA	NA

DBSCAN-SWA_4

445927 : 519869

Ralstonia_phage(50.0%)

tail,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157768392.1\|445927_446047_+\|transposase	transposase	NA	NA	NA	NA
WP_099206383.1\|446074_446260_+\|transposase	transposase	NA	NA	NA	NA
WP_007965402.1\|448014_449004_-	pectate lyase	NA	NA	NA	NA
WP_007972484.1\|449202_449673_-	CesT family type III secretion system chaperone	NA	NA	NA	NA
WP_131438874.1\|449727_450009_-	serine kinase	NA	NA	NA	NA
WP_042675499.1\|450087_450330_-	hypothetical protein	NA	NA	NA	NA
WP_007965398.1\|450339_451278_-	hypothetical protein	NA	NA	NA	NA
WP_007972482.1\|451274_452090_-	hypothetical protein	NA	NA	NA	NA
WP_002802878.1\|452086_452347_-	type III secretion system export apparatus subunit SctS	NA	NA	NA	NA
WP_007972480.1\|452351_452996_-	type III secretion system export apparatus subunit SctR	NA	NA	NA	NA
WP_042805706.1\|452982_453936_-	type III secretion system cytoplasmic ring protein SctQ	NA	NA	NA	NA
WP_007965390.1\|454028_454667_-	type III secretion system protein SctP	NA	NA	NA	NA
WP_007972477.1\|454666_456604_-	FHIPEP family type III secretion protein	NA	NA	NA	NA
WP_007972475.1\|456597_457671_-	type III secretion system export apparatus subunit SctU	NA	NA	NA	NA
WP_007965384.1\|457887_458343_+	HrpB1 family type III secretion system apparatus protein	NA	NA	NA	NA
WP_007965382.1\|458376_458769_+	type III secretion protein HrpB2	NA	NA	NA	NA
WP_007972473.1\|458770_459532_+	type III secretion inner membrane ring lipoprotein SctJ	NA	NA	NA	NA
WP_007972471.1\|459539_460169_+	type III secretion protein HrpB4	NA	NA	NA	NA
WP_007965376.1\|460153_460855_+	type III secretion system stator protein SctL	NA	NA	NA	NA
WP_007972469.1\|460844_462173_+	type III secretion system ATPase SctN	NA	NA	NA	NA
WP_007972466.1\|462165_462675_+	type III secretion protein HrpB7	NA	NA	NA	NA
WP_007965371.1\|462671_463502_+	type III secretion system export apparatus subunit SctT	NA	NA	NA	NA
WP_007972464.1\|463583_465407_+	type III secretion system outer membrane ring subunit SctC	NA	NA	NA	NA
WP_007962146.1\|465786_466767_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_007975737.1\|467298_467703_-	hypothetical protein	NA	NA	NA	NA
WP_007969091.1\|467900_468863_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007969478.1\|469155_469719_+	lytic transglycosylase domain-containing protein	A0A0K2QQJ4	Ralstonia_phage	5.2e-12	39.4
WP_042805092.1\|470053_471622_-	hypothetical protein	NA	NA	NA	NA
WP_007962146.1\|471900_472881_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_007974834.1\|474200_474542_-	HPF/RaiA family ribosome-associated protein	NA	NA	NA	NA
WP_173362066.1\|474689_477284_+	mechanosensitive ion channel family protein	NA	NA	NA	NA
WP_042806228.1\|477380_479489_-	phosphoglycerol transferase I	NA	NA	NA	NA
WP_007974840.1\|479915_481634_-	AarF/ABC1/UbiB kinase family protein	A0A0P0CRE2	Ostreococcus_lucimarinus_virus	3.9e-34	28.4
WP_007967773.1\|481882_482824_+	DUF808 domain-containing protein	NA	NA	NA	NA
WP_007974842.1\|482904_484533_-	GGDEF domain-containing protein	NA	NA	NA	NA
WP_007974844.1\|485020_486604_+	glycogen synthase GlgA	NA	NA	NA	NA
WP_007974847.1\|486600_488817_+	1,4-alpha-glucan branching enzyme	NA	NA	NA	NA
WP_007974849.1\|488819_490577_+	malto-oligosyltrehalose trehalohydrolase	NA	NA	NA	NA
WP_007974851.1\|490573_492523_+	4-alpha-glucanotransferase	NA	NA	NA	NA
WP_007974853.1\|492519_495129_+	malto-oligosyltrehalose synthase	NA	NA	NA	NA
WP_003486435.1\|495149_495335_+	DUF2934 domain-containing protein	NA	NA	NA	NA
WP_003486432.1\|495452_497615_+	glycogen debranching protein GlgX	NA	NA	NA	NA
WP_007974855.1\|497631_498264_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_007974857.1\|498635_499394_-	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	1.0e-10	37.7
WP_007974859.1\|499769_501179_+	FAD/NAD(P)-binding protein	NA	NA	NA	NA
WP_007967792.1\|501403_501835_+	hypothetical protein	NA	NA	NA	NA
WP_007967796.1\|503545_504163_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_007974865.1\|504241_505390_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_007974867.1\|505386_508485_+	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_162045113.1\|508500_509424_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_007967804.1\|509612_509948_+	hypothetical protein	NA	NA	NA	NA
WP_007974871.1\|510309_511602_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.9e-46	34.1
WP_007974873.1\|512054_513578_-	2-oxo acid dehydrogenase subunit E2	NA	NA	NA	NA
WP_003486396.1\|513574_513958_-	SH3 domain protein	NA	NA	NA	NA
WP_007967812.1\|513959_515030_-	alpha-ketoacid dehydrogenase subunit beta	NA	NA	NA	NA
WP_007967814.1\|515022_516111_-	pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha	NA	NA	NA	NA
WP_007974877.1\|516287_519869_-\|tail	lamin tail domain-containing protein	NA	NA	NA	NA

DBSCAN-SWA_5

748493 : 884317

Leptospira_phage(18.18%)

transposase,integrase

attL 795815:795874|attR 800272:800684

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007975311.1\|748493_749474_-\|transposase	IS5-like element ISXfu2 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.5
WP_007970540.1\|749575_750400_+	hypothetical protein	NA	NA	NA	NA
WP_007970538.1\|750489_751698_-	beta-ketoacyl-ACP synthase I	NA	NA	NA	NA
WP_007970536.1\|751697_752213_-	3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA	NA	NA	NA	NA
WP_007970533.1\|752559_753639_+	DNA polymerase IV	NA	NA	NA	NA
WP_007970530.1\|753781_754432_+	phosphoglycolate phosphatase	NA	NA	NA	NA
WP_157835079.1\|754863_757080_+	FepA family TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_007970525.1\|757138_758107_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_022559997.1\|758145_758532_-	TfoX/Sxy family protein	NA	NA	NA	NA
WP_003484068.1\|758528_759011_-	GAF domain-containing protein	NA	NA	NA	NA
WP_007970523.1\|759341_760016_+	dethiobiotin synthase	NA	NA	NA	NA
WP_007970521.1\|760129_760465_-	phasin family protein	NA	NA	NA	NA
WP_088370744.1\|762413_763501_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_042805257.1\|764269_764623_-	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
WP_042805258.1\|764892_767514_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	8.8e-46	26.6
WP_088370744.1\|769900_770987_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_003484084.1\|771366_772749_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	9.3e-55	35.7
WP_173362018.1\|773057_774116_+	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_007969488.1\|774147_774810_+	maleylacetoacetate isomerase	NA	NA	NA	NA
WP_003484093.1\|775338_776472_-	PilT/PilU family type 4a pilus ATPase	NA	NA	NA	NA
WP_173362029.1\|776654_776954_+	DUF4398 domain-containing protein	NA	NA	NA	NA
WP_007964831.1\|776950_777841_+	hypothetical protein	NA	NA	NA	NA
WP_003484103.1\|778192_778411_+	YdcH family protein	NA	NA	NA	NA
WP_007964832.1\|778649_780020_+	pyridoxal-phosphate dependent enzyme	A0A1X9I5F1	Streptococcus_phage	2.0e-49	38.5
WP_007971000.1\|780108_781296_+	cystathionine gamma-synthase	NA	NA	NA	NA
WP_007971002.1\|781668_784788_+	glycosyltransferase	A0A218MKE2	uncultured_virus	1.4e-13	24.4
WP_007971003.1\|784870_785665_+	ABC transporter permease	NA	NA	NA	NA
WP_007964837.1\|785661_786948_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.2e-10	22.5
WP_007971004.1\|787012_789160_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_007971005.1\|789159_791676_+	glycosyltransferase family 4 protein	A0A2K9VGK0	Pontimonas_phage	4.2e-05	27.9
WP_003484125.1\|791787_792828_+	GDP-mannose 4,6-dehydratase	M1HVB5	Paramecium_bursaria_Chlorella_virus	5.8e-102	54.2
WP_007971006.1\|792805_793705_+	GDP-mannose 4,6-dehydratase	NA	NA	NA	NA
WP_131438843.1\|793754_795728_+	hypothetical protein	NA	NA	NA	NA
795815:795874	attL	NA	NA	NA	NA
WP_088370744.1\|796307_797394_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_088370758.1\|797428_798268_-	DUF4102 domain-containing protein	NA	NA	NA	NA
WP_042805040.1\|798618_799809_+\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	1.2e-119	57.2
WP_007969091.1\|800290_801253_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
800272:800684	attR	NA	NA	NA	NA
WP_007962146.1\|801672_802653_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_007969828.1\|802777_805975_+	YadA-like family protein	NA	NA	NA	NA
WP_042805188.1\|806077_808003_+	S8 family serine peptidase	A0A217EQY2	Bacillus_phage	9.7e-18	32.0
WP_007969091.1\|811106_812069_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007972735.1\|816863_818747_+	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	1.8e-24	33.2
WP_042805770.1\|818876_820604_+	type II secretion system ATPase GspE	NA	NA	NA	NA
WP_003490504.1\|820779_821997_+	type II secretion system F family protein	NA	NA	NA	NA
WP_033481101.1\|822237_822669_+	type II secretion system major pseudopilin GspG	NA	NA	NA	NA
WP_042805769.1\|822678_823188_+	GspH/FimT family pseudopilin	NA	NA	NA	NA
WP_007965181.1\|823184_823601_+	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
WP_007965183.1\|823597_824233_+	type II secretion system protein J	NA	NA	NA	NA
WP_042675433.1\|824229_825081_+	general secretion pathway protein GspK	NA	NA	NA	NA
WP_007965187.1\|825077_826199_+	PilN domain-containing protein	NA	NA	NA	NA
WP_007972728.1\|826182_826836_+	type II secretion system protein M	NA	NA	NA	NA
WP_007972727.1\|826825_827623_+	hypothetical protein	NA	NA	NA	NA
WP_007972726.1\|827619_829911_+	type II secretion system secretin GspD	A7BJX1	Enterobacteria_phage	3.6e-11	22.6
WP_131454214.1\|829984_830257_+	hypothetical protein	NA	NA	NA	NA
WP_042805772.1\|830370_831198_+	hypothetical protein	NA	NA	NA	NA
WP_007965195.1\|831611_832340_-	UTRA domain-containing protein	NA	NA	NA	NA
WP_007972724.1\|832445_833021_-	nicotinamide mononucleotide transporter	NA	NA	NA	NA
WP_007972723.1\|833245_835408_-	TonB-dependent receptor	NA	NA	NA	NA
WP_007972722.1\|835439_836597_-	phosphotransferase	NA	NA	NA	NA
WP_007972718.1\|837232_838072_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_007972716.1\|838199_839234_+	hypothetical protein	NA	NA	NA	NA
WP_042805768.1\|841202_842498_+	hypothetical protein	NA	NA	NA	NA
WP_007972714.1\|842479_843448_+	hypothetical protein	NA	NA	NA	NA
WP_007972712.1\|843837_845016_+	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	4.5e-50	32.8
WP_007965213.1\|845217_845673_+	hypothetical protein	NA	NA	NA	NA
WP_088370746.1\|845978_847065_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_042805110.1\|847460_849605_+	UDP-forming cellulose synthase catalytic subunit	NA	NA	NA	NA
WP_082336374.1\|849610_851977_+	cellulose biosynthesis cyclic di-GMP-binding regulatory protein BcsB	NA	NA	NA	NA
WP_042805112.1\|851973_853146_+	cellulase	NA	NA	NA	NA
WP_088370759.1\|853127_857657_+	cellulose biosynthesis protein BcsC	NA	NA	NA	NA
WP_022559930.1\|859539_859965_-	hypothetical protein	NA	NA	NA	NA
WP_007963670.1\|860311_860734_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	1.5e-40	61.5
WP_007963672.1\|861067_861583_+	peptide deformylase	NA	NA	NA	NA
WP_007972228.1\|861801_862746_-	DegV family protein	NA	NA	NA	NA
WP_131438865.1\|863227_863641_+	hypothetical protein	NA	NA	NA	NA
WP_082336469.1\|863558_864044_+	glycosyl hydrolase family 5	NA	NA	NA	NA
WP_007972231.1\|864433_866023_-	rhamnogalacturonase B	NA	NA	NA	NA
WP_042805654.1\|866377_866692_-	hypothetical protein	NA	NA	NA	NA
WP_007972234.1\|866992_868273_-	amidohydrolase family protein	NA	NA	NA	NA
WP_007972236.1\|868269_869679_-	amidohydrolase	NA	NA	NA	NA
WP_173362041.1\|869812_870379_+	DUF924 family protein	A0A1V0SIY0	Klosneuvirus	1.2e-16	38.1
WP_007963687.1\|871602_872529_-	Grx4 family monothiol glutaredoxin	NA	NA	NA	NA
WP_007963688.1\|872574_873366_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_007972239.1\|873498_874170_-	methyltransferase	NA	NA	NA	NA
WP_007972240.1\|874631_875282_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_007963696.1\|875281_876553_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_007972241.1\|876845_879011_+	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	3.1e-49	29.6
WP_007972243.1\|879007_880429_+	HlyD family type I secretion periplasmic adaptor subunit	NA	NA	NA	NA
WP_007969091.1\|880480_881443_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007962146.1\|881954_882935_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_007969091.1\|883354_884317_+\|transposase	IS1595 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

1134409 : 1216547

Leptospira_phage(50.0%)

tRNA,transposase,integrase,protease

attL 1130951:1130968|attR 1211215:1212417

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1130951:1130968	attL	NA	NA	NA	NA
WP_007964566.1\|1134409_1135168_-\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
1130951:1130968	attL	NA	NA	NA	NA
WP_007974042.1\|1135390_1136185_-	thiazole synthase	NA	NA	NA	NA
WP_022558627.1\|1136234_1136435_-	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_033481344.1\|1136623_1138408_+	autotransporter domain-containing esterase	NA	NA	NA	NA
WP_007974045.1\|1138851_1140186_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_088370762.1\|1140257_1140443_+	hypothetical protein	NA	NA	NA	NA
WP_007969091.1\|1140524_1141487_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_131438931.1\|1141794_1142058_-	hypothetical protein	NA	NA	NA	NA
WP_007975745.1\|1142324_1142720_+	H-NS histone family protein	NA	NA	NA	NA
WP_042806308.1\|1143165_1143717_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_007962146.1\|1144090_1145071_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
1144593:1144610	attR	NA	NA	NA	NA
WP_050780476.1\|1145348_1145813_+	BLUF domain-containing protein	NA	NA	NA	NA
1144593:1144610	attR	NA	NA	NA	NA
WP_007962146.1\|1146892_1147873_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_007969286.1\|1148615_1148918_+	hypothetical protein	NA	NA	NA	NA
WP_007969284.1\|1148990_1149869_+	hypothetical protein	NA	NA	NA	NA
WP_042805052.1\|1150367_1150874_+	hypothetical protein	NA	NA	NA	NA
WP_007969091.1\|1150985_1151948_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_173655848.1\|1152841_1153075_-	hypothetical protein	NA	NA	NA	NA
WP_088370746.1\|1153584_1154671_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007969091.1\|1159466_1160429_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007969370.1\|1161041_1161413_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_042805064.1\|1161498_1162149_+	hypothetical protein	NA	NA	NA	NA
WP_017165118.1\|1162320_1162554_+	hypothetical protein	NA	NA	NA	NA
WP_007969368.1\|1162645_1163713_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_007969367.1\|1163959_1164886_-	hypothetical protein	NA	NA	NA	NA
WP_007969366.1\|1165011_1165398_-	hypothetical protein	NA	NA	NA	NA
WP_098477673.1\|1167287_1168390_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6
WP_082336386.1\|1168530_1169145_-	hypothetical protein	NA	NA	NA	NA
WP_082336385.1\|1169285_1170149_-	hypothetical protein	NA	NA	NA	NA
WP_042805181.1\|1170288_1170993_-	hypothetical protein	NA	NA	NA	NA
WP_100084197.1\|1170995_1171622_-	DUF4433 domain-containing protein	NA	NA	NA	NA
WP_007969773.1\|1171812_1173738_+	AAA family ATPase	NA	NA	NA	NA
WP_007969771.1\|1173734_1175378_+	ATP-dependent helicase	NA	NA	NA	NA
WP_050780412.1\|1175434_1176550_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_007969091.1\|1176777_1177740_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007970013.1\|1178388_1179234_+	MobA/MobL family protein	NA	NA	NA	NA
WP_042805235.1\|1179225_1179453_-	hypothetical protein	NA	NA	NA	NA
WP_007970012.1\|1179519_1179912_-	hypothetical protein	NA	NA	NA	NA
WP_173362023.1\|1179960_1180278_-	hypothetical protein	NA	NA	NA	NA
WP_007970010.1\|1180514_1180856_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_042805233.1\|1181021_1182719_+	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_042805232.1\|1182985_1183303_+	hypothetical protein	NA	NA	NA	NA
WP_007970004.1\|1183295_1187102_+	zeta toxin family protein	NA	NA	NA	NA
WP_007970002.1\|1187404_1188703_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_088370763.1\|1190008_1190566_+	plasmid mobilization protein	NA	NA	NA	NA
WP_042805530.1\|1190816_1191845_-	hypothetical protein	NA	NA	NA	NA
WP_050780436.1\|1191860_1193432_-	serine/threonine protein kinase	NA	NA	NA	NA
WP_007971688.1\|1193515_1194262_-	hypothetical protein	NA	NA	NA	NA
WP_007971690.1\|1194264_1195098_-	VWA domain-containing protein	NA	NA	NA	NA
WP_025989230.1\|1195719_1196196_-	Mov34/MPN/PAD-1 family protein	NA	NA	NA	NA
WP_042805534.1\|1196183_1197818_-	ThiF family adenylyltransferase	NA	NA	NA	NA
WP_007971696.1\|1197814_1198951_-	hypothetical protein	NA	NA	NA	NA
WP_007971699.1\|1198960_1199947_-	patatin-like phospholipase family protein	A0A1B2LRS3	Wolbachia_phage	2.1e-24	28.1
WP_046934610.1\|1199953_1200178_-	DUF2188 domain-containing protein	NA	NA	NA	NA
WP_042805538.1\|1200451_1200844_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_042805535.1\|1200846_1201716_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_007962004.1\|1202477_1203137_+	thermonuclease family protein	NA	NA	NA	NA
WP_007962003.1\|1203247_1203640_+	hypothetical protein	NA	NA	NA	NA
WP_003490669.1\|1203730_1204123_+	H-NS histone family protein	NA	NA	NA	NA
WP_007971705.1\|1204753_1206886_-	glycogen debranching protein GlgX	NA	NA	NA	NA
WP_007971708.1\|1208455_1208932_+	hypothetical protein	NA	NA	NA	NA
WP_003490678.1\|1208957_1209635_+	response regulator transcription factor	Q6XM27	Feldmannia_irregularis_virus	7.4e-05	27.4
WP_007971710.1\|1209627_1210986_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_088370764.1\|1211087_1211204_-	type I addiction module toxin, SymE family	NA	NA	NA	NA
WP_098477673.1\|1211246_1212349_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6
WP_088370746.1\|1213815_1214902_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007969091.1\|1215584_1216547_+\|transposase	IS1595 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

1646167 : 1702986

Pseudomonas_phage(37.5%)

tRNA,tail,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_050780463.1\|1646167_1646575_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_007974410.1\|1646574_1650246_-	putative Ig domain-containing protein	A0A0A1IX03	Pseudomonas_phage	2.4e-86	27.9
WP_042806161.1\|1650235_1650469_-	hypothetical protein	A0A0A1IV01	Pseudomonas_phage	2.4e-16	62.1
WP_007974412.1\|1650465_1650894_-	hypothetical protein	NA	NA	NA	NA
WP_007974415.1\|1650884_1651976_-	DUF2163 domain-containing protein	NA	NA	NA	NA
WP_131438905.1\|1651968_1653168_-	hypothetical protein	B7SE08	Pseudomonas_virus	2.3e-78	42.2
WP_050780464.1\|1653171_1655946_-\|tail	phage tail length tape measure family protein	A0A2H4J7J3	uncultured_Caudovirales_phage	1.5e-43	25.7
WP_007974420.1\|1656119_1656635_-	hypothetical protein	A0A0S4L2X3	Pseudomonas_phage	1.4e-24	46.6
WP_042806162.1\|1656634_1657402_-	hypothetical protein	J9SVZ4	Pseudomonas_phage	5.9e-43	39.9
WP_042806163.1\|1657391_1657577_-	hypothetical protein	NA	NA	NA	NA
WP_007974424.1\|1657573_1658050_-	hypothetical protein	A0A0S4L2X9	Pseudomonas_phage	4.1e-34	49.0
WP_007974425.1\|1658046_1658520_-	DUF1320 domain-containing protein	J9SNI4	Pseudomonas_phage	1.8e-34	50.0
WP_088370746.1\|1658586_1659674_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007967299.1\|1660238_1660667_-	Rnf electron transport complex subunit RnfB	NA	NA	NA	NA
WP_007971195.1\|1660668_1661259_-	HAD family hydrolase	NA	NA	NA	NA
WP_007971192.1\|1661698_1663783_-\|tRNA	methionine--tRNA ligase	NA	NA	NA	NA
WP_003485424.1\|1664032_1664482_-	DUF2147 domain-containing protein	NA	NA	NA	NA
WP_007971190.1\|1664713_1668310_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_005924907.1\|1668322_1669216_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	5.1e-22	31.1
WP_022559734.1\|1669354_1669744_-	VOC family protein	NA	NA	NA	NA
WP_007971187.1\|1670091_1671489_+	S-methylmethionine permease	NA	NA	NA	NA
WP_007971186.1\|1671485_1672451_+	homocysteine S-methyltransferase	NA	NA	NA	NA
WP_042805467.1\|1672639_1674577_-	DUF885 family protein	NA	NA	NA	NA
WP_007965588.1\|1674851_1675628_-	queuosine precursor transporter	NA	NA	NA	NA
WP_042805466.1\|1675632_1676307_-	DUF502 domain-containing protein	A0A2I7S9X1	Vibrio_phage	4.9e-09	28.3
WP_007971180.1\|1676731_1678093_+	hypothetical protein	NA	NA	NA	NA
WP_088370746.1\|1678561_1679649_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007973091.1\|1680284_1681628_-	polyhydroxyalkanoate depolymerase	NA	NA	NA	NA
WP_007973092.1\|1681930_1682533_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_007965599.1\|1682606_1683053_+	CopD family protein	NA	NA	NA	NA
WP_007973094.1\|1683669_1684548_-	type III secretion system effector protein	NA	NA	NA	NA
WP_007966722.1\|1684901_1685966_-	hypothetical protein	NA	NA	NA	NA
WP_046932707.1\|1686034_1686322_+	hypothetical protein	NA	NA	NA	NA
WP_007966720.1\|1686590_1688126_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	4.4e-98	41.6
WP_007973097.1\|1688141_1688963_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	7.7e-65	51.2
WP_005924942.1\|1689470_1690430_-	acetyl-CoA carboxylase carboxyltransferase subunit alpha	NA	NA	NA	NA
WP_007973101.1\|1690606_1694197_-	DNA polymerase III subunit alpha	A0A291AVA6	Streptomyces_phage	3.4e-181	36.3
WP_007965609.1\|1694463_1695210_-	ribonuclease HII	G9E3X7	Emiliania_huxleyi_virus	3.5e-24	36.9
WP_007965611.1\|1695206_1696511_-	lipid-A-disaccharide synthase	NA	NA	NA	NA
WP_003485381.1\|1696507_1697299_-	acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase	NA	NA	NA	NA
WP_003485378.1\|1697324_1697783_-	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_007965614.1\|1697779_1698793_-	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
WP_005911715.1\|1698921_1699113_+	hypothetical protein	NA	NA	NA	NA
WP_007973104.1\|1699189_1701556_-	outer membrane protein assembly factor BamA	NA	NA	NA	NA
WP_007973106.1\|1701639_1702986_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA

DBSCAN-SWA_8

1712579 : 1771547

Leptospira_phage(18.18%)

protease,tRNA,transposase,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022559712.1\|1712579_1713614_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_007973125.1\|1713610_1715962_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_007973127.1\|1715978_1716749_-	molecular chaperone	NA	NA	NA	NA
WP_008576696.1\|1716757_1717309_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_088370744.1\|1717562_1718650_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_088370774.1\|1718735_1719686_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	2.2e-100	61.6
WP_007971765.1\|1719959_1720736_+	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_007971766.1\|1720732_1723342_+	[protein-PII] uridylyltransferase	NA	NA	NA	NA
WP_007971767.1\|1723364_1724567_+	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
WP_007966645.1\|1724756_1725113_+	arsenate reductase	NA	NA	NA	NA
WP_007971770.1\|1725359_1726490_+	succinyl-diaminopimelate desuccinylase	NA	NA	NA	NA
WP_007971771.1\|1726782_1728477_+	asparagine synthase B	A0A0P0C1V4	Ostreococcus_lucimarinus_virus	2.7e-88	39.1
WP_033481302.1\|1728544_1729597_-	right-handed parallel beta-helix repeat-containing protein	NA	NA	NA	NA
WP_007971775.1\|1730041_1732180_-	TonB-dependent receptor	NA	NA	NA	NA
WP_042805544.1\|1732606_1735024_-	penicillin acylase family protein	NA	NA	NA	NA
WP_087945314.1\|1735120_1735657_+	bacterioferritin	NA	NA	NA	NA
WP_007971781.1\|1735923_1736580_-	thiopurine S-methyltransferase	NA	NA	NA	NA
WP_007971783.1\|1737009_1739253_-	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	1.0e-82	35.0
WP_007966661.1\|1739314_1740166_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_014089765.1\|1740288_1740729_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_173362037.1\|1740770_1742243_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_007966664.1\|1742253_1743447_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_007966665.1\|1743453_1745034_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_042805456.1\|1745475_1747665_-	glycoside hydrolase family 3 protein	NA	NA	NA	NA
WP_007971104.1\|1747842_1749612_-	M14 family metallopeptidase	NA	NA	NA	NA
WP_042805455.1\|1749975_1751541_+	MFS transporter	A0A0P0IY73	Acinetobacter_phage	1.8e-22	24.8
WP_007966672.1\|1751548_1752157_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_005911777.1\|1752463_1752652_-	hypothetical protein	NA	NA	NA	NA
WP_042675912.1\|1752878_1753148_+	N-acetyltransferase	NA	NA	NA	NA
WP_007966673.1\|1753199_1754045_+	DUF3298 and DUF4163 domain-containing protein	NA	NA	NA	NA
WP_007971099.1\|1754111_1754612_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_042805453.1\|1754844_1757043_-	dipeptidyl carboxypeptidase II	A0A1V0SID3	Klosneuvirus	2.8e-45	28.2
WP_007966677.1\|1757417_1757903_+	glutathione peroxidase	A0A1S7DM81	Molluscum_contagiosum_virus	4.0e-13	35.5
WP_007966679.1\|1758052_1758832_-	ferredoxin--NADP reductase	NA	NA	NA	NA
WP_007971094.1\|1759032_1760913_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.7e-25	38.5
WP_088370775.1\|1761035_1762016_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	2.3e-100	61.6
WP_007969635.1\|1762371_1763889_+	fumarate hydratase	NA	NA	NA	NA
WP_173362020.1\|1764950_1765589_+	carbonic anhydrase	NA	NA	NA	NA
WP_088370772.1\|1766157_1767244_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.2e-42	36.4
WP_007972080.1\|1768534_1769020_-	DUF456 domain-containing protein	NA	NA	NA	NA
WP_003483561.1\|1769247_1769463_+	cold-shock protein	A0A1X9IGI9	Lactococcus_phage	5.0e-16	59.7
WP_007966687.1\|1769601_1770081_-	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
WP_007966688.1\|1770213_1770642_-	hypothetical protein	NA	NA	NA	NA
WP_007972081.1\|1770716_1771547_+\|tRNA	tRNA threonylcarbamoyladenosine dehydratase	NA	NA	NA	NA

DBSCAN-SWA_9

1800491 : 1855485

Bacillus_phage(36.36%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007969091.1\|1800491_1801454_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007969319.1\|1802404_1804786_-	TonB-dependent receptor	NA	NA	NA	NA
WP_088370778.1\|1804915_1806005_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	5.5e-42	36.6
WP_039569573.1\|1806224_1806515_+	hypothetical protein	NA	NA	NA	NA
WP_007969297.1\|1806744_1807860_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007969295.1\|1807814_1808330_-	hypothetical protein	NA	NA	NA	NA
WP_007964018.1\|1808455_1810519_-	TonB-dependent receptor	NA	NA	NA	NA
WP_007969441.1\|1810681_1811098_+	MerC domain-containing protein	NA	NA	NA	NA
WP_003487537.1\|1811541_1811724_+	30S ribosomal protein THX	NA	NA	NA	NA
WP_042805086.1\|1811857_1812898_-	zinc-dependent alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_007975311.1\|1813840_1814821_-\|transposase	IS5-like element ISXfu2 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.5
WP_007964007.1\|1815700_1816999_-	alkaline phosphatase family protein	A0A0M3PB47	Turkeypox_virus	1.3e-55	34.6
WP_007964005.1\|1817035_1817581_-	methylated-DNA--[protein]-cysteine S-methyltransferase	A0A1S5V092	Saudi_moumouvirus	2.7e-13	50.6
WP_007969594.1\|1817577_1819041_-	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
WP_007969593.1\|1819188_1820415_+	hypothetical protein	NA	NA	NA	NA
WP_007969592.1\|1821151_1821688_+	DUF4019 domain-containing protein	NA	NA	NA	NA
WP_007963996.1\|1821713_1822115_+	MAPEG family protein	NA	NA	NA	NA
WP_007963995.1\|1822141_1822462_-	hypothetical protein	NA	NA	NA	NA
WP_042805556.1\|1822458_1822701_-	RNA-binding S4 domain-containing protein	NA	NA	NA	NA
WP_042805557.1\|1823473_1825372_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.7e-62	37.3
WP_042805558.1\|1825629_1828041_+	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	9.6e-15	35.8
WP_007971843.1\|1828153_1828876_+	pseudouridine synthase	NA	NA	NA	NA
WP_007971845.1\|1829082_1830210_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	2.2e-14	33.3
WP_007971847.1\|1830374_1831322_-	DMT family transporter	NA	NA	NA	NA
WP_007971849.1\|1831724_1832555_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_007963982.1\|1833155_1833656_+	ribonuclease E activity regulator RraA	NA	NA	NA	NA
WP_050780440.1\|1833597_1835274_+	serine hydrolase	NA	NA	NA	NA
WP_007971853.1\|1835419_1836685_+	cation:proton antiporter	NA	NA	NA	NA
WP_007971854.1\|1836748_1837942_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	2.8e-23	25.7
WP_005912893.1\|1837938_1838628_-	response regulator transcription factor	Q6XM27	Feldmannia_irregularis_virus	8.0e-07	27.5
WP_007971856.1\|1838732_1840202_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_022558952.1\|1840221_1841058_+	MipA/OmpV family protein	NA	NA	NA	NA
WP_007971860.1\|1841080_1842187_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_007971862.1\|1842183_1845243_+	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_007971865.1\|1845446_1846043_+	plasmid pRiA4b ORF-3 family protein	NA	NA	NA	NA
WP_007971867.1\|1846216_1848049_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.0e-30	26.5
WP_042674840.1\|1848266_1850072_-	DUF885 domain-containing protein	NA	NA	NA	NA
WP_007971872.1\|1850413_1850812_+	aldehyde-activating protein	NA	NA	NA	NA
WP_007971874.1\|1850808_1851612_+	DUF4349 domain-containing protein	NA	NA	NA	NA
WP_005912915.1\|1851811_1852105_-	hypothetical protein	NA	NA	NA	NA
WP_042805563.1\|1852192_1852444_-	DUF2867 domain-containing protein	NA	NA	NA	NA
WP_007962146.1\|1853499_1854480_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_007969091.1\|1854522_1855485_-\|transposase	IS1595 family transposase	NA	NA	NA	NA

DBSCAN-SWA_10

1859104 : 1912490

Leptospira_phage(50.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088370744.1\|1859104_1860191_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_088370887.1\|1860188_1862060_-	type III secretion system effector protein	NA	NA	NA	NA
WP_007962146.1\|1862678_1863659_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_007962146.1\|1863839_1864820_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_007975720.1\|1866051_1866582_+	hypothetical protein	NA	NA	NA	NA
WP_082336596.1\|1866578_1867238_+	hypothetical protein	NA	NA	NA	NA
WP_098477673.1\|1868141_1869243_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6
WP_088370780.1\|1869240_1869567_-	hypothetical protein	NA	NA	NA	NA
WP_088370744.1\|1869665_1870753_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007969713.1\|1871580_1875045_-	transcription-repair coupling factor	NA	NA	NA	NA
WP_003488532.1\|1875690_1876233_-	N-acetyltransferase	NA	NA	NA	NA
WP_172955843.1\|1876623_1877574_-	23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ	NA	NA	NA	NA
WP_007962146.1\|1877806_1878787_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_007962840.1\|1878880_1879585_+	two-component system response regulator CreB	W8CYM9	Bacillus_phage	9.6e-32	35.7
WP_042805519.1\|1879633_1881082_+	two-component system sensor histidine kinase CreC	NA	NA	NA	NA
WP_007962838.1\|1881208_1882021_-	C1 family peptidase	NA	NA	NA	NA
WP_007971609.1\|1882440_1883760_+	cell envelope integrity protein CreD	NA	NA	NA	NA
WP_007962836.1\|1883767_1884187_+	hypothetical protein	NA	NA	NA	NA
WP_042805517.1\|1884183_1884834_+	GNAT family acetyltransferase	NA	NA	NA	NA
WP_007962834.1\|1884958_1885843_+	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
WP_007971607.1\|1885862_1886954_+	DUF3616 domain-containing protein	NA	NA	NA	NA
WP_007971606.1\|1887022_1888426_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_007971605.1\|1888439_1888946_+	transcriptional repressor	NA	NA	NA	NA
WP_042805516.1\|1889281_1889926_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_007962821.1\|1890032_1891247_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_007971603.1\|1891261_1894405_+	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_007971602.1\|1894406_1895918_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_007971601.1\|1895910_1896585_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_007971600.1\|1896681_1897152_+	cupin domain-containing protein	NA	NA	NA	NA
WP_007971599.1\|1897257_1898166_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_003488570.1\|1898391_1898595_+	hypothetical protein	NA	NA	NA	NA
WP_007971596.1\|1898918_1899833_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_007971594.1\|1899940_1901158_+	MFS transporter	NA	NA	NA	NA
WP_007971592.1\|1901313_1902345_+	aldo/keto reductase	NA	NA	NA	NA
WP_007971590.1\|1902427_1903024_-	hypothetical protein	NA	NA	NA	NA
WP_007971589.1\|1903025_1904489_-	S8 family serine peptidase	NA	NA	NA	NA
WP_007969091.1\|1904514_1905477_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_098477673.1\|1905703_1906805_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6
WP_088370781.1\|1906982_1907279_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_007969091.1\|1907538_1908501_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007975758.1\|1908526_1909570_+	Fic family protein	NA	NA	NA	NA
WP_042806309.1\|1910045_1910450_+	hypothetical protein	NA	NA	NA	NA
WP_162829054.1\|1910437_1911175_+	hypothetical protein	NA	NA	NA	NA
WP_007969091.1\|1911527_1912490_+\|transposase	IS1595 family transposase	NA	NA	NA	NA

DBSCAN-SWA_11

2028865 : 2099315

Leptospira_phage(20.0%)

tRNA,transposase,integrase

attL 2056772:2056787|attR 2103651:2103666

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088370744.1\|2028865_2029953_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007966292.1\|2030202_2030892_+	hypothetical protein	NA	NA	NA	NA
WP_007966294.1\|2031032_2031668_-	FMN-binding negative transcriptional regulator	NA	NA	NA	NA
WP_007966296.1\|2031669_2031996_-	hypothetical protein	NA	NA	NA	NA
WP_003485878.1\|2031992_2032298_-	hypothetical protein	NA	NA	NA	NA
WP_050780448.1\|2032294_2032645_-	hypothetical protein	NA	NA	NA	NA
WP_007972426.1\|2032673_2034068_-\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	1.4e-79	38.1
WP_007966300.1\|2034272_2034611_+	iron-sulfur cluster assembly accessory protein	NA	NA	NA	NA
WP_003485869.1\|2035013_2035445_+	30S ribosomal protein S6	NA	NA	NA	NA
WP_002804494.1\|2035456_2035687_+	30S ribosomal protein S18	NA	NA	NA	NA
WP_007966301.1\|2035934_2036384_+	50S ribosomal protein L9	NA	NA	NA	NA
WP_007972428.1\|2036533_2037499_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_007972430.1\|2037682_2041186_+	chromosome segregation protein SMC	NA	NA	NA	NA
WP_005914888.1\|2041242_2041974_+	cell division protein ZipA	NA	NA	NA	NA
WP_042805701.1\|2041980_2042364_+	hypothetical protein	NA	NA	NA	NA
WP_007972432.1\|2042511_2043633_-	pyridoxal phosphate-dependent aminotransferase	A0A1X6WGT4	Pacmanvirus	4.5e-07	24.4
WP_007972434.1\|2043976_2046478_+	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	7.4e-119	40.1
WP_007972436.1\|2046474_2047437_+	EF-P lysine aminoacylase GenX	A0A1V0SAC0	Catovirus	2.8e-18	26.2
WP_007966318.1\|2047545_2048232_+	DUF3011 domain-containing protein	NA	NA	NA	NA
WP_007972437.1\|2048424_2049489_+	S-methyl-5-thioribose-1-phosphate isomerase	NA	NA	NA	NA
WP_007966320.1\|2049698_2052398_+	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	4.4e-109	34.4
WP_042805702.1\|2052624_2055093_+	membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family	NA	NA	NA	NA
WP_005914878.1\|2055488_2056217_-	hypothetical protein	NA	NA	NA	NA
WP_007972442.1\|2056477_2058145_-	urocanate hydratase	NA	NA	NA	NA
2056772:2056787	attL	NA	NA	NA	NA
WP_007966323.1\|2058161_2059019_-	N-formylglutamate deformylase	NA	NA	NA	NA
WP_007972444.1\|2059200_2060742_-	histidine ammonia-lyase	A0A1V0S940	Catovirus	1.8e-78	41.1
WP_007972446.1\|2060755_2061961_-	imidazolonepropionase	NA	NA	NA	NA
WP_042805703.1\|2062021_2063392_+	formimidoylglutamate deiminase	NA	NA	NA	NA
WP_007972450.1\|2063707_2064445_+	histidine utilization repressor	NA	NA	NA	NA
WP_033481359.1\|2064628_2065627_-	restriction endonuclease	NA	NA	NA	NA
WP_007972454.1\|2066191_2066749_-	phasin family protein	NA	NA	NA	NA
WP_008576246.1\|2066911_2067187_-	polyhydroxyalkanoic acid system family protein	NA	NA	NA	NA
WP_022559593.1\|2067423_2068233_+	FHA domain-containing protein	NA	NA	NA	NA
WP_007972456.1\|2068174_2068831_-	protein-methionine-sulfoxide reductase heme-binding subunit MsrQ	NA	NA	NA	NA
WP_007969337.1\|2070100_2071186_+	phosphoserine transaminase	M1Q1P2	Streptococcus_phage	2.2e-75	43.3
WP_007969335.1\|2071270_2072479_+	prephenate dehydratase	NA	NA	NA	NA
WP_007969333.1\|2072601_2073924_+	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_088370784.1\|2075129_2076092_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_082336398.1\|2076913_2081062_+	PAS domain-containing protein	NA	NA	NA	NA
WP_007962306.1\|2081269_2081635_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_007962305.1\|2081612_2082266_-	phophatidylserine decarboxylase associated domain-containing protein	NA	NA	NA	NA
WP_007970204.1\|2082298_2083135_-	putative DNA-binding domain-containing protein	NA	NA	NA	NA
WP_007970203.1\|2083187_2084117_-	DUF692 domain-containing protein	NA	NA	NA	NA
WP_088370744.1\|2085632_2086719_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_017158593.1\|2087652_2088597_-	AAA family ATPase	NA	NA	NA	NA
WP_007971045.1\|2088604_2089264_-	hypothetical protein	NA	NA	NA	NA
WP_017158592.1\|2089290_2090469_-	aminotransferase class III-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_007971047.1\|2090530_2091574_-	sulfotransferase family protein	NA	NA	NA	NA
WP_007971048.1\|2091566_2092445_-	TauD/TfdA family dioxygenase	NA	NA	NA	NA
WP_007971049.1\|2092720_2093776_-	DNA-binding protein	NA	NA	NA	NA
WP_007969091.1\|2093888_2094851_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007971051.1\|2095038_2096313_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_007971053.1\|2096321_2099315_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.4e-87	27.9
2103651:2103666	attR	NA	NA	NA	NA

DBSCAN-SWA_12

2103846 : 2142671

Xanthomonas_phage(65.52%)

transposase,integrase

attL 2128175:2128234|attR 2142651:2143845

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042805193.1\|2103846_2104050_+	hypothetical protein	A0A1D6ZIU2	Xanthomonas_phage	4.8e-29	97.0
WP_042805195.1\|2104062_2104293_+	methyltransferase	A0A1W6DXZ2	Xanthomonas_phage	2.1e-28	94.7
WP_007969856.1\|2104430_2105864_+	hypothetical protein	A0A1D6ZIU5	Xanthomonas_phage	2.3e-173	76.9
WP_007970474.1\|2105863_2106193_+	DUF2523 domain-containing protein	A0A1D6ZIU0	Xanthomonas_phage	1.6e-53	95.4
WP_007969859.1\|2106192_2107386_+	hypothetical protein	A0A1W6DXR3	Xanthomonas_phage	1.5e-210	91.4
WP_007970477.1\|2107387_2108068_+	conjugal transfer protein TrbP	A0A1W6DY89	Xanthomonas_phage	1.6e-92	76.5
WP_082336405.1\|2108549_2108810_+	hypothetical protein	NA	NA	NA	NA
WP_007970480.1\|2108844_2109480_-	conjugal transfer protein TrbP	A0A1W6DY89	Xanthomonas_phage	2.3e-93	80.8
WP_007970482.1\|2109481_2110675_-	hypothetical protein	A0A1W6DXR3	Xanthomonas_phage	5.9e-215	95.7
WP_007970474.1\|2110674_2111004_-	DUF2523 domain-containing protein	A0A1D6ZIU0	Xanthomonas_phage	1.6e-53	95.4
WP_007970484.1\|2111003_2112437_-	hypothetical protein	A0A1D6ZIU5	Xanthomonas_phage	3.3e-172	76.7
WP_042805195.1\|2112573_2112804_-	methyltransferase	A0A1W6DXZ2	Xanthomonas_phage	2.1e-28	94.7
WP_042805193.1\|2112816_2113020_-	hypothetical protein	A0A1D6ZIU2	Xanthomonas_phage	4.8e-29	97.0
WP_011347636.1\|2113023_2113320_-	hypothetical protein	NA	NA	NA	NA
WP_007970486.1\|2113651_2114377_-	hypothetical protein	NA	NA	NA	NA
WP_162045077.1\|2114366_2114507_-	hypothetical protein	NA	NA	NA	NA
WP_042805342.1\|2114503_2114689_-	hypothetical protein	NA	NA	NA	NA
WP_042805343.1\|2114688_2114871_-	hypothetical protein	NA	NA	NA	NA
WP_007970489.1\|2115082_2115541_+	transcriptional regulator	NA	NA	NA	NA
WP_007970491.1\|2115522_2115849_+	hypothetical protein	S0F2N2	Stenotrophomonas_phage	5.4e-14	38.2
WP_088370786.1\|2115915_2116227_+	chloride channel protein	A0A1W6DXV7	Xanthomonas_phage	1.4e-48	88.3
WP_042805344.1\|2116245_2116458_-	hypothetical protein	NA	NA	NA	NA
WP_007970497.1\|2116740_2118063_-	hypothetical protein	Q4LAU4	Stenotrophomonas_phage	6.9e-132	56.5
WP_088370746.1\|2118319_2119407_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007969861.1\|2119724_2120393_-	conjugal transfer protein TrbP	A0A1D6ZIU7	Xanthomonas_phage	5.6e-82	72.6
WP_007969859.1\|2120394_2121588_-	hypothetical protein	A0A1W6DXR3	Xanthomonas_phage	1.5e-210	91.4
WP_007969858.1\|2121587_2121917_-	DUF2523 domain-containing protein	A0A1D6ZIU0	Xanthomonas_phage	3.5e-53	94.5
WP_007969856.1\|2121916_2123350_-	hypothetical protein	A0A1D6ZIU5	Xanthomonas_phage	2.3e-173	76.9
WP_042805195.1\|2123486_2123717_-	methyltransferase	A0A1W6DXZ2	Xanthomonas_phage	2.1e-28	94.7
WP_042805193.1\|2123729_2123933_-	hypothetical protein	A0A1D6ZIU2	Xanthomonas_phage	4.8e-29	97.0
WP_011347636.1\|2123936_2124233_-	hypothetical protein	NA	NA	NA	NA
WP_007969851.1\|2124560_2125280_-	hypothetical protein	NA	NA	NA	NA
WP_162045071.1\|2125269_2125410_-	hypothetical protein	NA	NA	NA	NA
WP_082336388.1\|2125406_2125592_-	hypothetical protein	NA	NA	NA	NA
WP_131438830.1\|2125575_2125818_-	hypothetical protein	NA	NA	NA	NA
WP_007969847.1\|2125957_2126359_+	hypothetical protein	NA	NA	NA	NA
WP_098477673.1\|2127064_2128166_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6
2128175:2128234	attL	NA	NA	NA	NA
WP_088370746.1\|2128212_2129300_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007969253.1\|2129907_2130750_+	hypothetical protein	NA	NA	NA	NA
WP_007969255.1\|2130861_2131917_-	DNA-binding protein	NA	NA	NA	NA
WP_088370746.1\|2132556_2133644_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_157883161.1\|2134339_2135227_-\|integrase	integrase arm-type DNA-binding domain-containing protein	G9L697	Escherichia_phage	3.6e-76	50.9
WP_007969091.1\|2135483_2136446_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007969691.1\|2136612_2138178_-	glutamine-hydrolyzing GMP synthase	NA	NA	NA	NA
WP_007969694.1\|2138304_2139762_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	3.1e-85	38.9
WP_007969695.1\|2139928_2140840_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	2.3e-30	35.1
WP_007963232.1\|2140890_2141211_+	DUF1244 domain-containing protein	NA	NA	NA	NA
WP_088370746.1\|2141584_2142671_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
2142651:2143845	attR	NA	NA	NA	NA

DBSCAN-SWA_13

2176503 : 2219076

Leptospira_phage(22.22%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007970742.1\|2176503_2177208_-\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	1.1e-16	31.2
WP_088370789.1\|2177174_2177492_+\|transposase	transposase	NA	NA	NA	NA
WP_157883183.1\|2177515_2178022_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_088370744.1\|2178070_2179157_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007969091.1\|2179535_2180498_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_088370791.1\|2180488_2181532_-	hypothetical protein	NA	NA	NA	NA
WP_007970654.1\|2181628_2182093_-	hypothetical protein	NA	NA	NA	NA
WP_007970655.1\|2182481_2184014_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_042805372.1\|2184594_2184879_+	DUF4190 domain-containing protein	NA	NA	NA	NA
WP_007970656.1\|2184881_2185649_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_007965740.1\|2185654_2186710_+	quinone-dependent dihydroorotate dehydrogenase	NA	NA	NA	NA
WP_007970657.1\|2186706_2187759_+	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_042675614.1\|2187752_2188664_+	DMT family transporter	NA	NA	NA	NA
WP_007970658.1\|2188807_2189512_+	aspartate/glutamate racemase family protein	NA	NA	NA	NA
WP_007970659.1\|2189705_2190989_+	MFS transporter	NA	NA	NA	NA
WP_007970660.1\|2191132_2191864_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_007965749.1\|2191844_2193110_-	flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase	NA	NA	NA	NA
WP_007970661.1\|2193315_2194542_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_003481988.1\|2194538_2195105_+	response regulator transcription factor	NA	NA	NA	NA
WP_007970662.1\|2195286_2196273_-	cellulase family glycosylhydrolase	NA	NA	NA	NA
WP_088370772.1\|2196594_2197681_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.2e-42	36.4
WP_007969736.1\|2197919_2199776_+	EAL domain-containing protein	NA	NA	NA	NA
WP_005923413.1\|2199974_2201537_-	sodium/sugar symporter	A0A240F465	Aeromonas_phage	4.2e-88	41.0
WP_042805169.1\|2201794_2204407_-	exo 1,3/1,4-beta-D-glucan glucohydrolase	NA	NA	NA	NA
WP_042675619.1\|2204841_2206797_+	DUF839 domain-containing protein	NA	NA	NA	NA
WP_007965756.1\|2207007_2207631_-	hypothetical protein	NA	NA	NA	NA
WP_007970218.1\|2207634_2207979_-	type II toxin-antitoxin system prevent-host-death family antitoxin	NA	NA	NA	NA
WP_007970221.1\|2208135_2209650_-	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_003481969.1\|2209646_2210027_-	aspartate 1-decarboxylase	NA	NA	NA	NA
WP_007970223.1\|2210194_2211037_-	pantoate--beta-alanine ligase	NA	NA	NA	NA
WP_007965766.1\|2211033_2211849_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	4.2e-31	34.6
WP_007965767.1\|2211884_2212370_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_007965770.1\|2212373_2213741_-	polynucleotide adenylyltransferase PcnB	A0A1B1IVF3	uncultured_Mediterranean_phage	1.2e-25	38.4
WP_007965771.1\|2214350_2215268_-	GTP cyclohydrolase I FolE2	NA	NA	NA	NA
WP_042805290.1\|2215304_2216468_-	N-acetylmuramoyl-L-alanine amidase	M1IEI0	Bacillus_phage	2.9e-09	41.6
WP_007975311.1\|2216882_2217863_+\|transposase	IS5-like element ISXfu2 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.5
WP_088370792.1\|2218095_2219076_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	2.3e-100	61.6

DBSCAN-SWA_14

2259692 : 2270383

Leptospira_phage(16.67%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088370746.1\|2259692_2260779_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_042805593.1\|2262867_2263080_-	carbon storage regulator CsrA	J7I430	Pseudomonas_phage	5.1e-13	74.5
WP_007966762.1\|2263219_2265868_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	9.7e-85	40.0
WP_007966764.1\|2265969_2266458_-	recombination regulator RecX	NA	NA	NA	NA
WP_003481871.1\|2266770_2267805_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	5.1e-114	61.3
WP_007972059.1\|2267977_2268619_-	transcriptional repressor LexA	A0A1W6JNS2	Morganella_phage	2.4e-13	40.2
WP_007966769.1\|2268706_2270383_-	2-polyprenylphenol 6-hydroxylase	G8DDN0	Micromonas_pusilla_virus	1.9e-41	29.4

DBSCAN-SWA_15

2290533 : 2430391

109

Leptospira_phage(50.0%)

tRNA,transposase,integrase

attL 2350474:2350533|attR 2429257:2430455

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007962146.1\|2290533_2291514_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_005914995.1\|2291589_2291832_-	hypothetical protein	NA	NA	NA	NA
WP_007969183.1\|2291996_2293886_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	2.1e-89	33.8
WP_007969091.1\|2293972_2294935_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007969091.1\|2295226_2296189_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_131454090.1\|2296284_2297016_+	hypothetical protein	NA	NA	NA	NA
WP_098477673.1\|2297012_2298115_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6
WP_042675941.1\|2300143_2300905_-	YdcF family protein	NA	NA	NA	NA
WP_007966804.1\|2301011_2302139_-	inorganic phosphate transporter	NA	NA	NA	NA
WP_007966806.1\|2302148_2302775_-	DUF47 family protein	NA	NA	NA	NA
WP_007966808.1\|2303047_2304388_+	HlyC/CorC family transporter	NA	NA	NA	NA
WP_007972292.1\|2304371_2305040_+	exopolysaccharide biosynthesis protein	NA	NA	NA	NA
WP_007972293.1\|2305074_2305575_-	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_007972294.1\|2305635_2306637_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_007972295.1\|2306983_2308408_+	MFS transporter	NA	NA	NA	NA
WP_042805669.1\|2308621_2310343_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	5.6e-09	33.9
WP_007972297.1\|2310436_2311495_-	hypothetical protein	NA	NA	NA	NA
WP_042805670.1\|2311626_2313180_+	B12-binding domain-containing radical SAM protein	NA	NA	NA	NA
WP_007972299.1\|2313236_2314451_+	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_007972301.1\|2314543_2315665_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_007972302.1\|2315661_2316792_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_007966825.1\|2316916_2317615_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_088370793.1\|2317611_2318847_-	amidohydrolase family protein	NA	NA	NA	NA
WP_007972304.1\|2318859_2319702_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_007966828.1\|2319985_2320837_-	chain-length determining protein	NA	NA	NA	NA
WP_007972305.1\|2320881_2322015_-	hypothetical protein	NA	NA	NA	NA
WP_007972306.1\|2322011_2322950_-	glycosyltransferase	NA	NA	NA	NA
WP_007972307.1\|2322946_2324200_-	O-antigen translocase	NA	NA	NA	NA
WP_082336474.1\|2324196_2325321_-	DegT/DnrJ/EryC1/StrS family aminotransferase	E5ES42	Bathycoccus_sp._RCC1105_virus	3.2e-29	28.1
WP_082336475.1\|2325308_2326220_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_007972312.1\|2326227_2327181_-	hypothetical protein	NA	NA	NA	NA
WP_007966838.1\|2327184_2327856_-	acetyltransferase	NA	NA	NA	NA
WP_007972313.1\|2327852_2328290_-	WxcM-like domain-containing protein	NA	NA	NA	NA
WP_007966841.1\|2328705_2329215_+	cytochrome b/b6 domain-containing protein	NA	NA	NA	NA
WP_007972314.1\|2329298_2330642_+	hypothetical protein	NA	NA	NA	NA
WP_042805674.1\|2330668_2331061_+	c-type cytochrome	NA	NA	NA	NA
WP_042675163.1\|2331577_2332300_+	hypothetical protein	NA	NA	NA	NA
WP_007964109.1\|2332351_2332945_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_007964107.1\|2332941_2333598_+	zf-HC2 domain-containing protein	NA	NA	NA	NA
WP_007970697.1\|2333594_2334920_+	S8 family serine peptidase	A0A217EQY2	Bacillus_phage	1.5e-22	39.2
WP_007970695.1\|2334930_2335689_+	cytochrome c biogenesis protein CcsA	NA	NA	NA	NA
WP_039569300.1\|2335685_2335892_+	heme exporter protein CcmD	NA	NA	NA	NA
WP_007970694.1\|2335888_2336359_+	cytochrome c maturation protein CcmE	NA	NA	NA	NA
WP_007970692.1\|2336425_2338414_+	heme lyase CcmF/NrfE family subunit	NA	NA	NA	NA
WP_042675158.1\|2338410_2338953_+	DsbE family thiol:disulfide interchange protein	NA	NA	NA	NA
WP_007970691.1\|2338952_2339450_+	cytochrome c-type biogenesis protein CcmH	NA	NA	NA	NA
WP_042805378.1\|2339443_2340139_+	hypothetical protein	NA	NA	NA	NA
WP_007970689.1\|2340506_2342579_-	PAS domain-containing protein	NA	NA	NA	NA
WP_007964093.1\|2342565_2344083_-	AAA family ATPase	NA	NA	NA	NA
WP_033481396.1\|2344381_2344726_+	response regulator	NA	NA	NA	NA
WP_088370794.1\|2344833_2347689_-	PAS domain-containing protein	NA	NA	NA	NA
WP_007964087.1\|2348153_2348618_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_007970687.1\|2348654_2349845_+	FAD-dependent monooxygenase	NA	NA	NA	NA
2350474:2350533	attL	NA	NA	NA	NA
WP_098477673.1\|2350505_2351608_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6
WP_088370746.1\|2351763_2352851_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_042805069.1\|2352927_2353212_+	hypothetical protein	NA	NA	NA	NA
WP_007969389.1\|2353318_2353831_+	hypothetical protein	NA	NA	NA	NA
WP_007969391.1\|2353831_2354281_+	RES family NAD+ phosphorylase	NA	NA	NA	NA
WP_007969393.1\|2354295_2355768_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_007969395.1\|2356300_2357317_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_088370744.1\|2357942_2359029_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007969978.1\|2359526_2360807_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	7.4e-99	55.4
WP_042805225.1\|2360918_2361581_+	energy transducer TonB	NA	NA	NA	NA
WP_007969972.1\|2362628_2363051_+	DedA family protein	NA	NA	NA	NA
WP_042805224.1\|2363189_2363468_+	hypothetical protein	NA	NA	NA	NA
WP_007969968.1\|2363784_2364792_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_007969966.1\|2365019_2366333_-	sorbosone dehydrogenase family protein	NA	NA	NA	NA
WP_005916026.1\|2366329_2366746_-	hypothetical protein	NA	NA	NA	NA
WP_088370746.1\|2367715_2368802_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_050780414.1\|2369867_2370572_-	response regulator transcription factor	NA	NA	NA	NA
WP_033481483.1\|2370568_2371591_-	histidine kinase	Q9EYF3	Enterobacteria_phage	2.3e-10	28.7
WP_039731535.1\|2371806_2372082_-	hypothetical protein	NA	NA	NA	NA
WP_042805218.1\|2373164_2375909_+	S8 family serine peptidase	NA	NA	NA	NA
WP_042805217.1\|2376397_2377513_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_088370795.1\|2380067_2381155_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.2e-43	36.8
WP_007970310.1\|2381793_2383278_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_050780423.1\|2383396_2384419_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_007970314.1\|2384415_2385027_+	response regulator transcription factor	NA	NA	NA	NA
WP_007970316.1\|2385332_2395544_-	autotransporter-associated beta strand repeat-containing protein	NA	NA	NA	NA
WP_007969091.1\|2395763_2396726_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_005916070.1\|2396937_2397195_-	stress-induced protein	NA	NA	NA	NA
WP_007963473.1\|2399083_2400061_+	siroheme synthase	NA	NA	NA	NA
WP_042674992.1\|2400227_2400386_-	XapX domain-containing protein	NA	NA	NA	NA
WP_042805275.1\|2400382_2400613_-	DUF1427 family protein	NA	NA	NA	NA
WP_007970169.1\|2400618_2402247_-	MFS transporter	NA	NA	NA	NA
WP_007970171.1\|2402341_2404189_-	amidohydrolase	NA	NA	NA	NA
WP_042805277.1\|2404302_2404686_-	DoxX family protein	NA	NA	NA	NA
WP_007970176.1\|2404722_2405379_-	hydrolase	NA	NA	NA	NA
WP_007970178.1\|2405375_2405849_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_088370746.1\|2407821_2408908_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007970341.1\|2409238_2409880_+	response regulator transcription factor	NA	NA	NA	NA
WP_007970342.1\|2410135_2411263_+	Cache 3/Cache 2 fusion domain-containing protein	NA	NA	NA	NA
WP_007970344.1\|2411307_2411922_+	hypothetical protein	NA	NA	NA	NA
WP_042805313.1\|2413275_2414844_+	oxidoreductase	NA	NA	NA	NA
WP_042805314.1\|2414865_2417310_+	DUF2309 domain-containing protein	NA	NA	NA	NA
WP_162829047.1\|2417556_2417721_-	hypothetical protein	NA	NA	NA	NA
WP_162269069.1\|2418629_2418968_+	hypothetical protein	NA	NA	NA	NA
WP_042805317.1\|2418973_2419624_+	recombinase family protein	NA	NA	NA	NA
WP_007970355.1\|2419718_2420177_+	hypothetical protein	NA	NA	NA	NA
WP_007970357.1\|2420185_2420494_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_088370744.1\|2421590_2422677_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_131438827.1\|2423188_2423620_+	hypothetical protein	NA	NA	NA	NA
WP_082336369.1\|2423688_2424213_-	phenolic acid decarboxylase	NA	NA	NA	NA
WP_007969500.1\|2424873_2425737_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_007969501.1\|2425757_2426519_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	3.6e-24	34.8
WP_007969091.1\|2426557_2427520_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_162269070.1\|2427615_2427909_-	DUF3861 family protein	NA	NA	NA	NA
WP_007962146.1\|2427956_2428937_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_098477673.1\|2429288_2430391_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6
2429257:2430455	attR	NA	NA	NA	NA

DBSCAN-SWA_16

2618892 : 2691642

uncultured_Caudovirales_phage(36.84%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_098477673.1\|2618892_2619994_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6
WP_007969671.1\|2620486_2620858_+	flagellar hook-basal body complex protein FliE	NA	NA	NA	NA
WP_088370806.1\|2620871_2622596_+	flagellar M-ring protein FliF	NA	NA	NA	NA
WP_005918162.1\|2622606_2623596_+	flagellar motor switch protein FliG	NA	NA	NA	NA
WP_005918165.1\|2623592_2624213_+	flagellar assembly protein FliH	NA	NA	NA	NA
WP_005918170.1\|2624209_2625586_+	FliI/YscN family ATPase	NA	NA	NA	NA
WP_005918178.1\|2625589_2626045_+	flagellar export protein FliJ	NA	NA	NA	NA
WP_042805142.1\|2626041_2627334_+	flagellar hook-length control protein FliK	NA	NA	NA	NA
WP_173362021.1\|2627499_2628051_+	flagellar basal body-associated FliL family protein	NA	NA	NA	NA
WP_005917976.1\|2628061_2629075_+	flagellar motor switch protein FliM	NA	NA	NA	NA
WP_007969679.1\|2629071_2629410_+	flagellar motor switch protein FliN	NA	NA	NA	NA
WP_005921346.1\|2629406_2629814_+	flagellar biosynthetic protein FliO	NA	NA	NA	NA
WP_007969680.1\|2629815_2630661_+	flagellar type III secretion system pore protein FliP	NA	NA	NA	NA
WP_088370746.1\|2630869_2631956_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_005917968.1\|2632728_2632998_+	flagellar biosynthetic protein FliQ	NA	NA	NA	NA
WP_007975658.1\|2633011_2633803_+	flagellar biosynthetic protein FliR	NA	NA	NA	NA
WP_088370746.1\|2634092_2635179_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_088370807.1\|2635205_2638055_+	GGDEF domain-containing protein	G3MA91	Bacillus_virus	3.9e-15	31.4
WP_089112489.1\|2638430_2641352_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	3.5e-11	37.0
WP_007970797.1\|2641622_2643710_+	bifunctional diguanylate cyclase/phosphodiesterase	G3MA91	Bacillus_virus	1.5e-19	34.3
WP_007970795.1\|2643863_2644994_+	flagellar biosynthesis protein FlhB	NA	NA	NA	NA
WP_029819345.1\|2645011_2647084_+	flagellar biosynthesis protein FlhA	NA	NA	NA	NA
WP_088370808.1\|2648022_2649714_+	flagellar biosynthesis protein FlhF	NA	NA	NA	NA
WP_005918202.1\|2649700_2650585_+	MinD/ParA family protein	NA	NA	NA	NA
WP_005918198.1\|2650581_2651349_+	RNA polymerase sigma factor FliA	NA	NA	NA	NA
WP_002813536.1\|2651371_2651764_+	chemotaxis protein CheY	NA	NA	NA	NA
WP_007970783.1\|2651763_2652390_+	protein phosphatase CheZ	NA	NA	NA	NA
WP_007970781.1\|2652392_2654051_+	chemotaxis protein CheA	NA	NA	NA	NA
WP_088370744.1\|2654278_2655365_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_131454219.1\|2655362_2656472_-	hypothetical protein	NA	NA	NA	NA
WP_005914940.1\|2660954_2661695_+	flagellar motor protein	NA	NA	NA	NA
WP_005931860.1\|2661701_2662676_+	flagellar motor protein MotD	NA	NA	NA	NA
WP_003489696.1\|2662677_2663460_+	ParA family protein	Q8JL10	Natrialba_phage	5.9e-14	37.1
WP_007971282.1\|2663456_2664731_+	chemotaxis protein CheW	NA	NA	NA	NA
WP_003489692.1\|2664833_2665142_+	STAS domain-containing protein	NA	NA	NA	NA
WP_002806565.1\|2665138_2665504_+	response regulator	W8CYM9	Bacillus_phage	2.7e-14	39.3
WP_007971284.1\|2665537_2667538_+	chemotaxis protein CheA	NA	NA	NA	NA
WP_042805473.1\|2667778_2670070_+	MCP four helix bundle domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.5e-09	61.7
WP_033481115.1\|2670388_2670922_+	hypothetical protein	NA	NA	NA	NA
WP_007971288.1\|2671650_2673828_+	cache domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	3.2e-09	53.6
WP_042805474.1\|2673900_2676690_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.3e-10	47.8
WP_007962534.1\|2676992_2677754_+	transporter	NA	NA	NA	NA
WP_042805475.1\|2677767_2680137_+	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	4.9e-11	54.4
WP_088370746.1\|2682075_2683162_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_082336594.1\|2683203_2683815_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.2e-07	77.5
WP_007962146.1\|2683929_2684910_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_007969229.1\|2685476_2687735_+	MCP four helix bundle domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	9.3e-12	40.3
WP_098477673.1\|2687922_2689024_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6
WP_042674369.1\|2689530_2691642_+	CHASE3 domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	3.0e-12	38.8

DBSCAN-SWA_17

2732976 : 2798445

Leptospira_phage(25.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007973515.1\|2732976_2734494_-\|tRNA	lysine--tRNA ligase	A0A2K9KZX5	Tupanvirus	7.2e-85	39.7
WP_099050317.1\|2734704_2735830_-	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	9.4e-05	39.7
WP_042805941.1\|2737186_2738401_+	acyltransferase family protein	NA	NA	NA	NA
WP_007973510.1\|2738727_2740467_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	4.2e-44	28.6
WP_007973508.1\|2740463_2741384_-	hypothetical protein	NA	NA	NA	NA
WP_003486289.1\|2741400_2741865_-	transcription elongation factor GreA	NA	NA	NA	NA
WP_007973506.1\|2741873_2745116_-	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
WP_007962953.1\|2745124_2745568_-	hypothetical protein	NA	NA	NA	NA
WP_042674829.1\|2745567_2746743_-	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	6.3e-44	31.8
WP_007962949.1\|2746982_2747699_-	4-hydroxy-tetrahydrodipicolinate reductase	NA	NA	NA	NA
WP_042674827.1\|2748107_2748827_-	MOSC domain-containing protein	NA	NA	NA	NA
WP_046121198.1\|2748823_2750026_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_007962945.1\|2750253_2750754_-	hypothetical protein	NA	NA	NA	NA
WP_022559069.1\|2750813_2751068_-	hypothetical protein	NA	NA	NA	NA
WP_007962944.1\|2751069_2752929_-	ferrous iron transporter B	NA	NA	NA	NA
WP_003486267.1\|2752925_2753174_-	ferrous iron transport protein A	NA	NA	NA	NA
WP_088370811.1\|2753288_2754086_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_042674819.1\|2754082_2754472_+	VOC family protein	NA	NA	NA	NA
WP_007973499.1\|2754578_2755475_+	hydroxymethylglutaryl-CoA lyase	A0A1V0SKU2	Klosneuvirus	1.0e-33	33.3
WP_007962940.1\|2755611_2756382_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	3.4e-14	32.2
WP_007962938.1\|2756502_2757069_+	elongation factor P-like protein YeiP	NA	NA	NA	NA
WP_007962937.1\|2757068_2757455_+	hypothetical protein	NA	NA	NA	NA
WP_007973497.1\|2757682_2759539_-	DUF4105 domain-containing protein	NA	NA	NA	NA
WP_005915396.1\|2759535_2759835_-	DUF2388 domain-containing protein	NA	NA	NA	NA
WP_007973496.1\|2759869_2761288_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_007973495.1\|2761496_2762738_+	phosphoglycerate dehydrogenase	A0A1V0SBV6	Catovirus	9.7e-104	47.9
WP_087945324.1\|2762871_2763483_-	NUDIX hydrolase	NA	NA	NA	NA
WP_022559057.1\|2763624_2765097_+	amino acid permease	NA	NA	NA	NA
WP_007962121.1\|2765173_2766604_+	amino acid permease	NA	NA	NA	NA
WP_007962123.1\|2766693_2767347_+	methylthioribulose 1-phosphate dehydratase	NA	NA	NA	NA
WP_005915388.1\|2767382_2767949_+	acireductone dioxygenase	NA	NA	NA	NA
WP_007962134.1\|2767951_2768650_+	acireductone synthase	NA	NA	NA	NA
WP_088370804.1\|2768887_2769974_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.9e-42	36.4
WP_088370812.1\|2770110_2771697_-	calcineurin-like phosphoesterase C-terminal domain-containing protein	NA	NA	NA	NA
WP_007963934.1\|2771865_2772486_-	bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE	NA	NA	NA	NA
WP_007970958.1\|2772475_2773252_-	imidazole glycerol phosphate synthase subunit HisF	NA	NA	NA	NA
WP_007970957.1\|2773245_2773980_-	1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase	NA	NA	NA	NA
WP_007963930.1\|2773976_2774579_-	imidazole glycerol phosphate synthase subunit HisH	NA	NA	NA	NA
WP_007963926.1\|2774575_2775703_-	bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB	NA	NA	NA	NA
WP_007970954.1\|2775699_2776791_-	histidinol-phosphate transaminase	NA	NA	NA	NA
WP_007970952.1\|2776787_2778083_-	histidinol dehydrogenase	NA	NA	NA	NA
WP_007970951.1\|2778079_2778994_-	ATP phosphoribosyltransferase	NA	NA	NA	NA
WP_007970950.1\|2779003_2779327_-	DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_042675106.1\|2779952_2781365_-\|tRNA	histidine--tRNA ligase	A0A2K9L6G5	Tupanvirus	1.0e-40	28.4
WP_172955836.1\|2781568_2782234_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_042675105.1\|2782319_2783063_-	murein L,D-transpeptidase catalytic domain family protein	NA	NA	NA	NA
WP_173362027.1\|2783163_2784474_-	threonine synthase	NA	NA	NA	NA
WP_042675108.1\|2784629_2784944_+	EthD family reductase	NA	NA	NA	NA
WP_007970948.1\|2785018_2785999_-	homoserine kinase	NA	NA	NA	NA
WP_007970947.1\|2786040_2788548_-	bifunctional aspartate kinase/homoserine dehydrogenase I	NA	NA	NA	NA
WP_007970946.1\|2789234_2789735_-	tryptophan-rich sensory protein	NA	NA	NA	NA
WP_157883184.1\|2790200_2790374_+	hypothetical protein	NA	NA	NA	NA
WP_007962146.1\|2790354_2791335_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_131438933.1\|2792916_2793168_+	hypothetical protein	NA	NA	NA	NA
WP_131454068.1\|2793172_2793442_+	hypothetical protein	NA	NA	NA	NA
WP_088370744.1\|2793546_2794634_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007975469.1\|2794722_2795685_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_131477119.1\|2795753_2796095_+	hypothetical protein	NA	NA	NA	NA
WP_007969091.1\|2796108_2797071_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_088370746.1\|2797357_2798445_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8

DBSCAN-SWA_18

2925466 : 3010729

Bacillus_phage(20.0%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007965679.1\|2925466_2925907_-\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	7.1e-25	46.0
WP_005915265.1\|2925985_2926621_-	glutathione S-transferase N-terminal domain-containing protein	NA	NA	NA	NA
WP_007975178.1\|2926906_2927851_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007969900.1\|2928072_2928831_-	cytochrome c1	NA	NA	NA	NA
WP_007969898.1\|2928823_2930083_-	cytochrome bc complex cytochrome b subunit	NA	NA	NA	NA
WP_007965672.1\|2930082_2930727_-	ubiquinol-cytochrome c reductase iron-sulfur subunit	NA	NA	NA	NA
WP_007969896.1\|2931235_2932219_-	lytic transglycosylase domain-containing protein	A0A0H3V0Q1	Geobacillus_virus	7.4e-30	56.9
WP_007965669.1\|2932412_2933378_-	WYL domain-containing protein	NA	NA	NA	NA
WP_007969894.1\|2933483_2934128_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_007965666.1\|2934166_2935621_+\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
WP_088370817.1\|2936041_2937025_+	PhoH family protein	A0A1B2ICF6	Erwinia_phage	7.3e-46	48.6
WP_003488340.1\|2937673_2938159_+	rRNA maturation RNase YbeY	NA	NA	NA	NA
WP_007963745.1\|2938158_2938677_+	hypothetical protein	NA	NA	NA	NA
WP_003488337.1\|2938772_2939651_+	CBS domain-containing protein	NA	NA	NA	NA
WP_042805246.1\|2939647_2940931_+	DUF4105 domain-containing protein	NA	NA	NA	NA
WP_007970040.1\|2940946_2941948_+	magnesium and cobalt transport protein CorA	NA	NA	NA	NA
WP_172955830.1\|2942099_2943491_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_042805248.1\|2943670_2944519_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_050780418.1\|2944515_2945427_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_007970045.1\|2945555_2946689_-	polyamine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.8e-25	34.8
WP_007970047.1\|2946802_2948293_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_022559356.1\|2948297_2949884_-	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_007963775.1\|2949880_2951083_-	HlyD family secretion protein	NA	NA	NA	NA
WP_007972327.1\|2951330_2952446_-	polyamine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_007972329.1\|2952665_2954033_-	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_007963778.1\|2954629_2956015_-	glutamine synthetase	NA	NA	NA	NA
WP_007972331.1\|2956021_2956777_-	gamma-glutamyl-gamma-aminobutyrate hydrolase family protein	NA	NA	NA	NA
WP_007972333.1\|2956920_2958300_+	glutamine synthetase	NA	NA	NA	NA
WP_173362043.1\|2958296_2959616_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_007972337.1\|2959700_2960999_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.1e-20	37.6
WP_005915313.1\|2961128_2961590_+	bacteriohemerythrin	NA	NA	NA	NA
WP_007972338.1\|2961709_2962990_-	MHS family MFS transporter	NA	NA	NA	NA
WP_022559366.1\|2963684_2963963_-	hypothetical protein	NA	NA	NA	NA
WP_007972339.1\|2963952_2966301_-	FdhF/YdeP family oxidoreductase	NA	NA	NA	NA
WP_007972340.1\|2966297_2967143_-	formate dehydrogenase accessory sulfurtransferase FdhD	NA	NA	NA	NA
WP_005915324.1\|2967149_2968829_-	OFA family MFS transporter	NA	NA	NA	NA
WP_039731973.1\|2970847_2971702_+	plasmid replication/partition related protein	A0A1B1INV8	uncultured_Mediterranean_phage	6.4e-14	39.8
WP_007972342.1\|2971932_2973237_+	DUF445 family protein	NA	NA	NA	NA
WP_007972343.1\|2973381_2977476_+	response regulator	A0A1V0SGX0	Hokovirus	1.2e-57	28.9
WP_007972344.1\|2977509_2978496_+	response regulator	W8CYM9	Bacillus_phage	9.7e-06	27.6
WP_007962773.1\|2979058_2980486_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_082336480.1\|2980650_2981382_-	hypothetical protein	NA	NA	NA	NA
WP_082336481.1\|2981314_2983468_-	hypothetical protein	NA	NA	NA	NA
WP_007975321.1\|2984672_2985635_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_088370784.1\|2986275_2987238_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_088370820.1\|2987444_2988032_-	DUF1629 domain-containing protein	NA	NA	NA	NA
WP_088370746.1\|2988083_2989170_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007962168.1\|2989220_2989619_-	hypothetical protein	NA	NA	NA	NA
WP_017154836.1\|2989855_2990155_-	hypothetical protein	NA	NA	NA	NA
WP_007969987.1\|2990657_2995667_-	NAD-glutamate dehydrogenase	NA	NA	NA	NA
WP_007969989.1\|2995945_2996605_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_007962519.1\|2996619_2997924_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_007969992.1\|2997936_3001107_+	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
WP_005917351.1\|3001444_3002440_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_007969645.1\|3002601_3005118_+	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	2.3e-11	29.3
WP_007969646.1\|3005114_3006071_+	1-phosphofructokinase	NA	NA	NA	NA
WP_088370821.1\|3006223_3007966_+	PTS fructose transporter subunit EIIBC	NA	NA	NA	NA
WP_042805138.1\|3008138_3009416_+	carbohydrate porin	NA	NA	NA	NA
WP_007969091.1\|3009766_3010729_+\|transposase	IS1595 family transposase	NA	NA	NA	NA

DBSCAN-SWA_19

3213565 : 3273769

Leptospira_phage(13.33%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007973634.1\|3213565_3214339_-\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_007973636.1\|3214514_3214922_-	VOC family protein	NA	NA	NA	NA
WP_042805963.1\|3214918_3216847_-	ferrous iron transporter B	NA	NA	NA	NA
WP_007962932.1\|3217539_3218565_-	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_007973640.1\|3218647_3219721_-	D-glycerate dehydrogenase	M1HUT5	Acanthocystis_turfacea_Chlorella_virus	3.2e-18	26.9
WP_007973642.1\|3219713_3220817_-	chorismate synthase	A0A291AU41	Pandoravirus	1.6e-73	40.4
WP_007963936.1\|3220827_3221754_-	50S ribosomal protein L3 N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_042805965.1\|3221834_3222485_+	SCO family protein	NA	NA	NA	NA
WP_007973647.1\|3222481_3223324_+	phosphatidylserine decarboxylase	NA	NA	NA	NA
WP_007963939.1\|3223553_3225137_-	transglycosylase SLT domain-containing protein	A0A2H4J9N7	uncultured_Caudovirales_phage	5.5e-11	31.5
WP_007973649.1\|3225429_3226935_+	DUF853 family protein	A0A248XCZ8	Klebsiella_phage	4.2e-85	45.9
WP_007973651.1\|3226988_3227609_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_088370746.1\|3229531_3230618_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_088370828.1\|3230584_3232042_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_007963950.1\|3232152_3232659_+	transcription elongation factor GreB	NA	NA	NA	NA
WP_007963954.1\|3234532_3235195_+	dienelactone hydrolase family protein	NA	NA	NA	NA
WP_007963955.1\|3235191_3235626_+	HIT family protein	NA	NA	NA	NA
WP_003486900.1\|3235653_3235821_+	hypothetical protein	NA	NA	NA	NA
WP_022559000.1\|3236066_3236252_+	hypothetical protein	NA	NA	NA	NA
WP_005912996.1\|3236408_3236978_-	dCTP deaminase	S5VM63	Pseudomonas_phage	4.1e-73	70.6
WP_007963958.1\|3237074_3237926_-	iron-sulfur cluster carrier protein ApbC	Q8JL10	Natrialba_phage	7.1e-05	27.0
WP_007970550.1\|3238263_3241248_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	2.7e-14	35.6
WP_007963962.1\|3241609_3244672_+	TonB-dependent receptor	NA	NA	NA	NA
WP_007962146.1\|3244734_3245715_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_007963964.1\|3245878_3247639_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_042805062.1\|3247990_3250093_+	peptidase	A0A1V0SHG2	Klosneuvirus	1.2e-72	27.7
WP_042805121.1\|3250477_3252577_+	M13 family metallopeptidase	E3T4I7	Cafeteria_roenbergensis_virus	3.3e-72	29.7
WP_007969573.1\|3252760_3254776_+	M13 family metallopeptidase	NA	NA	NA	NA
WP_003486879.1\|3254960_3255656_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_007964761.1\|3255696_3256104_-	MGMT family protein	NA	NA	NA	NA
WP_088370829.1\|3256434_3257379_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_039730924.1\|3257624_3258995_-	glutathione-disulfide reductase	A0A2K5B2C5	Erysipelothrix_phage	1.4e-39	26.0
WP_042805402.1\|3258991_3260242_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_007970778.1\|3260249_3261494_-	DUF418 domain-containing protein	NA	NA	NA	NA
WP_007964764.1\|3261725_3262205_-	peptidylprolyl isomerase	NA	NA	NA	NA
WP_042805401.1\|3262314_3262857_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	1.2e-18	40.2
WP_017168813.1\|3262966_3263716_+	C40 family peptidase	A0A0K2SUC1	Clostridium_phage	1.2e-19	38.5
WP_007964766.1\|3263923_3264415_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_007964767.1\|3264649_3265486_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_042805398.1\|3265495_3266836_-	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_042805397.1\|3266978_3268685_+	alkaline phosphatase	NA	NA	NA	NA
WP_042805396.1\|3269054_3270356_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_003486852.1\|3270387_3270648_+	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_007970765.1\|3270649_3271525_+	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_162269063.1\|3272080_3272686_+	hypothetical protein	NA	NA	NA	NA
WP_088370746.1\|3272682_3273769_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8

DBSCAN-SWA_20

3534313 : 3646678

Leptospira_phage(25.0%)

transposase,integrase,protease

attL 3626872:3626888|attR 3649760:3649776

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088370746.1\|3534313_3535400_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007971812.1\|3536385_3538506_-	S9 family peptidase	NA	NA	NA	NA
WP_007971813.1\|3538800_3539646_-	transporter	NA	NA	NA	NA
WP_007971815.1\|3540348_3542319_-	oligopeptide transporter, OPT family	NA	NA	NA	NA
WP_003490255.1\|3542742_3543561_-	HDOD domain-containing protein	NA	NA	NA	NA
WP_162829048.1\|3543825_3544002_+	hypothetical protein	NA	NA	NA	NA
WP_172955903.1\|3544068_3544503_-	VOC family protein	NA	NA	NA	NA
WP_042805552.1\|3544741_3547993_-	error-prone DNA polymerase	A0A1C9LWI9	Streptomyces_phage	4.8e-86	25.3
WP_007971821.1\|3548173_3549592_-	DNA polymerase Y family protein	NA	NA	NA	NA
WP_007965488.1\|3549601_3550255_-	translesion DNA synthesis-associated protein ImuA	NA	NA	NA	NA
WP_007971824.1\|3550256_3550862_-	repressor LexA	A0A1W6JNS2	Morganella_phage	4.7e-11	36.9
WP_014502325.1\|3551011_3551233_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_007971826.1\|3551242_3551668_+	type II toxin-antitoxin system death-on-curing family toxin	A0A1B3AYM0	Gordonia_phage	1.8e-09	45.1
WP_007971828.1\|3551873_3552389_-	hypothetical protein	NA	NA	NA	NA
WP_007971831.1\|3552551_3552902_-	cupin domain-containing protein	NA	NA	NA	NA
WP_007965495.1\|3552964_3553558_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_007971833.1\|3553554_3554871_-	DUF763 domain-containing protein	NA	NA	NA	NA
WP_007965498.1\|3555147_3555726_+	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_042805554.1\|3555698_3556787_+	xanthine dehydrogenase family protein subunit M	NA	NA	NA	NA
WP_007971837.1\|3556783_3559081_+	xanthine dehydrogenase family protein molybdopterin-binding subunit	NA	NA	NA	NA
WP_088370836.1\|3559513_3560600_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007970896.1\|3560706_3563235_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	6.7e-152	34.4
WP_007965505.1\|3563491_3564130_-	HD domain-containing protein	NA	NA	NA	NA
WP_007970894.1\|3564422_3565169_+	EAL domain-containing protein	NA	NA	NA	NA
WP_007965509.1\|3565330_3565636_-	UBP-type zinc finger domain-containing protein	NA	NA	NA	NA
WP_007970892.1\|3565632_3567342_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_007970890.1\|3567695_3568325_-	alpha-ketoglutarate-dependent dioxygenase AlkB	NA	NA	NA	NA
WP_042675543.1\|3568356_3568539_-	hypothetical protein	NA	NA	NA	NA
WP_007965515.1\|3568486_3569467_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_007970887.1\|3569742_3572097_+	glycoside hydrolase family 92 protein	NA	NA	NA	NA
WP_007970882.1\|3573427_3575233_+	glycoside hydrolase family 15 protein	NA	NA	NA	NA
WP_007962146.1\|3575479_3576460_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_088370837.1\|3576522_3578001_-	glycoside hydrolase family 30 protein	NA	NA	NA	NA
WP_042805133.1\|3578322_3579192_-	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
WP_007969632.1\|3579191_3579971_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_042805134.1\|3580186_3580816_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_042805135.1\|3580878_3581655_-	hypothetical protein	NA	NA	NA	NA
WP_088370746.1\|3582075_3583162_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_042805044.1\|3583261_3584836_+	serine/threonine protein kinase	NA	NA	NA	NA
WP_042805045.1\|3585080_3585347_-	hypothetical protein	NA	NA	NA	NA
WP_088370746.1\|3586690_3587778_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007969091.1\|3588023_3588986_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_088370838.1\|3589071_3589269_-	hypothetical protein	NA	NA	NA	NA
WP_088370839.1\|3589265_3590519_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_007969091.1\|3590616_3591579_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_042805640.1\|3591669_3593511_-	SAM-dependent DNA methyltransferase	A0A220A2U4	Liberibacter_phage	5.4e-34	27.2
WP_007972186.1\|3593640_3594204_-	hypothetical protein	NA	NA	NA	NA
WP_007972187.1\|3594308_3595697_-	hypothetical protein	NA	NA	NA	NA
WP_007972190.1\|3596001_3597048_-	hypothetical protein	NA	NA	NA	NA
WP_007972192.1\|3597373_3598003_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_007972194.1\|3598074_3598788_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_082336465.1\|3599041_3599254_+	hypothetical protein	NA	NA	NA	NA
WP_007972196.1\|3599510_3602183_-	M1 family metallopeptidase	A0A0P0IY26	Acinetobacter_phage	4.7e-79	28.6
WP_005913957.1\|3602550_3603843_-	adenylosuccinate synthase	A0A2R8FF47	Brazilian_cedratvirus	5.8e-75	38.4
WP_007972197.1\|3604355_3605219_-\|protease	protease modulator HflC	NA	NA	NA	NA
WP_007972198.1\|3605218_3606346_-\|protease	FtsH protease activity modulator HflK	NA	NA	NA	NA
WP_005996155.1\|3607041_3607428_-	twitching motility response regulator PilH	W8CYM9	Bacillus_phage	5.6e-10	31.8
WP_003483926.1\|3607916_3608816_-	DnaJ domain-containing protein	A0A2L0UZR4	Agrobacterium_phage	7.0e-19	28.0
WP_007972201.1\|3609227_3609704_-	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_003483924.1\|3609866_3610349_+	peroxiredoxin	A0A1D8KSL1	Synechococcus_phage	7.0e-26	38.3
WP_003483923.1\|3610391_3610952_+	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_087945318.1\|3611299_3613702_-	penicillin-binding protein 1C	NA	NA	NA	NA
WP_007962234.1\|3614136_3615084_-	glycerophosphodiester phosphodiesterase family protein	A0A0S2MYI4	Enterococcus_phage	3.8e-07	36.0
WP_007972205.1\|3615231_3618219_-	TonB-dependent receptor	NA	NA	NA	NA
WP_173361968.1\|3618441_3623343_-	alpha-2-macroglobulin family protein	NA	NA	NA	NA
WP_042676284.1\|3624067_3625066_-	nucleoside hydrolase	NA	NA	NA	NA
WP_007970368.1\|3625143_3627360_-	TonB-dependent receptor	NA	NA	NA	NA
3626872:3626888	attL	NA	NA	NA	NA
WP_007970366.1\|3627574_3628774_-	2-methylaconitate cis-trans isomerase PrpF	NA	NA	NA	NA
WP_007969091.1\|3628908_3629871_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007969292.1\|3629966_3630524_-	hypothetical protein	NA	NA	NA	NA
WP_007969022.1\|3630533_3633128_-	Fe/S-dependent 2-methylisocitrate dehydratase AcnD	NA	NA	NA	NA
WP_007969021.1\|3633334_3634489_-	2-methylcitrate synthase	NA	NA	NA	NA
WP_007970235.1\|3634564_3635461_-	methylisocitrate lyase	NA	NA	NA	NA
WP_172955784.1\|3635587_3637207_+	propionate catabolism operon regulatory protein PrpR	NA	NA	NA	NA
WP_039732060.1\|3637438_3637765_-	hypothetical protein	NA	NA	NA	NA
WP_050780421.1\|3638346_3639537_+\|integrase	site-specific integrase	A0A0S2SYQ7	Pseudomonas_phage	3.3e-24	28.1
WP_007970239.1\|3639539_3640007_-	Arc family DNA-binding protein	A0A0U4B0M9	Pseudomonas_phage	1.0e-05	74.3
WP_042805296.1\|3640109_3640319_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_042805298.1\|3640402_3640837_+	hypothetical protein	NA	NA	NA	NA
WP_007970241.1\|3640833_3641589_+	Arc family DNA-binding protein	NA	NA	NA	NA
WP_042805299.1\|3642316_3642601_+	hypothetical protein	NA	NA	NA	NA
WP_042805300.1\|3642604_3642982_+	hypothetical protein	NA	NA	NA	NA
WP_042805301.1\|3643030_3644962_+\|protease	Clp protease ClpP	S5M7Q8	Escherichia_phage	1.6e-65	33.5
WP_088370744.1\|3645590_3646678_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
3649760:3649776	attR	NA	NA	NA	NA

DBSCAN-SWA_21

3824166 : 3892012

Ralstonia_phage(18.18%)

tRNA,transposase,integrase

attL 3878907:3878936|attR 3893582:3893611

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007965876.1\|3824166_3824640_+\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_007972512.1\|3824856_3826554_-	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	5.3e-28	33.5
WP_007972507.1\|3828564_3830298_-	S8 family serine peptidase	A0A2K9L1P3	Tupanvirus	1.5e-17	37.4
WP_007965884.1\|3830606_3831692_-	branched-chain amino acid aminotransferase	NA	NA	NA	NA
WP_003488784.1\|3831756_3832311_-	putative Fe-S cluster assembly protein SufT	NA	NA	NA	NA
WP_007965888.1\|3832497_3832917_+	hypothetical protein	NA	NA	NA	NA
WP_007972506.1\|3833271_3834729_-	NAD(P)(+) transhydrogenase (Re/Si-specific) subunit beta	NA	NA	NA	NA
WP_026006968.1\|3834725_3835031_-	NAD(P) transhydrogenase subunit alpha	NA	NA	NA	NA
WP_003488792.1\|3835154_3835718_+	RNA polymerase sigma factor	NA	NA	NA	NA
WP_042675658.1\|3835714_3836065_+	hypothetical protein	NA	NA	NA	NA
WP_005925947.1\|3836070_3836562_+	DUF3106 domain-containing protein	NA	NA	NA	NA
WP_007972504.1\|3836972_3838070_-	NAD(P) transhydrogenase subunit alpha	NA	NA	NA	NA
WP_007962146.1\|3838756_3839737_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_088370844.1\|3839851_3840451_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_007971450.1\|3841900_3844258_-	DUF1631 domain-containing protein	NA	NA	NA	NA
WP_007971452.1\|3844480_3846712_-	DUF1631 domain-containing protein	NA	NA	NA	NA
WP_007965906.1\|3846842_3847418_+	nitroreductase	NA	NA	NA	NA
WP_007965908.1\|3847414_3848401_+	exodeoxyribonuclease IX	A0A2H4IAS6	Erwinia_phage	3.7e-13	27.0
WP_007965909.1\|3848397_3848949_+	NUDIX hydrolase	NA	NA	NA	NA
WP_042675662.1\|3848941_3849727_+	N-formylglutamate amidohydrolase	NA	NA	NA	NA
WP_007965913.1\|3849933_3850875_-	prolyl aminopeptidase	NA	NA	NA	NA
WP_007965914.1\|3851116_3851977_-	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_003488826.1\|3852178_3852742_+	peroxiredoxin	NA	NA	NA	NA
WP_007971456.1\|3852927_3854520_+	alkyl hydroperoxide reductase subunit F	A0A1W6JK46	Lactococcus_phage	5.9e-21	28.6
WP_007965922.1\|3854611_3855553_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_007971458.1\|3856064_3856505_+	nucleoside diphosphate kinase regulator	NA	NA	NA	NA
WP_007965924.1\|3856558_3857527_+	transaldolase	Q58MB1	Prochlorococcus_phage	1.0e-07	25.1
WP_007971460.1\|3857883_3858453_+	glutamine amidotransferase	NA	NA	NA	NA
WP_007971463.1\|3858871_3859522_-	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_007965927.1\|3859617_3860133_-	SgcJ/EcaC family oxidoreductase	NA	NA	NA	NA
WP_007965928.1\|3860257_3860965_+	response regulator transcription factor	NA	NA	NA	NA
WP_007971465.1\|3860961_3862872_+	CHASE3 domain-containing protein	Q8QKV7	Ectocarpus_siliculosus_virus	9.9e-23	31.3
WP_007965930.1\|3862868_3863333_+	response regulator	NA	NA	NA	NA
WP_022558382.1\|3863427_3863658_-	DUF2007 domain-containing protein	NA	NA	NA	NA
WP_007970430.1\|3863659_3864301_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_007970431.1\|3864790_3866530_+\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	2.8e-181	55.4
WP_050780425.1\|3866635_3866899_+	hypothetical protein	NA	NA	NA	NA
WP_007970432.1\|3866910_3867840_+	DMT family transporter	NA	NA	NA	NA
WP_162045075.1\|3867943_3868153_+	hypothetical protein	NA	NA	NA	NA
WP_033481634.1\|3868506_3868887_+	hypothetical protein	NA	NA	NA	NA
WP_007965277.1\|3868886_3869447_+	nucleoside deaminase	NA	NA	NA	NA
WP_007970434.1\|3869483_3870527_+	23S rRNA (cytidine(2498)-2'-O)-methyltransferase RlmM	NA	NA	NA	NA
WP_007970435.1\|3870839_3871949_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_007970436.1\|3872071_3872977_+	SMP-30/gluconolactonase/LRE family protein	NA	NA	NA	NA
WP_007970438.1\|3873058_3873781_+	hypothetical protein	NA	NA	NA	NA
WP_042805335.1\|3873979_3874381_+	hypothetical protein	NA	NA	NA	NA
WP_007965267.1\|3874510_3874984_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_007970442.1\|3875029_3875857_+	p-hydroxycinnamoyl CoA hydratase/lyase	NA	NA	NA	NA
WP_007970444.1\|3875938_3877408_+	aldehyde dehydrogenase	NA	NA	NA	NA
WP_007962146.1\|3877797_3878778_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
3878907:3878936	attL	NA	NA	NA	NA
WP_007964456.1\|3879776_3880847_-	hypothetical protein	NA	NA	NA	NA
WP_007971055.1\|3880931_3882209_-	lytic murein transglycosylase	NA	NA	NA	NA
WP_007971053.1\|3882330_3885324_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.4e-87	27.9
WP_007971051.1\|3885332_3886607_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_088370845.1\|3886790_3887804_+	DNA-binding protein	NA	NA	NA	NA
WP_098477673.1\|3889004_3890106_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6
WP_007969091.1\|3891049_3892012_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
3893582:3893611	attR	NA	NA	NA	NA

DBSCAN-SWA_22

4200131 : 4246198

Bacillus_phage(20.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007973673.1\|4200131_4201499_-\|protease	ATP-dependent protease ATPase subunit HslU	A0A2H5BJT2	Erwinia_phage	8.1e-43	29.7
WP_003482763.1\|4201599_4202151_-\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_007965029.1\|4202347_4203265_-	tyrosine recombinase XerC	S5M872	Bacillus_phage	1.0e-12	26.8
WP_007973676.1\|4203445_4204117_-	DUF484 family protein	NA	NA	NA	NA
WP_007973677.1\|4204113_4204968_-	diaminopimelate epimerase	NA	NA	NA	NA
WP_022558202.1\|4204957_4205212_-	lipoprotein	NA	NA	NA	NA
WP_003482768.1\|4205268_4205667_-	YbaN family protein	NA	NA	NA	NA
WP_042805972.1\|4205906_4208042_-	oligopeptidase B	F2Y2Z7	Organic_Lake_phycodnavirus	1.8e-28	25.1
WP_007973682.1\|4208151_4209336_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_007973684.1\|4209726_4211820_-	S9 family peptidase	NA	NA	NA	NA
WP_007965016.1\|4211887_4212199_-	hypothetical protein	NA	NA	NA	NA
WP_003482775.1\|4212577_4213147_+	lipocalin family protein	NA	NA	NA	NA
WP_005916857.1\|4213256_4214222_-	YafY family transcriptional regulator	NA	NA	NA	NA
WP_005916853.1\|4214770_4215571_+	DUF481 domain-containing protein	NA	NA	NA	NA
WP_007973688.1\|4216125_4217040_-	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_007965008.1\|4217070_4217808_-	response regulator transcription factor	NA	NA	NA	NA
WP_007965004.1\|4217838_4218891_-	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	1.1e-18	33.5
WP_007973690.1\|4218895_4219564_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_007973691.1\|4219724_4221662_-	glucans biosynthesis glucosyltransferase MdoH	NA	NA	NA	NA
WP_007973693.1\|4222729_4224379_-	M28 family peptidase	NA	NA	NA	NA
WP_042675723.1\|4224554_4225535_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.4e-17	39.2
WP_007973696.1\|4225939_4227427_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	1.7e-126	57.1
WP_042675720.1\|4229076_4231263_+	cache domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	3.4e-11	65.7
WP_007975511.1\|4232033_4233014_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.3e-98	61.0
WP_088370744.1\|4233212_4234299_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_042805164.1\|4234382_4237124_-	PAS domain S-box protein	G3MA91	Bacillus_virus	3.6e-10	29.2
WP_007969725.1\|4237227_4240107_+	insulinase family protein	NA	NA	NA	NA
WP_003489747.1\|4240667_4241597_+	GAF domain-containing protein	NA	NA	NA	NA
WP_007975178.1\|4241734_4242679_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_173362017.1\|4243141_4244047_-	hypothetical protein	NA	NA	NA	NA
WP_007969091.1\|4245235_4246198_+\|transposase	IS1595 family transposase	NA	NA	NA	NA

DBSCAN-SWA_23

4276482 : 4346335

Leptospira_phage(27.27%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007969091.1\|4276482_4277445_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007972968.1\|4277540_4278977_-	UdgX family uracil-DNA binding protein	NA	NA	NA	NA
WP_003489593.1\|4279267_4280512_-	putative DNA modification/repair radical SAM protein	NA	NA	NA	NA
WP_007972967.1\|4280719_4281538_-	dioxygenase	NA	NA	NA	NA
WP_007965152.1\|4281567_4281978_-	DoxX family protein	NA	NA	NA	NA
WP_007965151.1\|4282084_4282981_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_007972966.1\|4283277_4283847_+	flavodoxin family protein	NA	NA	NA	NA
WP_007972965.1\|4283987_4284983_+	aldo/keto reductase	NA	NA	NA	NA
WP_007972964.1\|4285354_4286050_+	glycosyltransferase	NA	NA	NA	NA
WP_042805825.1\|4286198_4288268_+	M13 family metallopeptidase	A0A1V0SHG2	Klosneuvirus	1.3e-65	25.7
WP_007972962.1\|4288468_4289395_-	DUF2236 domain-containing protein	NA	NA	NA	NA
WP_080720651.1\|4289859_4290549_+	hypothetical protein	NA	NA	NA	NA
WP_007972960.1\|4290718_4292314_-	APC family permease	NA	NA	NA	NA
WP_007972959.1\|4292622_4292994_-	hypothetical protein	NA	NA	NA	NA
WP_007965134.1\|4293171_4293948_-	response regulator transcription factor	NA	NA	NA	NA
WP_042805824.1\|4293944_4295258_-	histidine kinase	Q9EYF3	Enterobacteria_phage	4.4e-22	32.5
WP_007972955.1\|4295565_4296780_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_022560070.1\|4297095_4297290_-	hypothetical protein	NA	NA	NA	NA
WP_007972952.1\|4297772_4298279_+	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_042805823.1\|4298417_4299317_+	manganese catalase family protein	NA	NA	NA	NA
WP_007972948.1\|4299399_4299738_+	hypothetical protein	NA	NA	NA	NA
WP_007965129.1\|4299876_4300449_-	hypothetical protein	NA	NA	NA	NA
WP_007972946.1\|4300900_4304443_-	PAS domain-containing protein	NA	NA	NA	NA
WP_007972943.1\|4304652_4305033_+	response regulator	NA	NA	NA	NA
WP_042805821.1\|4305026_4305269_-	hypothetical protein	NA	NA	NA	NA
WP_033481013.1\|4305265_4306549_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_042805820.1\|4307083_4307365_+	hypothetical protein	NA	NA	NA	NA
WP_007962146.1\|4307547_4308528_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_007969744.1\|4308815_4310225_+	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_007969742.1\|4310215_4311238_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_172955872.1\|4311342_4311552_-	hypothetical protein	NA	NA	NA	NA
WP_042805174.1\|4311699_4312341_-	hypothetical protein	NA	NA	NA	NA
WP_007969739.1\|4312569_4313436_+	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	1.7e-59	47.1
WP_007969738.1\|4313870_4315040_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	2.2e-73	43.4
WP_088370744.1\|4315590_4316677_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007971579.1\|4318616_4319768_+	beta-glucosidase	NA	NA	NA	NA
WP_042805510.1\|4319764_4321540_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.7e-40	26.7
WP_003490054.1\|4321728_4321911_-	DUF3606 domain-containing protein	NA	NA	NA	NA
WP_007971575.1\|4322012_4322627_-	DUF4142 domain-containing protein	NA	NA	NA	NA
WP_007971572.1\|4322893_4324057_+	glutathione-dependent formaldehyde dehydrogenase	E3SJ82	Synechococcus_phage	4.1e-11	29.3
WP_042805509.1\|4324139_4324322_-	hypothetical protein	NA	NA	NA	NA
WP_082336445.1\|4324722_4325037_+	YkgJ family cysteine cluster protein	NA	NA	NA	NA
WP_172955932.1\|4325070_4325268_+	hypothetical protein	NA	NA	NA	NA
WP_042805508.1\|4325706_4325919_-	hypothetical protein	NA	NA	NA	NA
WP_173362034.1\|4326246_4326996_+	DUF3348 domain-containing protein	NA	NA	NA	NA
WP_007971565.1\|4327006_4329664_+	DUF802 domain-containing protein	NA	NA	NA	NA
WP_007962999.1\|4329660_4330332_+	OmpA family protein	NA	NA	NA	NA
WP_007971562.1\|4330328_4330994_+	DUF2894 domain-containing protein	NA	NA	NA	NA
WP_007971560.1\|4331326_4333468_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_007971559.1\|4333553_4334822_-	DUF3526 domain-containing protein	NA	NA	NA	NA
WP_007971557.1\|4334821_4336258_-	DUF3526 domain-containing protein	NA	NA	NA	NA
WP_007971555.1\|4336268_4336991_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	8.4e-15	27.6
WP_007971554.1\|4337233_4339087_+	M14 family metallopeptidase	NA	NA	NA	NA
WP_042674847.1\|4339108_4340053_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_098477673.1\|4340600_4341702_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6
WP_088370744.1\|4341868_4342956_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_131438818.1\|4343695_4344844_-	hypothetical protein	NA	NA	NA	NA
WP_050780408.1\|4344840_4345302_-	DUF4365 domain-containing protein	NA	NA	NA	NA
WP_007975391.1\|4345351_4346335_-\|transposase	IS1595 family transposase	NA	NA	NA	NA

DBSCAN-SWA_24

4366602 : 4471469

115

Xanthomonas_virus(19.51%)

portal,tail,terminase,head,tRNA,capsid,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088370862.1\|4366602_4369437_+\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	5.1e-132	34.4
WP_007962146.1\|4370910_4371891_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_042805331.1\|4374270_4376244_+	transglycosylase SLT domain-containing protein	A0A0H3V0Q1	Geobacillus_virus	3.5e-15	36.7
WP_007970423.1\|4376551_4376935_-	hypothetical protein	NA	NA	NA	NA
WP_007970422.1\|4377757_4378240_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_007964195.1\|4378236_4378692_-	hypothetical protein	NA	NA	NA	NA
WP_005913472.1\|4378714_4379488_-	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
WP_007964196.1\|4379619_4380021_+	DUF4124 domain-containing protein	NA	NA	NA	NA
WP_042805328.1\|4380365_4382060_+\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_007970417.1\|4382203_4382665_+	H-NS histone family protein	NA	NA	NA	NA
WP_007962040.1\|4383814_4385074_-	threonine/serine exporter family protein	NA	NA	NA	NA
WP_007962042.1\|4385242_4386355_+	ABC transporter permease	NA	NA	NA	NA
WP_007969506.1\|4386440_4387277_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	4.5e-12	31.4
WP_003484185.1\|4387279_4388206_+	MCE family protein	NA	NA	NA	NA
WP_022559971.1\|4388202_4388847_+	membrane integrity-associated transporter subunit PqiC	NA	NA	NA	NA
WP_007971522.1\|4389309_4389906_-	alpha-ketoglutarate-dependent dioxygenase AlkB	A0A2K9L0M4	Tupanvirus	9.6e-25	34.3
WP_007971521.1\|4390021_4391671_+	electron transfer flavoprotein-ubiquinone oxidoreductase	NA	NA	NA	NA
WP_007962677.1\|4391701_4392334_-	CoA transferase subunit B	NA	NA	NA	NA
WP_007962676.1\|4392333_4393065_-	CoA transferase subunit A	NA	NA	NA	NA
WP_007971520.1\|4393199_4394546_+	phosphomannomutase/phosphoglucomutase	A0A127AWJ1	Bacillus_phage	7.5e-33	27.1
WP_007971519.1\|4394592_4395996_+	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	7.2e-47	29.8
WP_007971518.1\|4396270_4397437_-	nucleotide sugar dehydrogenase	M1HZB2	Paramecium_bursaria_Chlorella_virus	1.9e-117	58.4
WP_007962671.1\|4397777_4398677_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	4.1e-27	36.2
WP_007971517.1\|4398673_4399231_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	3.9e-44	48.3
WP_007971516.1\|4399227_4400115_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	1.5e-93	57.4
WP_007971515.1\|4400166_4401222_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	3.2e-79	45.0
WP_007962558.1\|4401427_4402174_+	electron transfer flavoprotein subunit beta/FixA family protein	NA	NA	NA	NA
WP_007971513.1\|4402173_4403118_+	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_007962553.1\|4403133_4404120_+	flippase-like domain-containing protein	NA	NA	NA	NA
WP_042674680.1\|4404222_4405611_+	UbiA family prenyltransferase	NA	NA	NA	NA
WP_007962550.1\|4405610_4406912_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_007971506.1\|4406914_4407643_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_007971505.1\|4407644_4408589_+	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_007971504.1\|4408611_4409907_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_007961930.1\|4409903_4410302_+	GtrA family protein	NA	NA	NA	NA
WP_088370744.1\|4411210_4412298_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_131438929.1\|4412563_4413103_-	hypothetical protein	NA	NA	NA	NA
WP_007975738.1\|4413089_4413638_-	hypothetical protein	NA	NA	NA	NA
WP_007969091.1\|4413704_4414667_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_131454201.1\|4414729_4415185_-	hypothetical protein	NA	NA	NA	NA
WP_088370864.1\|4415308_4415665_-	hypothetical protein	NA	NA	NA	NA
WP_088370865.1\|4415740_4416391_-	hypothetical protein	NA	NA	NA	NA
WP_007972139.1\|4416392_4417070_-	hypothetical protein	NA	NA	NA	NA
WP_007972140.1\|4417069_4417381_-	hypothetical protein	NA	NA	NA	NA
WP_042805609.1\|4417377_4421775_-	hypothetical protein	C4ML20	Xanthomonas_virus	0.0e+00	50.6
WP_007972142.1\|4421765_4422158_-	hypothetical protein	Q2NPH1	Xanthomonas_virus	2.4e-32	52.8
WP_007972143.1\|4422157_4422625_-	DUF1833 family protein	Q52PL0	Xanthomonas_phage	6.8e-34	45.8
WP_157883153.1\|4422621_4422981_-	hypothetical protein	A5H1M2	Xanthomonas_virus	3.1e-18	41.5
WP_007972144.1\|4422977_4425845_-\|tail	phage tail tape measure protein	A5H1M1	Xanthomonas_virus	4.7e-77	29.1
WP_050780443.1\|4425841_4426102_-	DUF1799 domain-containing protein	I6PD79	Cronobacter_phage	2.1e-08	39.7
WP_007972145.1\|4426149_4426452_-	hypothetical protein	NA	NA	NA	NA
WP_042805631.1\|4426448_4427093_-\|tail	phage tail protein	A0A0H5BBY3	Pseudomonas_phage	4.8e-62	58.4
WP_007972147.1\|4427207_4427708_-	HNH endonuclease	A5H1K2	Xanthomonas_virus	9.5e-26	42.1
WP_007972148.1\|4427717_4428071_-	DUF3168 domain-containing protein	C4ML11	Xanthomonas_virus	1.2e-11	35.3
WP_100084204.1\|4428067_4428529_-	HK97 gp10 family phage protein	I7GSL4	Xanthomonas_virus	5.9e-22	43.4
WP_042805612.1\|4428521_4428872_-\|head	phage head closure protein	Q7Y5K6	Xanthomonas_virus	2.3e-10	37.0
WP_007972155.1\|4428868_4429288_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_042805614.1\|4429291_4429801_-	hypothetical protein	NA	NA	NA	NA
WP_007972156.1\|4429860_4431105_-\|capsid	phage major capsid protein	C7BGH0	Burkholderia_phage	3.6e-82	42.9
WP_042805615.1\|4431172_4431910_-\|protease	Clp protease ClpP	C7BGG9	Burkholderia_phage	2.4e-49	52.8
WP_173362039.1\|4431875_4433198_-\|portal	phage portal protein	C7BGG8	Burkholderia_phage	1.3e-61	37.6
WP_042805617.1\|4433197_4434874_-\|terminase	terminase large subunit	A0A0U4B0C7	Pseudomonas_phage	8.5e-236	71.5
WP_042805618.1\|4434876_4435257_-	hypothetical protein	A0A0U4JIP6	Pseudomonas_phage	9.4e-34	57.1
WP_007972163.1\|4435354_4435783_-	HNH endonuclease	NA	NA	NA	NA
WP_162829049.1\|4435782_4435929_-	hypothetical protein	NA	NA	NA	NA
WP_042805619.1\|4435925_4436132_-	hypothetical protein	A0A1V0E8A3	Vibrio_phage	2.4e-07	45.9
WP_162045088.1\|4436128_4436293_-	hypothetical protein	NA	NA	NA	NA
WP_131438860.1\|4436295_4436589_-	hypothetical protein	NA	NA	NA	NA
WP_100084205.1\|4436606_4438016_-	SGNH/GDSL hydrolase family protein	Q52PM7	Xanthomonas_phage	4.7e-62	38.5
WP_162269065.1\|4437943_4438474_-	hypothetical protein	NA	NA	NA	NA
WP_042805621.1\|4438698_4438917_-	hypothetical protein	NA	NA	NA	NA
WP_007972169.1\|4438913_4439417_-	hypothetical protein	Q2NPA5	Xanthomonas_phage	2.1e-20	40.0
WP_007972171.1\|4439413_4440070_-	glycoside hydrolase family 19 protein	A0A1B0Z086	Pseudomonas_phage	4.9e-38	45.4
WP_042805622.1\|4440817_4441108_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	1.3e-19	50.5
WP_007972174.1\|4441140_4441446_+	putative addiction module antidote protein	NA	NA	NA	NA
WP_042805623.1\|4441528_4442047_-	hypothetical protein	NA	NA	NA	NA
WP_088370866.1\|4442043_4442451_-	hypothetical protein	NA	NA	NA	NA
WP_100084206.1\|4442440_4443790_-	AAA family ATPase	O80281	Escherichia_phage	1.5e-49	32.5
WP_042805625.1\|4443786_4444086_-	hypothetical protein	NA	NA	NA	NA
WP_042805626.1\|4444637_4444832_-	hypothetical protein	NA	NA	NA	NA
WP_042805627.1\|4444828_4445167_-	hypothetical protein	NA	NA	NA	NA
WP_007972180.1\|4445391_4445700_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_042805628.1\|4445781_4446459_+	helix-turn-helix transcriptional regulator	E5AGE6	Erwinia_phage	1.3e-17	29.5
WP_157883186.1\|4446461_4446605_+	hypothetical protein	NA	NA	NA	NA
WP_007969091.1\|4446690_4447653_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_131454203.1\|4447873_4448257_+	hypothetical protein	NA	NA	NA	NA
WP_088370868.1\|4448441_4448708_+	hypothetical protein	NA	NA	NA	NA
WP_088370744.1\|4448704_4449792_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007972876.1\|4449934_4450252_+	hypothetical protein	NA	NA	NA	NA
WP_042805804.1\|4450356_4450578_+	hypothetical protein	NA	NA	NA	NA
WP_007972878.1\|4450583_4451033_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_042805805.1\|4451322_4452009_+	phage antirepressor KilAC domain-containing protein	A0A1B0YZY9	Pseudomonas_phage	2.6e-26	38.7
WP_007972882.1\|4452005_4452455_+	hypothetical protein	NA	NA	NA	NA
WP_042805807.1\|4452451_4452634_+	hypothetical protein	NA	NA	NA	NA
WP_131438881.1\|4452626_4452884_+	hypothetical protein	NA	NA	NA	NA
WP_007972887.1\|4452894_4453269_+	hypothetical protein	NA	NA	NA	NA
WP_007972889.1\|4453265_4453952_+	hypothetical protein	NA	NA	NA	NA
WP_042805810.1\|4453941_4454298_+	hypothetical protein	NA	NA	NA	NA
WP_007972892.1\|4454284_4454677_+	hypothetical protein	NA	NA	NA	NA
WP_157883152.1\|4454666_4454843_+	hypothetical protein	NA	NA	NA	NA
WP_042805811.1\|4454823_4455066_+	AlpA family phage regulatory protein	A0A2H4J8C8	uncultured_Caudovirales_phage	1.2e-05	36.8
WP_007964253.1\|4455670_4455991_-	hypothetical protein	NA	NA	NA	NA
WP_007972894.1\|4456183_4458061_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.8e-37	35.5
WP_007972896.1\|4458169_4458610_-\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_007972901.1\|4458608_4459622_+	lauroyl acyltransferase	NA	NA	NA	NA
WP_007964247.1\|4459818_4460340_-	N-acetyltransferase	NA	NA	NA	NA
WP_007972904.1\|4460585_4461719_+	GTP cyclohydrolase II RibA	A0A2H4PQS2	Staphylococcus_phage	6.1e-28	40.9
WP_007972905.1\|4461857_4462334_+	PH domain-containing protein	NA	NA	NA	NA
WP_007964242.1\|4462330_4463836_+	PH domain-containing protein	NA	NA	NA	NA
WP_080720841.1\|4463939_4464998_-	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
WP_007972908.1\|4464998_4465823_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_007972910.1\|4466020_4467298_-	O-antigen ligase family protein	NA	NA	NA	NA
WP_007972912.1\|4467463_4469185_-	glycosyltransferase family 39 protein	NA	NA	NA	NA
WP_007964231.1\|4469235_4470546_-	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
WP_007972915.1\|4470545_4471469_-\|tRNA	methionyl-tRNA formyltransferase	NA	NA	NA	NA

DBSCAN-SWA_25

4697683 : 4715997

Pseudomonas_phage(56.25%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007974155.1\|4697683_4698604_-	hypothetical protein	Q6QID9	Burkholderia_phage	8.1e-23	32.8
WP_042806087.1\|4698618_4698924_-	hypothetical protein	NA	NA	NA	NA
WP_042806086.1\|4699075_4699309_-	hypothetical protein	NA	NA	NA	NA
WP_042806085.1\|4699305_4699515_-	hypothetical protein	NA	NA	NA	NA
WP_042806084.1\|4699642_4700077_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_042806082.1\|4700099_4700486_+	outer membrane protein assembly factor BamE	NA	NA	NA	NA
WP_042806080.1\|4700486_4700711_-	hypothetical protein	A0A1L2CVJ2	Pectobacterium_phage	2.9e-14	52.7
WP_042806114.1\|4700900_4701626_+	hypothetical protein	J9Q7Y7	Salmonella_phage	2.7e-37	49.2
WP_157883171.1\|4701622_4702042_+	hypothetical protein	NA	NA	NA	NA
WP_131469762.1\|4702079_4702325_+	hypothetical protein	NA	NA	NA	NA
WP_007974147.1\|4702321_4702633_+	hypothetical protein	Q5ZQY8	Pseudomonas_phage	8.3e-12	38.9
WP_042806113.1\|4702640_4702937_+	hypothetical protein	A0A0S4L0A3	Pseudomonas_phage	1.8e-32	63.3
WP_042806074.1\|4702941_4703493_+	DUF3486 family protein	Q6QIC2	Burkholderia_phage	4.0e-33	47.8
WP_007974143.1\|4703496_4705218_+	hypothetical protein	A0A219VH72	Ochrobactrum_phage	7.7e-99	41.9
WP_007974141.1\|4705214_4706744_+	DUF935 family protein	A0A0S4L5M4	Pseudomonas_phage	6.0e-164	58.3
WP_007974140.1\|4706747_4708022_+	hypothetical protein	J9STS2	Pseudomonas_phage	3.7e-82	60.9
WP_042806071.1\|4708021_4708597_+	phage virion morphogenesis protein	Q5ZQY1	Pseudomonas_phage	1.7e-31	47.9
WP_042806069.1\|4708812_4709961_+	hypothetical protein	A0A0S4L0J5	Pseudomonas_phage	2.7e-76	47.7
WP_042806067.1\|4709989_4710337_+	DUF2190 family protein	NA	NA	NA	NA
WP_007974137.1\|4710406_4711354_+	hypothetical protein	R9U4B8	Rhizobium_phage	6.6e-60	41.3
WP_088409559.1\|4711508_4711790_+	hypothetical protein	NA	NA	NA	NA
WP_007974136.1\|4711861_4712392_+	DUF1320 domain-containing protein	Q5ZQX5	Pseudomonas_phage	4.2e-32	41.9
WP_007974135.1\|4712388_4712859_+	hypothetical protein	A0A0S4L2X9	Pseudomonas_phage	3.5e-30	46.6
WP_042806063.1\|4712855_4713107_+	hypothetical protein	NA	NA	NA	NA
WP_007974134.1\|4713108_4713864_+	hypothetical protein	NA	NA	NA	NA
WP_007974133.1\|4713863_4714376_+	hypothetical protein	A0A0S4L2X3	Pseudomonas_phage	4.0e-19	39.4
WP_162829052.1\|4714417_4714558_+	hypothetical protein	NA	NA	NA	NA
WP_088370872.1\|4714561_4714846_+	hypothetical protein	NA	NA	NA	NA
WP_088370873.1\|4714910_4715997_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.2e-42	36.4

DBSCAN-SWA_26

4820287 : 4878385

uncultured_virus(25.0%)

transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007969091.1\|4820287_4821250_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007969091.1\|4821812_4822775_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007970822.1\|4822979_4825784_-	DNA polymerase I	A0A218MKQ4	uncultured_virus	7.4e-67	30.1
WP_003487371.1\|4825860_4826151_+	DUF2782 domain-containing protein	NA	NA	NA	NA
WP_007970826.1\|4826461_4827505_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_042805413.1\|4827554_4834694_-	filamentous hemagglutinin N-terminal domain-containing protein	NA	NA	NA	NA
WP_042676013.1\|4834705_4836382_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_007970830.1\|4836378_4836840_-	hypothetical protein	NA	NA	NA	NA
WP_007970832.1\|4836836_4840532_-	protein kinase	Q0N495	Clanis_bilineata_nucleopolyhedrovirus	9.3e-09	29.9
WP_042805414.1\|4840536_4841253_-	serine/threonine-protein phosphatase	NA	NA	NA	NA
WP_033485573.1\|4841249_4841825_-	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_007972979.1\|4841821_4845352_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_042805829.1\|4845348_4846629_-	type VI secretion system protein TssL	NA	NA	NA	NA
WP_007967095.1\|4846610_4847945_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_007967097.1\|4848447_4849338_-	aldo/keto reductase family oxidoreductase	NA	NA	NA	NA
WP_082332431.1\|4849588_4850470_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_007967101.1\|4850528_4851854_-	type VI secretion system-associated FHA domain protein TagH	NA	NA	NA	NA
WP_007967103.1\|4852137_4852686_-	hypothetical protein	NA	NA	NA	NA
WP_007972985.1\|4852682_4854650_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	2.3e-38	28.5
WP_007972987.1\|4854799_4856131_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_007972988.1\|4856360_4856675_-	PAAR domain-containing protein	NA	NA	NA	NA
WP_007967112.1\|4859052_4859592_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_022560311.1\|4859941_4860469_+	RNA polymerase sigma factor	NA	NA	NA	NA
WP_007972993.1\|4860465_4861536_+	FecR domain-containing protein	NA	NA	NA	NA
WP_042805830.1\|4862001_4864887_+	TonB-dependent receptor	NA	NA	NA	NA
WP_007972997.1\|4864990_4866292_+	histidine-type phosphatase	NA	NA	NA	NA
WP_007967121.1\|4866362_4867667_+	hypothetical protein	NA	NA	NA	NA
WP_007973001.1\|4868284_4869028_-	hypothetical protein	NA	NA	NA	NA
WP_007973002.1\|4869432_4871460_-	hypothetical protein	NA	NA	NA	NA
WP_042805832.1\|4871772_4872036_+	hypothetical protein	NA	NA	NA	NA
WP_007969091.1\|4872247_4873210_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007969091.1\|4873522_4874485_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_088370877.1\|4874544_4877289_-	type VI secretion system ATPase TssH	H6X3M6	Enterobacteria_phage	8.8e-81	29.2
WP_042805202.1\|4877344_4878385_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA

DBSCAN-SWA_27

5066472 : 5116961

Ralstonia_phage(12.5%)

tail,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007962146.1\|5066472_5067453_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_005917020.1\|5067692_5068322_+	thymidine kinase	A0A023W530	Serratia_phage	3.3e-52	55.0
WP_007965298.1\|5068706_5069951_+	GAF domain-containing sensor histidine kinase	NA	NA	NA	NA
WP_007965295.1\|5070109_5071711_-	glucan biosynthesis protein D	NA	NA	NA	NA
WP_088370746.1\|5071849_5072937_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007965291.1\|5074620_5075436_-	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	A0A127AWE5	Bacillus_phage	5.4e-18	27.0
WP_007972253.1\|5081704_5082886_+	benzoate/H(+) symporter BenE family transporter	NA	NA	NA	NA
WP_042805659.1\|5082967_5084872_-	GAF domain-containing protein	B5LWN8	Feldmannia_species_virus	3.3e-18	28.2
WP_007964950.1\|5084868_5085462_-	biliverdin-producing heme oxygenase	NA	NA	NA	NA
WP_088370880.1\|5087279_5089442_-	lytic murein transglycosylase	NA	NA	NA	NA
WP_033481624.1\|5089626_5089833_-	hypothetical protein	NA	NA	NA	NA
WP_082336471.1\|5090025_5090412_-	YchJ family protein	NA	NA	NA	NA
WP_082336472.1\|5090448_5091327_+	TSUP family transporter	NA	NA	NA	NA
WP_007972260.1\|5091362_5095385_-	ATP-binding protein	NA	NA	NA	NA
WP_022560433.1\|5096158_5096860_-	DUF4194 domain-containing protein	NA	NA	NA	NA
WP_007964964.1\|5096846_5098316_-	DUF3375 domain-containing protein	NA	NA	NA	NA
WP_003489347.1\|5098335_5098938_-	GTP cyclohydrolase I FolE	E7DN69	Pneumococcus_phage	3.1e-47	49.0
WP_007964968.1\|5099068_5099521_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_082332286.1\|5099609_5099828_+	DUF1656 domain-containing protein	NA	NA	NA	NA
WP_022560435.1\|5099824_5100757_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_007964972.1\|5100753_5102214_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_042805665.1\|5102210_5104532_+	FUSC family protein	NA	NA	NA	NA
WP_007964975.1\|5104770_5106132_-	MFS transporter	Q6JIH2	Burkholderia_virus	1.9e-31	27.1
WP_007964977.1\|5106884_5107787_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_007964979.1\|5107887_5108721_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_007964982.1\|5109550_5110816_+	cardiolipin synthase B	NA	NA	NA	NA
WP_007972266.1\|5110839_5111367_-	hypothetical protein	NA	NA	NA	NA
WP_022560440.1\|5111637_5111844_+	hypothetical protein	NA	NA	NA	NA
WP_057663950.1\|5111830_5112937_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_040964294.1\|5113142_5113631_-	hypothetical protein	NA	NA	NA	NA
WP_007969091.1\|5113949_5114912_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007968268.1\|5115216_5115753_-\|tail	phage tail protein	NA	NA	NA	NA
WP_007968270.1\|5115813_5116341_-\|tail	phage tail protein	A0A0U4JYA4	Arthrobacter_phage	1.0e-09	28.0
WP_007969699.1\|5116409_5116961_-\|tail	phage tail protein	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP011160

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection