CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP011164	Xanthomonas citri pv. aurantifolii strain FDC 1609 plasmid pXfc37, complete sequence	0 crisprs	NA	0	0
NZ_CP011163	Xanthomonas citri pv. aurantifolii strain FDC 1609 chromosome, complete genome	2 crisprs	cas3,WYL,DinG,csa3,DEDDh	11	27
NZ_CP011166	Xanthomonas citri pv. aurantifolii strain FDC 1609 plasmid pXfc46, complete sequence	0 crisprs	NA	0	0
NZ_CP011165	Xanthomonas citri pv. aurantifolii strain FDC 1609 plasmid pXfc32, complete sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP011163_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011163_1

29121-29418

Orphan

Consensus_repeat	Method
CNTNGANACGGTCAACGGC	CRT
GTGGAAACGGTCAACGGCAGCATC	CRISPRCasFinder
GTGGAAACGGTCAACGGCAGCATC	PILER-CR

5 spacers

WYL

The CRISPR arrays of NZ_CP011163_1

>merge|NZ_CP011163|1|29121-29418|CRT,CRISPRCasFinder,PILER-CR
CGTCAGCAAGGTCAACGGCAAGATCAGCGCAGATGCCGGCAAGACCTATGGCGCCCTGGAAACGGTCAACGGCTCCATCGAGATCGGTGCCGGTGCGCAAACCAAGAACGTGGAAACCGTCAACGGCGGCATCCGCATCGGCGACAACGCGCGTACCGGGGGCGTGGAAACGGTCAACGGCAGCATCCTCGCCGAGCGCGGCAGCCAGATCAGTGGCGGGGTGGAAACGGTCAACGGCAGCATCGGGCTGGTGGGAACCGAGCTCGGCAAGGGCATCGAGACGGTCAATGGCGACATC

>NZ_CP011163|1|1|29121-29412|CRT
CGTCAGCAAGGTCAACGGC	AAGATCAGCGCAGATGCCGGCAAGACCTATGGCGC
CCTGGAAACGGTCAACGGC	TCCATCGAGATCGGTGCCGGTGCGCAAACCAAGAA
CGTGGAAACCGTCAACGGC	GGCATCCGCATCGGCGACAACGCGCGTACCGGGGG
CGTGGAAACGGTCAACGGC	AGCATCCTCGCCGAGCGCGGCAGCCAGATCAGTGGCGG
GGTGGAAACGGTCAACGGC	AGCATCGGGCTGGTGGGAACCGAGCTCGGCAAGGG
CATCGAGACGGTCAATGGC

>NZ_CP011163|1|1|29122-29418|CRISPRCasFinder
GTCAGCAAGGTCAACGGCAAGATC	AGCGCAGATGCCGGCAAGACCTATGGCGCC
CTGGAAACGGTCAACGGCTCCATC	GAGATCGGTGCCGGTGCGCAAACCAAGAAC
GTGGAAACCGTCAACGGCGGCATC	CGCATCGGCGACAACGCGCGTACCGGGGGC
GTGGAAACGGTCAACGGCAGCATC	CTCGCCGAGCGCGGCAGCCAGATCAGTGGCGGG
GTGGAAACGGTCAACGGCAGCATC	GGGCTGGTGGGAACCGAGCTCGGCAAGGGC
ATCGAGACGGTCAATGGCGACATC

>NZ_CP011163|1|1|29177-29364|PILER-CR
TGGAAACGGTCAACGGCTCCATCG	AGATCGGTGCCGGTGCGCAAACCAAGAACG
TGGAAACCGTCAACGGCGGCATCC	GCATCGGCGACAACGCGCGTACCGGGGGCG
TGGAAACGGTCAACGGCAGCATCC	TCGCCGAGCGCGGCAGCCAGATCAGTGGCGGGG
TGGAAACGGTCAACGGCAGCATC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011163.1\|WP_173668619.1\|37610_37976_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011163.1\|WP_022557799.1\|44334_44715_-\|proteinase-inhibitor	unknown	unknown	gnl\|CDD\|288556
NZ_CP011163.1\|WP_007964895.1\|37982_39464_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|273553
NZ_CP011163.1\|WP_088409191.1\|18648_19374_+\|YafY-family-transcriptional-regulator	WYL	COG2378_WYL_CAS-I:CAS-III	gnl\|CDD\|225253
NZ_CP011163.1\|WP_042805567.1\|19422_19788_+\|DUF1330-domain-containing-protein	unknown	unknown	unknown
NZ_CP011163.1\|WP_088409192.1\|39660_44133_-\|glutamate-synthase-large-subunit	unknown	unknown	gnl\|CDD\|236968
NZ_CP011163.1\|WP_007971900.1\|21224_21926_-\|2OG-Fe(II)-oxygenase	unknown	unknown	gnl\|CDD\|379309
NZ_CP011163.1\|WP_088370743.1\|29814_31611_+\|M28-family-peptidase	unknown	unknown	gnl\|CDD\|349910
NZ_CP011163.1\|WP_007969091.1\|33507_34470_-\|IS1595-family-transposase	unknown	unknown	gnl\|CDD\|372298
NZ_CP011163.1\|WP_098477673.1\|34658_35761_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP011163.1\|WP_088370744.1\|32015_33103_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP011163.1\|WP_003482177.1\|23755_24448_+\|rhomboid-family-intramembrane-serine-protease	unknown	unknown	gnl\|CDD\|366759
NZ_CP011163.1\|WP_042805569.1\|24556_24877_+\|DUF1820-family-protein	unknown	unknown	gnl\|CDD\|370154
NZ_CP011163.1\|WP_007971897.1\|19911_21039_-\|PA0069-family-radical-SAM-protein	unknown	unknown	gnl\|CDD\|275263
NZ_CP011163.1\|WP_007973056.1\|44771_46049_+\|DNA-topoisomerase-IB	unknown	unknown	gnl\|CDD\|226099
NZ_CP011163.1\|WP_007971907.1\|26030_27557_-\|S41-family-peptidase	unknown	unknown	gnl\|CDD\|223864
NZ_CP011163.1\|WP_007971891.1\|16887_18348_-\|cardiolipin-synthase	unknown	unknown	gnl\|CDD\|234967
NZ_CP011163.1\|WP_007968187.1\|22190_23531_-\|outer-membrane-protein-transport-protein	unknown	unknown	gnl\|CDD\|367457
NZ_CP011163.1\|WP_003482129.1\|46265_46610_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011163.1\|WP_022557789.1\|27659_28958_-\|peptidoglycan-DD-metalloendopeptidase-family-protein	unknown	unknown	gnl\|CDD\|227278

Protein	Function_ID	Function_description	E-value
NZ_CP011163.1\|WP_022557799.1\|44334_44715_-\|proteinase-inhibitor	gnl\|CDD\|288556	pfam11720, Inhibitor_I78, Peptidase inhibitor I78 family. This family includes Aspergillus elastase inhibitor and belongs to MEROPS peptidase inhibitor family I78.	1.35722e-19
NZ_CP011163.1\|WP_007964895.1\|37982_39464_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|273553	TIGR01318, glutamate_synthase_small_subunit_gltD, glutamate synthase small subunit family protein, proteobacterial. This model represents one of three built for the NADPH-dependent or NADH-dependent glutamate synthase (EC 1.4.1.13 and 1.4.1.14, respectively) small subunit and homologs. TIGR01317 describes the small subunit (or equivalent region from longer forms) in eukaryotes, Gram-positive bacteria, and some other lineages, both NADH and NADPH-dependent. TIGR01316 describes a protein of similar length, from Archaea and a number of bacterial lineages, that forms glutamate synthase homotetramers without a large subunit. This model describes both glutatate synthase small subunit and closely related paralogs of unknown function from a number of gamma and alpha subdivision Proteobacteria, including E. coli.	0
NZ_CP011163.1\|WP_088409191.1\|18648_19374_+\|YafY-family-transcriptional-regulator	gnl\|CDD\|225253	COG2378, COG2378, Predicted transcriptional regulator [Transcription].	1.15999e-54
NZ_CP011163.1\|WP_088409192.1\|39660_44133_-\|glutamate-synthase-large-subunit	gnl\|CDD\|236968	PRK11750, gltB, glutamate synthase subunit alpha; Provisional.	0
NZ_CP011163.1\|WP_007971900.1\|21224_21926_-\|2OG-Fe(II)-oxygenase	gnl\|CDD\|379309	pfam13640, 2OG-FeII_Oxy_3, 2OG-Fe(II) oxygenase superfamily. This family contains members of the 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily.	1.10927e-07
NZ_CP011163.1\|WP_088370743.1\|29814_31611_+\|M28-family-peptidase	gnl\|CDD\|349910	cd05660, M28_like_PA, M28 Zn-peptidase containing a protease-associated (PA) domain insert. Peptidase family M28 (also called aminopeptidase Y family), uncharacterized subfamily. The M28 family contains aminopeptidases as well as carboxypeptidases. They have co-catalytic zinc ions; each zinc ion is tetrahedrally co-ordinated, with three amino acid ligands plus activated water; one aspartate residue binds both metal ions. This subfamily is composed of uncharacterized proteins containing a protease-associated (PA) domain insert which may participate in substrate binding and/or promote conformational changes, influencing the stability and accessibility of the site to substrate.	1.09455e-120
NZ_CP011163.1\|WP_007969091.1\|33507_34470_-\|IS1595-family-transposase	gnl\|CDD\|372298	pfam12762, DDE_Tnp_IS1595, ISXO2-like transposase domain. This domain probably functions as an integrase that is found in a wide variety of transposases, including ISXO2.	2.59371e-37
NZ_CP011163.1\|WP_098477673.1\|34658_35761_-\|IS3-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.33904e-31
NZ_CP011163.1\|WP_088370744.1\|32015_33103_-\|IS3-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	1.67693e-30
NZ_CP011163.1\|WP_003482177.1\|23755_24448_+\|rhomboid-family-intramembrane-serine-protease	gnl\|CDD\|366759	pfam01694, Rhomboid, Rhomboid family. This family contains integral membrane proteins that are related to Drosophila rhomboid protein. Members of this family are found in bacteria and eukaryotes. Rhomboid promotes the cleavage of the membrane-anchored TGF-alpha-like growth factor Spitz, allowing it to activate the Drosophila EGF receptor. Analysis has shown that Rhomboid-1 is an intramembrane serine protease (EC:3.4.21.105). Parasite-encoded rhomboid enzymes are also important for invasion of host cells by Toxoplasma and the malaria parasite.	1.19314e-25
NZ_CP011163.1\|WP_042805569.1\|24556_24877_+\|DUF1820-family-protein	gnl\|CDD\|370154	pfam08850, DUF1820, Domain of unknown function (DUF1820). This family includes small functionally uncharacterized proteins around 100 amino acids in length.	3.19071e-52
NZ_CP011163.1\|WP_007971897.1\|19911_21039_-\|PA0069-family-radical-SAM-protein	gnl\|CDD\|275263	TIGR04470, hypothetical_protein_ALIPUT_00462, radical SAM mobile pair protein B. Members of this family are the downstream member (B) of a pair of tandem-encoded radical SAM enzymes. Most of these radical SAM gene pairs have an additional upstream regulatory gene in the MarR family. Examples of high sequence identity (over 96 percent) from cassettes in several Treponema species of the oral cavity to those in multiple Firmicutes in the gut microbiome suggest recent lateral gene transfer, as might be expected for antibiotic resistance genes. The function is unknown.	8.08014e-22
NZ_CP011163.1\|WP_007973056.1\|44771_46049_+\|DNA-topoisomerase-IB	gnl\|CDD\|226099	COG3569, COG3569, Topoisomerase IB [DNA replication, recombination, and repair].	1.38767e-108
NZ_CP011163.1\|WP_007971907.1\|26030_27557_-\|S41-family-peptidase	gnl\|CDD\|223864	COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane].	1.421e-127
NZ_CP011163.1\|WP_007971891.1\|16887_18348_-\|cardiolipin-synthase	gnl\|CDD\|234967	PRK01642, cls, cardiolipin synthetase; Reviewed.	2.63771e-151
NZ_CP011163.1\|WP_007968187.1\|22190_23531_-\|outer-membrane-protein-transport-protein	gnl\|CDD\|367457	pfam03349, Toluene_X, Outer membrane protein transport protein (OMPP1/FadL/TodX). This family includes TodX from Pseudomonas putida F1 and TbuX from Ralstonia pickettii PKO1. These are membrane proteins of uncertain function that are involved in toluene catabolism. Related proteins involved in the degradation of similar aromatic hydrocarbons are also in this family, such as CymD. This family also includes FadL involved in translocation of long-chain fatty acids across the outer membrane. It is also a receptor for the bacteriophage T2.	1.79229e-134
NZ_CP011163.1\|WP_022557789.1\|27659_28958_-\|peptidoglycan-DD-metalloendopeptidase-family-protein	gnl\|CDD\|227278	COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning].	4.5771e-92

>NZ_CP011163.1|WP_022557789.1|27659_28958_-|peptidoglycan-DD-metalloendopeptidase-family-protein
MPPSPAPLSRLPLAPATGRGRIWLAVGVLACTLLGSMGASAQSQRETERKLQQLRDELKTISADRRELEGKRGTAAQQLRQADEKVAKTARALSETEAAMRAQEQHLSSLQQERAQLQRGLQSQRTQLAALLRAADQVGRNAPLKVLLSQDTVGDATRMLADHRYVQNARAQRIHALTTQLDALATVEQDIATRRQALDAARAQQKAQAATLQKDRSQQAATVAQLDDRYKQRAEREKAIGQDAKALEQLLANLRAAAAKAEAERRAAARRAAAEAAAQAKRSKTERSDRPGKTPPKVIANAPAPKVGGLSWPVAGNLLARFNATLPDGHTSKGVLIGAPKGTTVTAVADGTVVFSDWMTGYGMILIVDHGNGYMSLYAHNDTLLRDAGASIKRGDAVAKVGSSGGQGVPALYFELRRNGQPVDPSSWLQRR
>NZ_CP011163.1|WP_007971907.1|26030_27557_-|S41-family-peptidase
MRVAVLSVALSLALFASPGWAQKAGPAAAQASADDPEANEAAVSKMPLDEIRRFVAVYNAVKQAYVDPVEDKKLMHAAVRGLLSDLDPHSTYFDKEDAEAFDEQATGAYDGIGVELLQQQQDNTLKVIAPIDDTPAARAGIRAGDVIVAIDGKPIDASKAMEPLRGESGSKVVLTIMRDKTPKPFDVTLQRETIRVASVRSKLLEPGYGYIRISTFQADTGADFQKNLKQLQAGGKLRGLVLDLRSNPGGLLTSAVQVADDLLDKGNIVSTRGRISISDAKFDATPGDLLNGAPVVVLVDAGSASASEVLAGALRDNKRARIIGSRTFGKGSVQTVLPLDNGDSVKLTTARYYTPSGKSIQASGIVPDVLLAPEPQPGDADAPASLTDYSEATLPGHLRGDDEGEEGYSAGDVLPGDGPITEALAELKQPGAAAKAQAARKAKAQAAQKAKAAKTGAEPKPAAARPATTDKPRSAEPAGKAKPATAPAAPAEPVQPTPPADKPAEPVN
>NZ_CP011163.1|WP_042805569.1|24556_24877_+|DUF1820-family-protein
MSKPLYKVTFLNHGKVYELYAREVTGSHLWGFNQIGELVFDVHDGLVVDPTEERLREEFGNTRTLHLPMQSIVRIEEVEKKGQSVIRDATTGGKVVTPFPSPIKPR
>NZ_CP011163.1|WP_003482177.1|23755_24448_+|rhomboid-family-intramembrane-serine-protease
MFVSLPSRKKPTPRWAVPLLFATVWLAYLWSISRPGEARNTLWLDWGALSSGVSNLGDWWATLRDGSVLRLFTALFLHADWSHLLGNLVFLLIFGLPAERILGPWRLLLLFLVGGAASNLAAIFAIGTPDRVIIGASGAVSALIGTYLALFPGAKLGVVLPLGVFLEFIRVPAPLLIGAWALLQVVFAYIGPAFGMVAWSAHIAGFVFGIVYGLYVRAAIARRLRKRHGF
>NZ_CP011163.1|WP_007968187.1|22190_23531_-|outer-membrane-protein-transport-protein
MSTASTLSRATLLAVGIAGVLAVGQAHGAAFQLKENSAKGLGRAFAGSGSAPDDASIIATNPAGMRQLDGRLFQADVSAISFSAKFQPDTAAYANGAPVSGGNGGDAGMIAPVPALYFHVPFGENDNMHLGTSLTVPFGFKTEYDRDWVGRYHGTKTELQAIDFNVAFSYDVNPYVSFGASVFAERLDIDLANAVDFGSVLAARRVPGFAPGSADGYSRIKGDSTEVGFTLGGLFSIDENTHIGFSYRSQVEHKITDGTADFTVPGSAAAVLSVAAPGTFVDTKGRATVKLPASATASFTHNVNEQWSIMADVTRTAWSKFDQVTVDFASNQPDSVLDFSYRDTTFASIGADYRLSDTVTLRGGLAYDQTPTTAEHRDVRVPDASRKWVSLGMSWRPSAQTEYNFGYTHLFTSDPTSDTRSATGDRLAGSYDVKGDVLAASINYKF
>NZ_CP011163.1|WP_007971900.1|21224_21926_-|2OG-Fe(II)-oxygenase
MSQPDFIQITDNAIAHEECVAIVQRMRQSQQLHPGRIGGGVFPDLKHSRDLRISGMAEWAEVENRLQQAVFEGVLTYLRQYPQALISPLMLQVTTADGTPHRLVAEDIVQMSDQALGDLARTCLRPGAINLQWYTADQGGYPYWHCELYPRDANADTLHRHLLWTLYLNDDFAQGETEFLFQQRKARPRTGSLLIAPTAFTHTHRGNRPVGGDKFIATSWILFQSAQALYGGE
>NZ_CP011163.1|WP_007971897.1|19911_21039_-|PA0069-family-radical-SAM-protein
MQKNSSPSASAAAERDVRSSRTVIKGRGTTAYVPGRFSVTTAVEIDDGWGALDADGETALRPKTVVAEEIARSIISRNNSPDIGFSQSVNPYRGCEHGCVYFFARPSHAYLDLSPGLDFETRIFAKPNAAALLRAEIARPSYQCSPIALGINTDAYQPAERRLHISRQCLEVLAQARHPVSFVTKAALIERDIDVLAEMAQHNLVSVYFSVTTLDNRLAAKMEPRAAAPHARLRAMQALHAAGVPVGVLVAPVIPMINDKELERILDAAAAHGARSAGYVLLRLPHELTQLWREWLELHYPDRAKHVMSLIQQMRGGKDYDSRFGKRMVGEGPFAELIAQRFSIAYRRLGFGRLPRLDTTQFRPPRPDTPQLDLF
>NZ_CP011163.1|WP_042805567.1|19422_19788_+|DUF1330-domain-containing-protein
MVAFSPNALSAFLDNQDTSAIVMLNLIRFQADGGRERYHRYLRLATPILARFDAHIVFSGDGLPVLTAGQAQAWDAVTLVQYPGRSAFKQMIADVEYQHAFEVGRSAIAEIVLQPFHGITL
>NZ_CP011163.1|WP_088409191.1|18648_19374_+|YafY-family-transcriptional-regulator
MSRTTRLFELLGLLRAHRRPVSAAALASELGVSQRSLYRDIDTLRALGAPLEGQAGVGYYLKPGFFLPSLAFSQEELDAVMLGLDWVKQRADPALARCGESALAKILSARKHGDGTGIDVAPPAILTAASTSEAVDHPQTAVLRDAIRRQCKLAIGYVDAQDTPSERIVWPIALVYFDDVRVLAAWCERRSAFRHFRVDRLQVRAVLKARYPQSRQALVKQWRQHDRDWSSLLTVSDTAQR
>NZ_CP011163.1|WP_007971891.1|16887_18348_-|cardiolipin-synthase
MLALAQGAWEWLATIPHLEALLLAAYVLYLLWIAGWIVLQKREPVATLSWVLSLAALPYLGLLIYYWLGPQKVKRQRLRRGRSRSGMESYSSVCPPDADCTELAKIAQSTTGLAPSSATEVHWLVDGAATYAAIIEAIRGARDHIHLEYYIFQPDQSGTAICAALMERARAGVKVRLLMDAIGSSAMTRRALRTLREAGVETAWFHPSQLLKPFKRPWLNLRTHRKVIVIDGRIGFTGGINVTDDENEQVRKQAYRDLHVRLQGHVVRSLQLVFLEDWLYATSQGRAAFHGQQLWPDDVPTRAQGTVDAQVLVSGPDSSWEAIHRLMVAAIHEAKHRVWLVTPYFVPGEAARMALTSAALGGLDVRLLVPRVSDSRLVTYAARSYFDELLEAGVRIYEYGPRMLHTKALLADDDVCIVGSANFDSRSFRLNFELSMLFRDQAVAAEMAGLIGTDLQQAQEVQFARHRPLWRSRLPEAFARLLSPLL
>NZ_CP011163.1|WP_088370743.1|29814_31611_+|M28-family-peptidase
MPRKILLCLAATLALAGCKREPADAPGAPAAQTPTESAPSAPVSRHTFSPDMTTGDFAELVKTLASDDFEGRGPGTPGEEKTVTYIRDQMQRIGLQPGNGDSWFQEVPMVETTADASTAPSLRSGEQTRTLAFGTDIVVGTRTGQAEVKLDNSELVFVGYGVDAPEQQWNDYAGQEWKGKTVVMFVNDPGFHTDDAKLFDGKRMTYYGRWTYKFEEAARKGAAAALIVHDTPGASYGWDVVKHSWSGPQYDLPAKDDPDPRLPVQGWISAETAKQLFADAGLDLAQAYKDASKRGFKPVPLKASWSVDLKSTIAQKTSRNVVGVLPGTSHADEAVLYMAHWDHLGKHPGESGDNIYNGAVDNATGVAGILEIADAFAHQDPKPARSVVFLAVTLEESGLLGSKYYVANPSFPLDKIAVVINLDAMSVAGRARDVTVVGMGSSELEDILKPLAAMQGRTLHAEATPQSGSYFRSDHFNFAKAGVPALYADGGEDLREGGTAAGRAAAEDYGRHRYHAPGDEYDAATWKLDGTIEDLQVVYGVGKEVAAGDRWPNWYPGNPFKAARDRMMAGRPGASAATAQPAEAASTAPQTNKAKSPH
>NZ_CP011163.1|WP_088370744.1|32015_33103_-|IS3-family-transposase
MKKSRFTDSQIIAVLKQAQAGAPVPELCREHGISSATFYKWRSKFGGMDVSMVARMKELEEENRRLKKMYAEAQLSTDLLKEALGKKMVRPSQRREMAQSAVTSGRTNIRHACQAFAVSETCFRYQAKASEQNARIADWLVRLTTAHRDWGFGLCYLYLRNVKGFGWNHKRVYRIYRELELNLRIKPKKRLVRERPEPLAVPEAINQVWSMDFMHDQLADGRSFRLFNVLDDFNREGLGIEVDLSLPSARVIRSLEQIIEWRGKPAVIRCDNGPEYISGALLSWAQRHGIRVEHIQPGKPQQNAYVERYNRTIRYAWLAQTLFDTIDQVQDKATRWLWTYNHERPNMALGGITPAMKLAMAA
>NZ_CP011163.1|WP_007969091.1|33507_34470_-|IS1595-family-transposase
MGINIVQFQPGLSLTEFVDRYGTEAKCYRALYRWRWPKGFRCPQCDGRARSRFRRDGQVYYQCRACRHQTTLRASTLLQSSKLPLRLWMQAIYLLTSSKTNLAALELKRHLGVTYKAAWRMKHKIMQAMTEREEPRKLKGFVQIDDAYLGGERNGGKRGRGSENKQPFVIAVQVDHNHEHPVFAVIEPVKAFDNASLKDWIARRLEPGCEVYSDGLACFRRLEEAGHAHTTLDTDGARAATEVQGARWLNVVLGNVKRAISGTYHAVRQAKYARRYLAEAAYRFNRRFRLEQMLPRLATALMRCTPCPESVLRMASNFHG
>NZ_CP011163.1|WP_098477673.1|34658_35761_-|IS3-family-transposase
MKKRFTEEQIIGFLREAEGGVAIKDLCRRHGFSEASYYLWRSKFGGMSVPDAKRLKDLEAENARLKKLLAEQLFENDLIKDALRKKLVSAPARRMLVREWIGRGASERRALAVIGMSASALRYCPRQDRNGELRERILALAHRHRRYGVGMIYLKLRQEGRLVNYKRVERLYREQQLQVRRRQRKKVPVGERQPLLRPAQANQVWSMDFVFDRSAEGRVIKCLVIVDDATHEAVAIEVERAISGHGVARVLDRLAHSRGLPQVIRTDNGKEFCGMAMVAWAHARGVQLRLIQPGKPNQNAYVESFNGRLRDECLNEHWFPTLLHARTEIERWRREYNEDRPKKAIGGMTPAAYAQHLANTDIINPGL
>NZ_CP011163.1|WP_173668619.1|37610_37976_-|hypothetical-protein
MPRHVTLNNYEQRIRWAIGLTMALAGASLIVTLILFIFYFAKLHYSKVFFVTGSATATILAVIAQDRYNRFKALLVPNTFSTQEFNAILGKYKKYQTLGSPILLVLVIMGVVIGALGSLSN
>NZ_CP011163.1|WP_007964895.1|37982_39464_-|FAD-dependent-oxidoreductase
MSRKQAFQFLDLPRTMPTRIPVELRTSGDWGELYGRFDKVDAQYQAGRCLDCGNPYCSWKCPVHNAIPQWLQLVQENRIEEAAALCHSTNPLPEVCGRVCPQDRLCEGSCTLEEFGAVTIGAVEKYIVDTAFKMGWRPDLGNVQPSGHRVAVIGAGPAGLACADRLARAGIEAVVYDRYEQIGGLLQFGIPSFKLDKSVIGKRREILEGMGVQFRLGVEIGKDISIEQLLAEYDAVFLGTGAYRYTDGGLPGQDLKNVLPALPFLVQNSRIVSGNDPHGRPIAGWEDQLALPDLTGKRVVVLGGGDTGMDCVRSAIRLGAAKVTCAYRRDEASMPGSAREVANAREEGVRFLFNRQPLSIESGADDEAIGVTVVETKLGEPDASGRRNAVPVEGSESLLEADVVIIAFGFSPTLPDWLASQGVEAGSNGRIVAPADGNGRLPYQTTNPRLFAGGDCVRGADLVVTAVAEGRDAAGSIVQMLGVKAQVKEPAAA
>NZ_CP011163.1|WP_088409192.1|39660_44133_-|glutamate-synthase-large-subunit
MAPRTRQGLNDDGLYNSMRDERDACGFGMVAQLDDQPSRALVDTAIAALSRMTHRGGVAADGLTGDGCGLLIRKPDAFLRGLARDAGIALGTRYAAGVVFLPLDEADAARCRAELEAQLHSAGVHLRGWRVVPTDDSVCGQLARDTLPRIEQVFVDAGAEQTEDGFTLALFLARRRAEQALHAVENFYVTTLSPNGISYKGMVLPDKLSTFYPDLQRSDLSSSAIVFHQRFSTNTLPRWPLAHPFRLLAHNGEINTIEGNRRWAQARSKVWQTPRFDIAQFDPVISMHGSDSQSLDNMLELLIAGGMDLLQALRILVPPATQSLEFKDADLAAFYEFYGLNTEPWDGPAGIVACDSRYAACMLDRNGLRPARWMLTSDRHFLVASEAGVWELPAERITRKGKLGPGEMMAIDLKRGDLLDSDAIDRINRARAPYKQWLQQGVTYLQTELIDPSLVEEPFSEQTLRSYHKLFQLSTEEVEQVLRPLAETEQEATGSMGDDTPMAVLSRQTRPLYDYFRQAFAQVTNPPIDPLREGIAMSLTTQLGKETNIFHAGAETVNHVILNSPVLSQRKLRQLLKMEQYVERNRLIDLSYSLEEGLKAGLERICQEVEAAARAGAVMLLLSDRYPVPDRPMAHALLATGAVHHHLCKVGLRCDVNLIIETGTARDPHHMACLLGVGATAVYPYLAYQTLFDLGRRGILQLSKGGEQSQIGRRYRKGIYKGLSKIISKMGICTIASYRGAQLFEIVGLDPDVVDLCFADTPARIGGVDLARLDTEARELTVRAWNDQLKPEVGGLLKYVHGGEYHMYNPDVVMTLQRATRTGDAGDWQKYVDAVHARPASTLRDLVQLKRADTPTPLDDVAPAEDVLRRFDSAAISLGALSPEAHEALAIAMNRLGGRSNSGEGGEDPARYGTEKRSKIKQVASGRFGVTPEYLVNAEVLQIKVAQGAKPGEGGQLPGHKVNELIARLRYAKPGIGLISPPPHHDIYSIEDLAQLIYDLKQVNPTALVSVKLVAHAGVGTIAAGVVKAGADLITVSGHDGGTGASPVSSIRYAGVTWELGVAESHQALVANDLRERTILQTDGGLKTGLDVVKAALLGADSFGFGTAPMIVLGCKYLRICHLNNCATGVATQDERLRAGYFTGLPERVEHFFRLLAEEVRQWLSYLGVRSLDEIVGRTDLLEQLDVSPRPGVKVDLSRLLTHAQYDGSHCAAQRLYESPDSLATQMDGLLADAIANKRGGDHRFLIHNTDRSIGARLSGAIARAHGNHGMSDAPLNLRFRGTAGQSFGAFNAGGLQLELEGEANDYVGKGMAGGRLVVRPPRGARFEARNTPIVGNTCLYGATGGELFAAGRAGERFAVRNSGALAVVEGAGDHCCEYMTDGVVLVLGKVGLNFGAGFTGGLAYVLDIERDFVDRYNHELIDIHRVSAEGFENHRQHLHTLISRHRELTGSIWAQQILDEFRDYIGKFWLVKPKAASIESLTESLRRAA
>NZ_CP011163.1|WP_022557799.1|44334_44715_-|proteinase-inhibitor
MRAVLPIARLACTLVVLTALTACNKPQPDEQEAVTANAQHAAEQAAAPAPDAAPEAPPIGSCDATQVQSLVGQPLTDAVGEQARSDAGAKSVRVLKPGQMTTMEFNGERLNLEVDAKNVISSVRCG
>NZ_CP011163.1|WP_007973056.1|44771_46049_+|DNA-topoisomerase-IB
MACAHGVVAALTQPSPAAPNNRGQSFDLCAMKAKRVLRNATVAASTVGKLAAVATGAAVATAAVASAAAVAQAKATARAAGLTYVNDQQPGISRRKAGKSFSYRDADGQRIADAETLQRIRSLAIPPAYTEVWICAKPNGHLQATGRDARRRKQYRYHADWAQVRGEGKFERVIAFGTALPKLRRRLRRDLLLSGFPREKVLAIVVALLADTLVRVGNAEYARSNRSYGLTTLRNRHMEFLKGGRARLKFRGKSGQDHDIEVDDKQLVKLIRQCQQLPGQSLFQYRDDDGQLQPVDSGEVNDYLREAMGEDFTAKDFRTWGGTLAALQRLARLPLPERSSERALKQVQNDVIREVADALGNTPSVCRKAYIDPCVFEGWRAGQLQAMATGVRGERQWEAATLKFLSASRSKLKTQAKSVARRKSA
>NZ_CP011163.1|WP_003482129.1|46265_46610_-|hypothetical-protein
MIRILAPLAAAALLSACASNQVAQIQPIDGAISGQCHSDKVRGAVGLAAAAQTIERARVDSDSQTVIVRRGERATGGTTASGLADPAQGASESGGDQLTIETGPNNSITAIYCG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP011163_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011163_2

244880-244980

Orphan

Consensus_repeat	Method
TCGGCCGAAGGGCGCACCTGCAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP011163_2

>merge|NZ_CP011163|2|244880-244980|CRISPRCasFinder
TCGGCCGAAGGACGCACCTGCACGGCGGCCAGGGTGCGGATGTCGCTGGTGCGTTCCAGGGTCTGCTGGGCGATCTGGTCGGCGGCCGGACGCACCTGGAC

>NZ_CP011163|2|2|244880-244980|CRISPRCasFinder
TCGGCCGAAGGACGCACCTGCAC	GGCGGCCAGGGTGCGGATGTCGCTGGTGCGTTCCAGGGTCTGCTGGGCGATCTGG
TCGGCGGCCGGACGCACCTGGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011163.1\|WP_088370899.1\|233872_234960_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP011163.1\|WP_007972042.1\|250060_251710_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|236443
NZ_CP011163.1\|WP_173668633.1\|236232_237942_+\|ubiquinone-dependent-pyruvate-dehydrogenase	unknown	unknown	gnl\|CDD\|181661
NZ_CP011163.1\|WP_007972039.1\|248301_249204_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|179147
NZ_CP011163.1\|WP_007972046.1\|255997_257008_+\|NAD-dependent-epimerase/dehydratase-family-protein	unknown	unknown	gnl\|CDD\|187552
NZ_CP011163.1\|WP_007972029.1\|237991_239434_+\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP011163.1\|WP_007972033.1\|242538_243768_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340883
NZ_CP011163.1\|WP_007974735.1\|232569_233595_+\|NAD(P)-dependent-glycerol-3-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|234629
NZ_CP011163.1\|WP_088409204.1\|239418_240783_+\|sigma-54-dependent-Fis-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225114
NZ_CP011163.1\|WP_007972041.1\|249356_249740_-\|YkgJ-family-cysteine-cluster-protein	unknown	unknown	gnl\|CDD\|223799
NZ_CP011163.1\|WP_007972044.1\|251718_253266_+\|winged-helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|294013
NZ_CP011163.1\|WP_007962146.1\|254403_255384_+\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|225581
NZ_CP011163.1\|WP_005912222.1\|245890_246907_+\|3-oxoacyl-ACP-synthase-III	unknown	unknown	gnl\|CDD\|181732
NZ_CP011163.1\|WP_088409205.1\|253465_254401_-\|serine-hydrolase	unknown	unknown	gnl\|CDD\|224594
NZ_CP011163.1\|WP_007966372.1\|245468_245789_+\|DUF4156-domain-containing-protein	unknown	unknown	gnl\|CDD\|372679
NZ_CP011163.1\|WP_088370753.1\|247018_248176_+\|Fic-family-protein	unknown	unknown	gnl\|CDD\|225718
NZ_CP011163.1\|WP_022557907.1\|240973_241726_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011163.1\|WP_007972032.1\|241828_242446_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011163.1\|WP_003488348.1\|244117_244594_-\|tRNA-(cytidine(34)-2'-O)-methyltransferase	unknown	unknown	gnl\|CDD\|349967
NZ_CP011163.1\|WP_007972027.1\|235262_235859_-\|Ax21-family-protein	unknown	unknown	gnl\|CDD\|275096

Protein	Function_ID	Function_description	E-value
NZ_CP011163.1\|WP_088370899.1\|233872_234960_-\|IS3-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	1.53673e-29
NZ_CP011163.1\|WP_007972042.1\|250060_251710_+\|AMP-binding-protein	gnl\|CDD\|236443	PRK09274, PRK09274, peptide synthase; Provisional.	0
NZ_CP011163.1\|WP_173668633.1\|236232_237942_+\|ubiquinone-dependent-pyruvate-dehydrogenase	gnl\|CDD\|181661	PRK09124, PRK09124, ubiquinone-dependent pyruvate dehydrogenase.	0
NZ_CP011163.1\|WP_007972039.1\|248301_249204_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|179147	PRK00870, PRK00870, haloalkane dehalogenase; Provisional.	3.47808e-47
NZ_CP011163.1\|WP_007972046.1\|255997_257008_+\|NAD-dependent-epimerase/dehydratase-family-protein	gnl\|CDD\|187552	cd05241, 3b-HSD-like_SDR_e, 3beta-hydroxysteroid dehydrogenases (3b-HSD)-like, extended (e) SDRs. Extended SDR family domains belonging to this subgroup have the characteristic active site tetrad and a fairly well-conserved NAD(P)-binding motif. 3b-HSD catalyzes the NAD-dependent conversion of various steroids, such as pregnenolone to progesterone, or androstenediol to testosterone. This subgroup includes an unusual bifunctional 3b-HSD/C-4 decarboxylase from Arabidopsis thaliana, and Saccharomyces cerevisiae ERG26, a 3b-HSD/C-4 decarboxylase, involved in the synthesis of ergosterol, the major sterol of yeast. It also includes human 3 beta-HSD/HSD3B1 and C(27) 3beta-HSD/ [3beta-hydroxy-delta(5)-C(27)-steroid oxidoreductase; HSD3B7]. C(27) 3beta-HSD/HSD3B7 is a membrane-bound enzyme of the endoplasmic reticulum, that catalyzes the isomerization and oxidation of 7alpha-hydroxylated sterol intermediates, an early step in bile acid biosynthesis. Mutations in the human NSDHL (NAD(P)H steroid dehydrogenase-like protein) cause CHILD syndrome (congenital hemidysplasia with ichthyosiform nevus and limb defects), an X-linked dominant, male-lethal trait. Mutations in the human gene encoding C(27) 3beta-HSD underlie a rare autosomal recessive form of neonatal cholestasis. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid sythase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	2.51368e-82
NZ_CP011163.1\|WP_007972029.1\|237991_239434_+\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	1.62309e-31
NZ_CP011163.1\|WP_007972033.1\|242538_243768_+\|MFS-transporter	gnl\|CDD\|340883	cd17325, MFS_MdtG_SLC18_like, bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters. This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	5.52073e-20
NZ_CP011163.1\|WP_007974735.1\|232569_233595_+\|NAD(P)-dependent-glycerol-3-phosphate-dehydrogenase	gnl\|CDD\|234629	PRK00094, gpsA, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase.	4.57783e-180
NZ_CP011163.1\|WP_088409204.1\|239418_240783_+\|sigma-54-dependent-Fis-family-transcriptional-regulator	gnl\|CDD\|225114	COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms].	6.2198e-174
NZ_CP011163.1\|WP_007972044.1\|251718_253266_+\|winged-helix-turn-helix-domain-containing-protein	gnl\|CDD\|294013	cd00383, trans_reg_C, DNA-binding effector domain of two-component system response regulators. Bacteria and some eukaryotes use two-component signal transduction systems to detect and respond to changes in the environment. The systems consists of a sensor histidine kinase and a response regulator. The former autophosphorylates a histidine residue on detecting an external stimulus. The phosphate is then transferred to an invariant aspartate residue in a highly conserved receiver domain of the response regulator. Phosphorylation activates a variable effector domain of the response regulator, which triggers the cellular response. This C-terminal effector domain belongs to the winged helix-turn-helix family of transcriptional regulators and contains DNA and RNA polymerase binding sites. Several dimers or monomers bind head to tail to small tandem repeats upstream of the genes. The RNA polymerase binding sites interact with the alpha or sigma subunit of RNA polymerase.	4.67473e-19
NZ_CP011163.1\|WP_007962146.1\|254403_255384_+\|IS5-family-transposase	gnl\|CDD\|225581	COG3039, COG3039, Transposase and inactivated derivatives, IS5 family [DNA replication, recombination, and repair].	5.13288e-33
NZ_CP011163.1\|WP_088409205.1\|253465_254401_-\|serine-hydrolase	gnl\|CDD\|224594	COG1680, AmpC, Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms].	1.6042e-32
NZ_CP011163.1\|WP_007966372.1\|245468_245789_+\|DUF4156-domain-containing-protein	gnl\|CDD\|372679	pfam13698, DUF4156, Domain of unknown function (DUF4156). The function of this family is unknown but members are annotated as putative lipoprotein outer membrane proteins.	1.76533e-09
NZ_CP011163.1\|WP_088370753.1\|247018_248176_+\|Fic-family-protein	gnl\|CDD\|225718	COG3177, COG3177, Fic family protein [Function unknown].	2.98125e-63
NZ_CP011163.1\|WP_007972041.1\|249356_249740_-\|YkgJ-family-cysteine-cluster-protein	gnl\|CDD\|223799	COG0727, COG0727, Predicted Fe-S-cluster oxidoreductase [General function prediction only].	2.27067e-20
NZ_CP011163.1\|WP_005912222.1\|245890_246907_+\|3-oxoacyl-ACP-synthase-III	gnl\|CDD\|181732	PRK09258, PRK09258, 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed.	0
NZ_CP011163.1\|WP_003488348.1\|244117_244594_-\|tRNA-(cytidine(34)-2'-O)-methyltransferase	gnl\|CDD\|349967	cd18094, SpoU-like_TrmL, SAM-dependent tRNA methylase related to TrmL. tRNA (Um34/Cm34) methyltransferase TrmL catalyzes the methyl transfer from S-adenosyl-L-methionine (AdoMet) to the 2'-OH at position 34 in both tRNA(Leu)(CmAA) and tRNA(Leu)(cmnm5UmAA). It is part of the SpoU family of MTases, a subfamily of the SPOUT methyltransferase superfamily. The SPOUT methyltransferase superfamily is a large class of S-adenosyl-L-methionine (AdoMet or SAM)-dependent RNA MTases which are structurally characterized by a deep trefoil knot.	2.47465e-81
NZ_CP011163.1\|WP_007972027.1\|235262_235859_-\|Ax21-family-protein	gnl\|CDD\|275096	TIGR04273, activator_of_XA21-mediated_immunity_Ax21, sulfation-dependent quorum factor, Ax21 family. This family consists of proteins closely related to Ax21 (Activator of XA21-mediated immunity), a protein that is secreted by a type I secretion system (RaxABC), and that appears to be sulfated on an N-terminal region tryosine in a motif LSYN. Ax21 acts in a quorum-sensing system. Homologous peptide-mediated quorum-sensing systems appear to exist in other species, such as the emerging opportunistic pathogen Stenotrophomonas maltophilia. Intriguingly, the rice genome encodes a receptor (XA21) for this protein that triggers innate immunity. [Cellular processes, Pathogenesis].	4.49673e-108

>NZ_CP011163.1|WP_003488348.1|244117_244594_-|tRNA-(cytidine(34)-2'-O)-methyltransferase
MSAPVLDVILFQPEIPPNTGNVIRLCANTGARLHLIEPLGFDLSDKQLKRAGLDYHEYAPLQVHADLPSALAAIAPKRVFALSTRSTVRYDTPQFADGDAFLFGPETRGLPAEVLESIPPQHRLRLPMRPDNRSLNLSNTVAVMVFEAWRQWNFAGGQ
>NZ_CP011163.1|WP_007972033.1|242538_243768_+|MFS-transporter
MPMTKARPRGTRALEALHFSVADVQDGLGPFLSVFLQSKGWSVAAIGTVMSVGGIAGMLATTPAGALVDATRRKRAVVVIGCLAILLATALIWLRPTSSGVVAAQIASALAAAGIGPALTGITLGLVHARGFDHQLARNQVANHAGNVLAAVLAGWLGWRYGFAAVFLLTAFFGALALMAVLAIPAAAIDHRAARGLASTNGGDALSGWRVLLTCRPLALLAVTLGLFHLGNAAMLPLYGMAIVAAHAGDPSALTATTIVVAQATMVVVALLAMRWIRVHGHWWVLLVAFMALPLRALVAASVIHGWGVFPVQILDGLGAGLQSVVVPALVARLLQGTGRVNVGQGAVMTVQGVGAALSPAFGGWLAHAFGYRIAFLSLGAIALLAVALWAGCRGMLQAGASVQAETML
>NZ_CP011163.1|WP_007972032.1|241828_242446_+|hypothetical-protein
MHWVDPDFLPATRGTLARFLLNPKADIDGLLLTDGTEVHTPPHLSEALLKALKPGSALTVRGLKPRDVEMLVALAIDPEGGKRILDEGPHGPHAKPKPKPPGKPSKPEVAQHSGTITRLLHGPHGQVHGVLLDDAVTVRFPPHAGGDFAKQLVVGKPLVAEGETKATPHGVLIHAHALGGKAATLKQIEHPPHGPAHKPKPKPKH
>NZ_CP011163.1|WP_022557907.1|240973_241726_+|hypothetical-protein
MMRQTVLAIALACTIGAAAAQVAAPPPPPAPNGPIGGPPAPPTPVAATPVSVSGTVERFLLNPNGDVDGLWLRDGTQVGFPPHLSSEVKAAVRAGDSVVVKGFRLGNLPVLQVSSIRSGRSGREVVDRPPTFGAAPPPPPTPGQLTPLQSDGTIHRLVYGPAGEVNGALVSDGTVVRMPPHLALQFADLLRVGAPLSASGLGVATPDGRAIEATQLGRDRSSLRALFTAPRPDGPLPPPPPGAPVPPAGR
>NZ_CP011163.1|WP_088409204.1|239418_240783_+|sigma-54-dependent-Fis-family-transcriptional-regulator
MARILIIDDDAAFRTTLQATLRSLGHTAVAAENGPDGLARLSEGGIDMAFVDFRMPGMDGIAVLRARLDDAQARQARQARQVPLVMLTAHVSSGNTIEAMTLGAFDHLVKPVGRADIVEVVERALLGRADAQAAATDALSASAEDDDALVGHSPAMRTVHKRIGLAAASDLPVLITGETGTGKELAARALHRASPRASAPFVAVNCAAIPLELMESELFGHRKGAFSGASSDRRGLIREADGGTLFLDEIGDMPLPMQAKLLRFLQEGEVTPLGGSGPQKVDVRVLAATHRDLAACVADGRFRSDLRYRLNVVPIELPPLRERGQDILLLAQHFLSVNAARAQSLSPAAQERLLAHRWPGNVRELRNVMQRSQVLVRGASIDAADLEEALGEAGEAPSNVASALTGTLPEAVAQLEKQMIQSALEQSQGNRAEAARRLGIHRQLLYRKLEEYGL
>NZ_CP011163.1|WP_007972029.1|237991_239434_+|HAMP-domain-containing-histidine-kinase
MPRSLLRQLLLIWMVIVAACLGVATMLYGLYRQTEGVRLEEARQQLGGQCARIVQRYAGASEAARRGDDGVGLAAVVVQLVLADAPGVEGGVWDLHKGFVAYAYPTYDGSDHKTDIPAAEWANIVNTAQQSVTTKQAAQYRRDGRREVLLISACPLASGSAAWTMTRVPASKADAWRPLVVGMLLIFAMVAISAIALGVLVRRWSQRLQRIQQALAADTETPHIPPTGTPELDRLGAAVNDYAQRNAQALAQTRRLADELSRHERLAALGRMTATVAHEIRNPIATMRLALENEIARDDATPDDAAHGELMLGQIRRLDGVVESLLGMVQPIRLHLETVVVQDWLATLLEPSPLPPGTPPPRVLLPAAPLRWTLDPQQLGRAVHNLLRNAAQHADPGSEVALQAEAVEGILQLQVCNRGAPIAEPIAAHLFEPFVSGRADGNGLGLALVREIARAHGGHARYAHADGLTHFILELPWRAS
>NZ_CP011163.1|WP_173668633.1|236232_237942_+|ubiquinone-dependent-pyruvate-dehydrogenase
MARFLAETLQSAGVERIWGVTGDSLNGLTDALREMQTIEWMHVRHEEVAAFAAGAEAAVTGQLAVCAGSCGPGNLHLINGLFDCHRSRQPVLAIAAHIPSSEIGLSYFQETHPQELFRECSHFVELVTNPAQLPEVLHRAMRSAILQQGVAVVVIPGDIALLEVDKHVSSAWPALRQPRVLPAAEDVRQLAELLQQSKAVTVLCGSGCAGAHDAVVALADTLGAPVVHALRGKEYVEWDNPFDVGMTGLIGFSSGYHAMLNCDTLLMPGTDFPYRQFYPKDATIVQVDRDPSALGRRTPLQLGIVADVGETIAALLPQLQRREERGFLEKSLAHYRKAREGLDDLAVPADPGEPLHPQFVTRLISQIADQDAVFTCDVGTPTVWAARYLRMNGKRRLLGSFNHGSMANAMPQALGAQAAFPGRQVISLSGDGGFAMLMGDFISLAQLNLPVKVVVFNNASLGFVAMEMKAAGYLDTGTELRNPDFAAMSNAMGILGIRVDESSQLERALRQAFAHSGPALVDVRVATQELAVPPAIKLEQAKGMGLYLLKAVMSGRGDEVIALVKTNLR
>NZ_CP011163.1|WP_007972027.1|235262_235859_-|Ax21-family-protein
MKTSLLALGLLAVLPFAASAAENLSYNFVEGDYVRTPTEGRDADGWGVKASYAIAPNFHVFGDYSKQNADDNNNVFENTDSDFQQWGVGVGFNHEIATSTDFVARVAYRKLDLDTPNINFDGYSVEAGLRNAFGEHFEVYALAGYEDFSKKRGIDIGDNFYGRLGAQVKLNQNWGINGDIRMDGDGNKEWSVGPRFSW
>NZ_CP011163.1|WP_088370899.1|233872_234960_-|IS3-family-transposase
MKKSRFTDSQIIAVLKQAQAGAPVPELCREHGISSATFYKWRSKFGGMDVSMVARMKELEQENRRLKKMYAEAQLSTDLLKEALGKKMVRPSQRREMAQSAVTSGRTNIRHACQAFAVSETCFRYQAKASEQNARIADWLVRLTTAHRDWGFGLCYLYLRNVKGFGWNHKRVYRIYRELELNLRIKPKKRLVRERPEPLAVPEAINQVWSMDFMHDQLADGRSFRLFNVLDDFNREGLGIEVDLSLPSARVIRSLEQIIEWRGKPAVIRCDNGPEYISGALLSWAQRHGIRVEHIQAGKPQQNAYVERYNRTIRYAWLAQTLFDTIDQVQDKATRWLWTYNHERPNMALGGITPAMKLAMAA
>NZ_CP011163.1|WP_007974735.1|232569_233595_+|NAD(P)-dependent-glycerol-3-phosphate-dehydrogenase
MSDLTHKIAVLGAGSWGTALAALLARHGHPTVLWGRDAAMVDTIDRTHENARYLPGIALPDSLRATTDLQAAVADATWILVVVPSHAFTETIRLIAPLRPAGAGVAWATKGFEPGSGRFLHEVARDILGPSVPLAVVTGPSFAKEVTLGLPTAITVHGDDAAFAQVVADAMHGPTFRAYTGDDMVGAELGGAMKNVLAVATGVADGMQLGLNARAGLITRGLNEMLRLAAVIGARPETLMGLAGLGDLVLTCTGDLSRNRRLGLALGRGQSLDEAIREIGQVVESVQTADEVMRQAEHHGIELPISNAVRAVLHGEITPEAGLKELLARERKPEYPQTLFT
>NZ_CP011163.1|WP_007966372.1|245468_245789_+|DUF4156-domain-containing-protein
MRVLMLSVLVATTTAACTWVPIEQSGKGVRVLPAGPVPAGCQQQGEVVVTVKSKVGFYNRNPLRVQEELETLARNEAPGANANAVQAQGQPADGSQRFNAFRCPPR
>NZ_CP011163.1|WP_005912222.1|245890_246907_+|3-oxoacyl-ACP-synthase-III
MLFQNVSIAGLAHVDAPHTLTSKEINERLQPTYDRLGIKTDVLGDVAGIHARRLWDQDVQASDAATQAARKALIDAGIGIEKIGLLVNTSVSRDYLEPSTASIVSGNLGVGDHCVTFDVANACLAFINGMDIAARMLERGEIDYALVVDGETANLVYEKTLERMTSPDVTEEEFRNELAALTLGCGAAAMVMARTELVPDAPRYKGGVTRSATEWNKLCRGNLDRMVTDTRLLLIEGIKLAQKTFMAARQVLGWAVDELDQFVIHQVSRPHTAAFVKSFGIDPAKVMTIFGEHGNIGPASVPIVLSKLKELGRLKKGDRIALLGIGSGLNCSMAEVVW
>NZ_CP011163.1|WP_088370753.1|247018_248176_+|Fic-family-protein
MPHRTTGHYVAGALAGSRYQAFVPGPLPPVPALDFAQVELVVRKERADQALGRLEGITLMLPDPELLLHQYVRKEALLSSQIEGAQSSLSDLLLFEMDAAPGVPMDDVEEISNYVAALNHGLRRLREDDFPLSLRLIREMHALLLQGGRGASKQPGEFRRSQVWVGAASPALAHFVSPPPDAVPGTLAALEQFLHAPPGQIPPLVKAALAHVQFETIHPFSDGHGRLGRLLITLILCSEGVLRELSLYFKRRRADYYDRLNAVRLNGDWEGWLGFFLDGVAETAQQAVDAAQRLLALLARDRARIAALGKRVGNVGLVFEQFARRVVLAVPQVAPHLSLSVPTIRAAVRTLQELKIVNKLTGQQRHRIFAYQAYLDILSEGAQPL
>NZ_CP011163.1|WP_007972039.1|248301_249204_+|alpha/beta-fold-hydrolase
MNYPGYPFTPKRLDVRPGVAMSYLDEGPRDGEVVVMLHGNPSWSYLWRHLVSGLSDRYRCIVPDHIGMGLSDKPDDAPDAQPRYDYTLQSRVDDLDSLLRHLGITGAVTLAVHDWGGMIGFGWALSHHAQVKRLVITNTAAFPLPAEKPMPWQIAMGRHWRPGEWFIRTFNAFSSGASWLGVSRRMPSEVRRAYVAPYNNWRNRISTIRFMQDIPLSPADKGWSLLERSAQALASFADRPAFIAWGLRDICFDKHFLAGFRKALPQAEVTAFDDANHYVLEDKHEVLVPAIRAFLERNPL
>NZ_CP011163.1|WP_007972041.1|249356_249740_-|YkgJ-family-cysteine-cluster-protein
MAHPCLTCGACCAYFRVSFHWSEADPALGGRVPIELTEALRTHERVMRGTSQSQPRCIALDAEIGRYSRCSIHDRRPSSCAAVPASLEFGERSAQCDKSRLAHGLHALTDADWVGVDDAQRNPLPPV
>NZ_CP011163.1|WP_007972042.1|250060_251710_+|AMP-binding-protein
MTTLCNIAATLPQLARERPDQIAIRCPGGRGANGFAAYDVTLSYAELDARSDAIAAGLARHGIGRGSRAVVMVRPSPEFFLLMFALFKAGAVPVLVDPGIDKRALKQCLDEAQPQAFIGIALAQLARRLLRWARSAKQIVTVGGRYGWGGVTLARVERDGAGAGSQLADTGPDDVAAILFTSGSTGVPKGVVYRHRHFVGQIELLRNAFGMQPGGVDLPTFPPFALFDPALGLTSVIPDMDPTRPGSADPRKLHDAINRFGVTQLFGSPALMRVLADYGQPLPDVRLATSAGAPVPPDVVAKLRALLPADAQFWTPYGATECLPVAAIEGRTLDATRAATEAGAGTCVGHVVPPNQVRIIAIDDAAIADWSGVRVLATGEVGEITVAGPTATDAYFNRDAATRIAKIRERCSDGSERVVHRMGDVGYFDAEGRLWFCGRKTHRVEAASGPLYTEQVEPVFNVHPQVRRTALVGVGAPGQQQPVLCVELQPGVSASAFAQVESDLRALGAAHPHTAGVARFLRHSGFPVDIRHNAKIGRETLAVWATQQR
>NZ_CP011163.1|WP_007972044.1|251718_253266_+|winged-helix-turn-helix-domain-containing-protein
MRARYRLDDLRIDIARQRVERDGVAFEVTGLSFRLLHYLLQQGQRVVDFDELIQHVWAPALVNEETVTQRVRLLRQALGDDSRQPRYLRSVRGQGYQLCVPVQQEQVPPAMRRHYAWPVAAVAALVCIGAGVIGWLQTRDAPPAAAALVQRAAYYAGIGQRDDNDRAIDLYGQRLQQAPDDRQAQLGLSRAYSARVCQYDGDAVYAARALQLANGVVTAQPDLAAAHAARGYALDCQGRNADALAAYEQALQLDADADAVRGSAAYLYERRGKLVQALTANLAVRDPTRVRFLPIQIASNLSLLGYAGAAETRYRKNFQLYPDDPFSNLAWPTFLFEHGRAAEAETALNASLNRGTAYAGLSVLQAELAWARGDESLARQAALHAIQLRPQGSFAQTVAWAVHAQPLPTPAVLRMRAQELLNSVERGGDPFDAIDAAVLLLCADAPEVAMRALQRAETAGYRNAGYLRQSPLLKPLRRSPEFIALLARIDADLAAQRAQLRRRNLLPTDAVSGSN
>NZ_CP011163.1|WP_088409205.1|253465_254401_-|serine-hydrolase
MNPLHKAIVSRICGELIRPSLGDATRETLHDTRSLTKSVTALLVGAAIERKLLPSAQAKVFDYFGDRQWQHPDPRKRAITVEDLLTMSSQLECNDDNEFSAGNEERMYLSADWTQFALDLPIRGYAPWMQRPEHSPYGRAFSYCTAGSFLLGALLEKATGQPLRAFAGEVLETPLGIKNVQWTVSSEGVGMGGGGTRYRSRDLAKLGQLLVAQGRWQGRQVIPADWIRAMTRVQAQAREDADYGYLTWHFRFPVHRVQRDTWAMSGNGGNYVFVVPAERLLVVLTRSAYNTRQMHQQSQRVLTDYVLKALP
>NZ_CP011163.1|WP_007962146.1|254403_255384_+|IS5-family-transposase
MQLTFGDAEGLGKRKQTRREIFLAEMEQVVPWQQLLALIAPHYPVSGRPGRQPYALATMLRIHLLQQWYALSDPAMEEALHEIPTLRRFAQLGGLDDIPDETTILNFRRLLETHGLAARMLEAVNAHLARKGQSLRSGTIVDATLIAAPSSTKNADHARDPEMHQTRKGNQWYFGMKAHIGVDEFSGLVHHVHCTAANVADVTVTHALLHGKEDSVFGDSGYTGADKRQELRDCQAVFFIAARPSTMRSIGNTRERAREQRWEHFKASVRAKVEHPFRVIKRQFGYTKVRYRGLAKNTAQVLTLFALSNLWMKRKQLLPAMGSVRL
>NZ_CP011163.1|WP_007972046.1|255997_257008_+|NAD-dependent-epimerase/dehydratase-family-protein
MKVLVTGGGGFLGQALCRGLRARGHEVVSFQRGDYPVLQRLGVGQIRGDLADPQAVRHAFAGIDAVFHNAAKAGAWGSYDSYHQANVVGTQNVIEACRANGVPRLIYTSTPSVTHRATNPVEGLGADEVPYGDDLRAAYAATKAIAERAVLAANDAQLATVALRPRLIWGPGDNHLLPRLAARARAGRLRMVGDGGNLVDSTYIDNAAQAHFDAFQHLAVGAACAGKAYFISNGEPLPMRELLNRLLAAVDAPAVTRSLSFNTAYRIGAVCETLWPLLRLPGEVPLTRFLVEQLCTPHWYSMEPARRDFGYVPRISIEEGLQRLRSSSSNDIAITR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP011163_1	1.6\|29146\|30\|NZ_CP011163\|CRISPRCasFinder	29146-29175	30	NZ_CP044217	Mesorhizobium sp. NIBRBAC000500504 plasmid unnamed, complete sequence	110715-110744	6	0.8
NZ_CP011163_1	1.6\|29146\|30\|NZ_CP011163\|CRISPRCasFinder	29146-29175	30	NC_012811	Methylorubrum extorquens AM1 megaplasmid, complete sequence	847803-847832	6	0.8
NZ_CP011163_1	1.7\|29200\|30\|NZ_CP011163\|CRISPRCasFinder	29200-29229	30	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	841350-841379	6	0.8
NZ_CP011163_1	1.7\|29200\|30\|NZ_CP011163\|CRISPRCasFinder	29200-29229	30	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	841096-841125	6	0.8
NZ_CP011163_1	1.7\|29200\|30\|NZ_CP011163\|CRISPRCasFinder	29200-29229	30	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	741215-741244	6	0.8
NZ_CP011163_1	1.7\|29200\|30\|NZ_CP011163\|CRISPRCasFinder	29200-29229	30	NZ_CP023000	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence	513843-513872	6	0.8
NZ_CP011163_1	1.7\|29200\|30\|NZ_CP011163\|CRISPRCasFinder	29200-29229	30	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	811281-811310	6	0.8
NZ_CP011163_1	1.7\|29200\|30\|NZ_CP011163\|CRISPRCasFinder	29200-29229	30	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	740330-740359	6	0.8
NZ_CP011163_1	1.7\|29200\|30\|NZ_CP011163\|CRISPRCasFinder	29200-29229	30	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	742908-742937	6	0.8
NZ_CP011163_1	1.7\|29200\|30\|NZ_CP011163\|CRISPRCasFinder	29200-29229	30	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	742897-742926	6	0.8
NZ_CP011163_1	1.7\|29200\|30\|NZ_CP011163\|CRISPRCasFinder	29200-29229	30	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	741202-741231	6	0.8
NZ_CP011163_1	1.7\|29200\|30\|NZ_CP011163\|CRISPRCasFinder	29200-29229	30	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	741221-741250	6	0.8
NZ_CP011163_1	1.7\|29200\|30\|NZ_CP011163\|CRISPRCasFinder	29200-29229	30	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	741199-741228	6	0.8
NZ_CP011163_1	1.7\|29200\|30\|NZ_CP011163\|CRISPRCasFinder	29200-29229	30	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	841419-841448	6	0.8
NZ_CP011163_1	1.7\|29200\|30\|NZ_CP011163\|CRISPRCasFinder	29200-29229	30	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	841418-841447	6	0.8
NZ_CP011163_1	1.7\|29200\|30\|NZ_CP011163\|CRISPRCasFinder	29200-29229	30	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	841403-841432	6	0.8
NZ_CP011163_1	1.7\|29200\|30\|NZ_CP011163\|CRISPRCasFinder	29200-29229	30	NZ_CP032297	Rahnella aquatilis strain ZF7 plasmid pRAZF7, complete sequence	533041-533070	6	0.8
NZ_CP011163_1	1.7\|29200\|30\|NZ_CP011163\|CRISPRCasFinder	29200-29229	30	NC_017060	Rahnella aquatilis HX2 plasmid PRA1, complete sequence	112243-112272	6	0.8
NZ_CP011163_1	1.7\|29200\|30\|NZ_CP011163\|CRISPRCasFinder	29200-29229	30	NC_015062	Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence	115413-115442	6	0.8
NZ_CP011163_1	1.7\|29200\|30\|NZ_CP011163\|CRISPRCasFinder	29200-29229	30	NZ_CP034838	Rahnella aquatilis strain KM12 plasmid pKM12v1, complete sequence	115691-115720	6	0.8
NZ_CP011163_1	1.7\|29200\|30\|NZ_CP011163\|CRISPRCasFinder	29200-29229	30	NZ_CP034839	Rahnella aquatilis strain KM25 plasmid pKM12v2, complete sequence	115691-115720	6	0.8
NZ_CP011163_1	1.7\|29200\|30\|NZ_CP011163\|CRISPRCasFinder	29200-29229	30	NZ_CP034837	Rahnella aquatilis strain KM05 plasmid pKM05, complete sequence	93604-93633	6	0.8
NZ_CP011163_1	1.11\|29201\|30\|NZ_CP011163\|PILER-CR	29201-29230	30	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	841350-841379	6	0.8
NZ_CP011163_1	1.11\|29201\|30\|NZ_CP011163\|PILER-CR	29201-29230	30	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	841096-841125	6	0.8
NZ_CP011163_1	1.11\|29201\|30\|NZ_CP011163\|PILER-CR	29201-29230	30	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	741215-741244	6	0.8
NZ_CP011163_1	1.11\|29201\|30\|NZ_CP011163\|PILER-CR	29201-29230	30	NZ_CP023000	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence	513843-513872	6	0.8
NZ_CP011163_1	1.11\|29201\|30\|NZ_CP011163\|PILER-CR	29201-29230	30	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	811281-811310	6	0.8
NZ_CP011163_1	1.11\|29201\|30\|NZ_CP011163\|PILER-CR	29201-29230	30	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	740330-740359	6	0.8
NZ_CP011163_1	1.11\|29201\|30\|NZ_CP011163\|PILER-CR	29201-29230	30	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	742908-742937	6	0.8
NZ_CP011163_1	1.11\|29201\|30\|NZ_CP011163\|PILER-CR	29201-29230	30	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	742897-742926	6	0.8
NZ_CP011163_1	1.11\|29201\|30\|NZ_CP011163\|PILER-CR	29201-29230	30	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	741202-741231	6	0.8
NZ_CP011163_1	1.11\|29201\|30\|NZ_CP011163\|PILER-CR	29201-29230	30	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	741221-741250	6	0.8
NZ_CP011163_1	1.11\|29201\|30\|NZ_CP011163\|PILER-CR	29201-29230	30	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	741199-741228	6	0.8
NZ_CP011163_1	1.11\|29201\|30\|NZ_CP011163\|PILER-CR	29201-29230	30	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	841419-841448	6	0.8
NZ_CP011163_1	1.11\|29201\|30\|NZ_CP011163\|PILER-CR	29201-29230	30	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	841418-841447	6	0.8
NZ_CP011163_1	1.11\|29201\|30\|NZ_CP011163\|PILER-CR	29201-29230	30	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	841403-841432	6	0.8
NZ_CP011163_1	1.11\|29201\|30\|NZ_CP011163\|PILER-CR	29201-29230	30	NZ_CP032297	Rahnella aquatilis strain ZF7 plasmid pRAZF7, complete sequence	533041-533070	6	0.8
NZ_CP011163_1	1.11\|29201\|30\|NZ_CP011163\|PILER-CR	29201-29230	30	NC_017060	Rahnella aquatilis HX2 plasmid PRA1, complete sequence	112243-112272	6	0.8
NZ_CP011163_1	1.11\|29201\|30\|NZ_CP011163\|PILER-CR	29201-29230	30	NC_015062	Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence	115413-115442	6	0.8
NZ_CP011163_1	1.11\|29201\|30\|NZ_CP011163\|PILER-CR	29201-29230	30	NZ_CP034838	Rahnella aquatilis strain KM12 plasmid pKM12v1, complete sequence	115691-115720	6	0.8
NZ_CP011163_1	1.11\|29201\|30\|NZ_CP011163\|PILER-CR	29201-29230	30	NZ_CP034839	Rahnella aquatilis strain KM25 plasmid pKM12v2, complete sequence	115691-115720	6	0.8
NZ_CP011163_1	1.11\|29201\|30\|NZ_CP011163\|PILER-CR	29201-29230	30	NZ_CP034837	Rahnella aquatilis strain KM05 plasmid pKM05, complete sequence	93604-93633	6	0.8
NZ_CP011163_1	1.6\|29146\|30\|NZ_CP011163\|CRISPRCasFinder	29146-29175	30	NZ_CP028969	Aminobacter sp. MSH1 plasmid pUSP1, complete sequence	120445-120474	7	0.767
NZ_CP011163_1	1.6\|29146\|30\|NZ_CP011163\|CRISPRCasFinder	29146-29175	30	NZ_CP026266	Aminobacter sp. MSH1 plasmid pAM01, complete sequence	117739-117768	7	0.767
NZ_CP011163_1	1.6\|29146\|30\|NZ_CP011163\|CRISPRCasFinder	29146-29175	30	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	813583-813612	7	0.767
NZ_CP011163_1	1.6\|29146\|30\|NZ_CP011163\|CRISPRCasFinder	29146-29175	30	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	813131-813160	7	0.767
NZ_CP011163_1	1.8\|29254\|30\|NZ_CP011163\|CRISPRCasFinder	29254-29283	30	NZ_CP015279	Mycobacterium chimaera strain DSM 44623 plasmid unnamed 1, complete sequence	150331-150360	7	0.767
NZ_CP011163_1	1.8\|29254\|30\|NZ_CP011163\|CRISPRCasFinder	29254-29283	30	NZ_CP015280	Mycobacterium chimaera strain DSM 44623 plasmid unnamed 2, complete sequence	81611-81640	7	0.767
NZ_CP011163_1	1.9\|29308\|33\|NZ_CP011163\|CRISPRCasFinder	29308-29340	33	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1614843-1614875	7	0.788
NZ_CP011163_1	1.10\|29365\|30\|NZ_CP011163\|CRISPRCasFinder	29365-29394	30	NZ_CP023712	Rhodococcus ruber strain YC-YT1 plasmid unnamed1, complete sequence	83288-83317	7	0.767
NZ_CP011163_1	1.12\|29255\|30\|NZ_CP011163\|PILER-CR	29255-29284	30	NZ_CP015279	Mycobacterium chimaera strain DSM 44623 plasmid unnamed 1, complete sequence	150331-150360	7	0.767
NZ_CP011163_1	1.12\|29255\|30\|NZ_CP011163\|PILER-CR	29255-29284	30	NZ_CP015280	Mycobacterium chimaera strain DSM 44623 plasmid unnamed 2, complete sequence	81611-81640	7	0.767
NZ_CP011163_1	1.13\|29309\|33\|NZ_CP011163\|PILER-CR	29309-29341	33	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1614843-1614875	7	0.788
NZ_CP011163_1	1.6\|29146\|30\|NZ_CP011163\|CRISPRCasFinder	29146-29175	30	NC_027204	Sinorhizobium phage phiM12, complete genome	74902-74931	8	0.733
NZ_CP011163_1	1.6\|29146\|30\|NZ_CP011163\|CRISPRCasFinder	29146-29175	30	KR052482	Sinorhizobium phage phiN3, complete genome	76608-76637	8	0.733
NZ_CP011163_1	1.6\|29146\|30\|NZ_CP011163\|CRISPRCasFinder	29146-29175	30	KR052481	Sinorhizobium phage phiM19, complete genome	72551-72580	8	0.733
NZ_CP011163_1	1.6\|29146\|30\|NZ_CP011163\|CRISPRCasFinder	29146-29175	30	KR052480	Sinorhizobium phage phiM7, complete genome	72291-72320	8	0.733
NZ_CP011163_1	1.6\|29146\|30\|NZ_CP011163\|CRISPRCasFinder	29146-29175	30	NZ_CP021033	Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence	58430-58459	8	0.733
NZ_CP011163_1	1.8\|29254\|30\|NZ_CP011163\|CRISPRCasFinder	29254-29283	30	NZ_CP017244	Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence	934481-934510	8	0.733
NZ_CP011163_1	1.10\|29365\|30\|NZ_CP011163\|CRISPRCasFinder	29365-29394	30	NZ_CP050094	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b4, complete sequence	380720-380749	8	0.733
NZ_CP011163_1	1.12\|29255\|30\|NZ_CP011163\|PILER-CR	29255-29284	30	NZ_CP017244	Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence	934481-934510	8	0.733
NZ_CP011163_1	1.7\|29200\|30\|NZ_CP011163\|CRISPRCasFinder	29200-29229	30	NZ_CP013739	Streptomyces globisporus C-1027 plasmid SGLP1, complete sequence	114529-114558	9	0.7
NZ_CP011163_1	1.9\|29308\|33\|NZ_CP011163\|CRISPRCasFinder	29308-29340	33	MH271303	Microbacterium phage MementoMori, complete genome	20739-20771	9	0.727
NZ_CP011163_1	1.9\|29308\|33\|NZ_CP011163\|CRISPRCasFinder	29308-29340	33	MN813682	Microbacterium phage Matzah, complete genome	21015-21047	9	0.727
NZ_CP011163_1	1.9\|29308\|33\|NZ_CP011163\|CRISPRCasFinder	29308-29340	33	MK937591	Microbacterium phage Cinna, complete genome	21039-21071	9	0.727
NZ_CP011163_1	1.11\|29201\|30\|NZ_CP011163\|PILER-CR	29201-29230	30	NZ_CP013739	Streptomyces globisporus C-1027 plasmid SGLP1, complete sequence	114529-114558	9	0.7
NZ_CP011163_1	1.13\|29309\|33\|NZ_CP011163\|PILER-CR	29309-29341	33	MH271303	Microbacterium phage MementoMori, complete genome	20739-20771	9	0.727
NZ_CP011163_1	1.13\|29309\|33\|NZ_CP011163\|PILER-CR	29309-29341	33	MN813682	Microbacterium phage Matzah, complete genome	21015-21047	9	0.727
NZ_CP011163_1	1.13\|29309\|33\|NZ_CP011163\|PILER-CR	29309-29341	33	MK937591	Microbacterium phage Cinna, complete genome	21039-21071	9	0.727
NZ_CP011163_1	1.2\|29194\|35\|NZ_CP011163\|CRT	29194-29228	35	NZ_AP017604	Sphingopyxis sp. EG6 plasmid pSREG01, complete sequence	1759-1793	10	0.714
NZ_CP011163_1	1.4\|29302\|38\|NZ_CP011163\|CRT	29302-29339	38	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1614844-1614881	10	0.737
NZ_CP011163_1	1.5\|29359\|35\|NZ_CP011163\|CRT	29359-29393	35	NZ_CP049358	Deinococcus wulumuqiensis R12 plasmid unnamed1, complete sequence	138975-139009	10	0.714
NZ_CP011163_1	1.9\|29308\|33\|NZ_CP011163\|CRISPRCasFinder	29308-29340	33	NZ_CP023152	Mycobacterium chimaera strain FLAC0070 plasmid pFLAC0070_1, complete sequence	116466-116498	10	0.697
NZ_CP011163_1	1.9\|29308\|33\|NZ_CP011163\|CRISPRCasFinder	29308-29340	33	NZ_AP012556	Mycobacterium avium subsp. hominissuis TH135 plasmid pMAH135, complete sequence	22147-22179	10	0.697
NZ_CP011163_1	1.9\|29308\|33\|NZ_CP011163\|CRISPRCasFinder	29308-29340	33	NC_016588	Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence	72444-72476	10	0.697
NZ_CP011163_1	1.13\|29309\|33\|NZ_CP011163\|PILER-CR	29309-29341	33	NZ_CP023152	Mycobacterium chimaera strain FLAC0070 plasmid pFLAC0070_1, complete sequence	116466-116498	10	0.697
NZ_CP011163_1	1.13\|29309\|33\|NZ_CP011163\|PILER-CR	29309-29341	33	NZ_AP012556	Mycobacterium avium subsp. hominissuis TH135 plasmid pMAH135, complete sequence	22147-22179	10	0.697
NZ_CP011163_1	1.13\|29309\|33\|NZ_CP011163\|PILER-CR	29309-29341	33	NC_016588	Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence	72444-72476	10	0.697

1. spacer 1.6|29146|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP044217 (Mesorhizobium sp. NIBRBAC000500504 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

agcgcagatgccggcaagacctatggcgcc	CRISPR spacer
aatgacgattcaggcaagacctatggcgcc	Protospacer
*..*  *** * ******************

2. spacer 1.6|29146|30|NZ_CP011163|CRISPRCasFinder matches to NC_012811 (Methylorubrum extorquens AM1 megaplasmid, complete sequence) position: , mismatch: 6, identity: 0.8

agcgcagat----gccggcaagacctatggcgcc	CRISPR spacer
----ctgatcggggccggcaagaccgatggcgcc	Protospacer
    * ***    ************ ********

3. spacer 1.7|29200|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

4. spacer 1.7|29200|30|NZ_CP011163|CRISPRCasFinder matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

5. spacer 1.7|29200|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

6. spacer 1.7|29200|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP023000 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gcattgggtgccggtgcgcaagccaacaac	Protospacer
* . * ***************.**** ***

7. spacer 1.7|29200|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

8. spacer 1.7|29200|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

9. spacer 1.7|29200|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

10. spacer 1.7|29200|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

11. spacer 1.7|29200|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

12. spacer 1.7|29200|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

13. spacer 1.7|29200|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

14. spacer 1.7|29200|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

15. spacer 1.7|29200|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

16. spacer 1.7|29200|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

17. spacer 1.7|29200|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP032297 (Rahnella aquatilis strain ZF7 plasmid pRAZF7, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gataactttgccggtgcgcaaatcaagaaa	Protospacer
** * *  **************.******

18. spacer 1.7|29200|30|NZ_CP011163|CRISPRCasFinder matches to NC_017060 (Rahnella aquatilis HX2 plasmid PRA1, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gataactttgccggtgcgcaaatcaagaaa	Protospacer
** * *  **************.******

19. spacer 1.7|29200|30|NZ_CP011163|CRISPRCasFinder matches to NC_015062 (Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gataactttgccggtgcgcaaatcaagaaa	Protospacer
** * *  **************.******

20. spacer 1.7|29200|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP034838 (Rahnella aquatilis strain KM12 plasmid pKM12v1, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gataactttgccggtgcgcaaatcaagaaa	Protospacer
** * *  **************.******

21. spacer 1.7|29200|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP034839 (Rahnella aquatilis strain KM25 plasmid pKM12v2, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gataactttgccggtgcgcaaatcaagaaa	Protospacer
** * *  **************.******

22. spacer 1.7|29200|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP034837 (Rahnella aquatilis strain KM05 plasmid pKM05, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gataactttgccggtgcgcaaatcaagaaa	Protospacer
** * *  **************.******

23. spacer 1.11|29201|30|NZ_CP011163|PILER-CR matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

24. spacer 1.11|29201|30|NZ_CP011163|PILER-CR matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

25. spacer 1.11|29201|30|NZ_CP011163|PILER-CR matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

26. spacer 1.11|29201|30|NZ_CP011163|PILER-CR matches to NZ_CP023000 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gcattgggtgccggtgcgcaagccaacaac	Protospacer
* . * ***************.**** ***

27. spacer 1.11|29201|30|NZ_CP011163|PILER-CR matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

28. spacer 1.11|29201|30|NZ_CP011163|PILER-CR matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

29. spacer 1.11|29201|30|NZ_CP011163|PILER-CR matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

30. spacer 1.11|29201|30|NZ_CP011163|PILER-CR matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

31. spacer 1.11|29201|30|NZ_CP011163|PILER-CR matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

32. spacer 1.11|29201|30|NZ_CP011163|PILER-CR matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

33. spacer 1.11|29201|30|NZ_CP011163|PILER-CR matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

34. spacer 1.11|29201|30|NZ_CP011163|PILER-CR matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

35. spacer 1.11|29201|30|NZ_CP011163|PILER-CR matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

36. spacer 1.11|29201|30|NZ_CP011163|PILER-CR matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gagaccggtgccggcgcgcaaacctacgat	Protospacer
****.*********.********* * .*.

37. spacer 1.11|29201|30|NZ_CP011163|PILER-CR matches to NZ_CP032297 (Rahnella aquatilis strain ZF7 plasmid pRAZF7, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gataactttgccggtgcgcaaatcaagaaa	Protospacer
** * *  **************.******

38. spacer 1.11|29201|30|NZ_CP011163|PILER-CR matches to NC_017060 (Rahnella aquatilis HX2 plasmid PRA1, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gataactttgccggtgcgcaaatcaagaaa	Protospacer
** * *  **************.******

39. spacer 1.11|29201|30|NZ_CP011163|PILER-CR matches to NC_015062 (Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gataactttgccggtgcgcaaatcaagaaa	Protospacer
** * *  **************.******

40. spacer 1.11|29201|30|NZ_CP011163|PILER-CR matches to NZ_CP034838 (Rahnella aquatilis strain KM12 plasmid pKM12v1, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gataactttgccggtgcgcaaatcaagaaa	Protospacer
** * *  **************.******

41. spacer 1.11|29201|30|NZ_CP011163|PILER-CR matches to NZ_CP034839 (Rahnella aquatilis strain KM25 plasmid pKM12v2, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gataactttgccggtgcgcaaatcaagaaa	Protospacer
** * *  **************.******

42. spacer 1.11|29201|30|NZ_CP011163|PILER-CR matches to NZ_CP034837 (Rahnella aquatilis strain KM05 plasmid pKM05, complete sequence) position: , mismatch: 6, identity: 0.8

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
gataactttgccggtgcgcaaatcaagaaa	Protospacer
** * *  **************.******

43. spacer 1.6|29146|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP028969 (Aminobacter sp. MSH1 plasmid pUSP1, complete sequence) position: , mismatch: 7, identity: 0.767

agcgcagatgccggcaagacctatggcgcc	CRISPR spacer
tccggctatgtcggcaagacctatcgcgcc	Protospacer
  **   ***.************* *****

44. spacer 1.6|29146|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP026266 (Aminobacter sp. MSH1 plasmid pAM01, complete sequence) position: , mismatch: 7, identity: 0.767

agcgcagatgccggcaagacctatggcgcc	CRISPR spacer
tccggctatgtcggcaagacctatcgcgcc	Protospacer
  **   ***.************* *****

45. spacer 1.6|29146|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 7, identity: 0.767

agcgcagatgccggcaagacctatggcgcc	CRISPR spacer
cgacgaaatgccggcaagaccgatggcggc	Protospacer
 *   *.************** ****** *

46. spacer 1.6|29146|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 7, identity: 0.767

agcgcagatgccggcaagacctatggcgcc	CRISPR spacer
cgacgaaatgccggcaagaccgatggcggc	Protospacer
 *   *.************** ****** *

47. spacer 1.8|29254|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP015279 (Mycobacterium chimaera strain DSM 44623 plasmid unnamed 1, complete sequence) position: , mismatch: 7, identity: 0.767

cgcatcggcgacaacgcgcgtaccgggggc	CRISPR spacer
atcaccggcgacaacgcgcgcaccgccgcc	Protospacer
  **.***************.****  * *

48. spacer 1.8|29254|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP015280 (Mycobacterium chimaera strain DSM 44623 plasmid unnamed 2, complete sequence) position: , mismatch: 7, identity: 0.767

cgcatcggcgacaacgcgcgtaccgggggc	CRISPR spacer
atcaccggcgacaacgcgcgcaccgccgcc	Protospacer
  **.***************.****  * *

49. spacer 1.9|29308|33|NZ_CP011163|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.788

ctcgccgagcgcggcagccagatcagtggcggg	CRISPR spacer
ttcgtcgagcgcggcagccagatcatggggctg	Protospacer
.***.********************  **   *

50. spacer 1.10|29365|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP023712 (Rhodococcus ruber strain YC-YT1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gggctggtgggaaccgagctcggcaagggc	CRISPR spacer
ggcgagctgggcaccgagctcggcaaggtg	Protospacer
**   * **** ****************

51. spacer 1.12|29255|30|NZ_CP011163|PILER-CR matches to NZ_CP015279 (Mycobacterium chimaera strain DSM 44623 plasmid unnamed 1, complete sequence) position: , mismatch: 7, identity: 0.767

cgcatcggcgacaacgcgcgtaccgggggc	CRISPR spacer
atcaccggcgacaacgcgcgcaccgccgcc	Protospacer
  **.***************.****  * *

52. spacer 1.12|29255|30|NZ_CP011163|PILER-CR matches to NZ_CP015280 (Mycobacterium chimaera strain DSM 44623 plasmid unnamed 2, complete sequence) position: , mismatch: 7, identity: 0.767

cgcatcggcgacaacgcgcgtaccgggggc	CRISPR spacer
atcaccggcgacaacgcgcgcaccgccgcc	Protospacer
  **.***************.****  * *

53. spacer 1.13|29309|33|NZ_CP011163|PILER-CR matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.788

ctcgccgagcgcggcagccagatcagtggcggg	CRISPR spacer
ttcgtcgagcgcggcagccagatcatggggctg	Protospacer
.***.********************  **   *

54. spacer 1.6|29146|30|NZ_CP011163|CRISPRCasFinder matches to NC_027204 (Sinorhizobium phage phiM12, complete genome) position: , mismatch: 8, identity: 0.733

agcgcagatgccggcaagacctatggcgcc	CRISPR spacer
gacgaagatgacggcaagacctatgaaacg	Protospacer
..** ***** **************. .*

55. spacer 1.6|29146|30|NZ_CP011163|CRISPRCasFinder matches to KR052482 (Sinorhizobium phage phiN3, complete genome) position: , mismatch: 8, identity: 0.733

agcgcagatgccggcaagacctatggcgcc	CRISPR spacer
gacgaagatgacggcaagacctatgaaacg	Protospacer
..** ***** **************. .*

56. spacer 1.6|29146|30|NZ_CP011163|CRISPRCasFinder matches to KR052481 (Sinorhizobium phage phiM19, complete genome) position: , mismatch: 8, identity: 0.733

agcgcagatgccggcaagacctatggcgcc	CRISPR spacer
gacgaagatgacggcaagacctatgaaacg	Protospacer
..** ***** **************. .*

57. spacer 1.6|29146|30|NZ_CP011163|CRISPRCasFinder matches to KR052480 (Sinorhizobium phage phiM7, complete genome) position: , mismatch: 8, identity: 0.733

agcgcagatgccggcaagacctatggcgcc	CRISPR spacer
gacgaagatgacggcaagacctatgaaacg	Protospacer
..** ***** **************. .*

58. spacer 1.6|29146|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP021033 (Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence) position: , mismatch: 8, identity: 0.733

agcgcagatgccggcaagacctatggcgcc	CRISPR spacer
cgcaacgatgccggcgagacctatggcctt	Protospacer
 **.  *********.*********** ..

59. spacer 1.8|29254|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP017244 (Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence) position: , mismatch: 8, identity: 0.733

cgcatcggcgacaacgcgcgtaccgggggc	CRISPR spacer
cgcagcggcgacaacgcgcgcaccatcttg	Protospacer
**** ***************.***.

60. spacer 1.10|29365|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP050094 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b4, complete sequence) position: , mismatch: 8, identity: 0.733

gggctggtgggaaccgagctcggcaagggc	CRISPR spacer
ctgctggtgggaatcgagttcggcaccgca	Protospacer
  ***********.****.******  *

61. spacer 1.12|29255|30|NZ_CP011163|PILER-CR matches to NZ_CP017244 (Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence) position: , mismatch: 8, identity: 0.733

cgcatcggcgacaacgcgcgtaccgggggc	CRISPR spacer
cgcagcggcgacaacgcgcgcaccatcttg	Protospacer
**** ***************.***.

62. spacer 1.7|29200|30|NZ_CP011163|CRISPRCasFinder matches to NZ_CP013739 (Streptomyces globisporus C-1027 plasmid SGLP1, complete sequence) position: , mismatch: 9, identity: 0.7

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
cagagcggtgccggtgcgcatacctctggg	Protospacer
 *** *************** ***   ..

63. spacer 1.9|29308|33|NZ_CP011163|CRISPRCasFinder matches to MH271303 (Microbacterium phage MementoMori, complete genome) position: , mismatch: 9, identity: 0.727

ctcgccgagcgcggcagccagatcagtggcggg	CRISPR spacer
ctcgccgagcgcggcatcccgatcctctccctg	Protospacer
**************** ** ****  .  *  *

64. spacer 1.9|29308|33|NZ_CP011163|CRISPRCasFinder matches to MN813682 (Microbacterium phage Matzah, complete genome) position: , mismatch: 9, identity: 0.727

ctcgccgagcgcggcagccagatcagtggcggg	CRISPR spacer
ctcgccgagcgcggcatcccgatcctctccctg	Protospacer
**************** ** ****  .  *  *

65. spacer 1.9|29308|33|NZ_CP011163|CRISPRCasFinder matches to MK937591 (Microbacterium phage Cinna, complete genome) position: , mismatch: 9, identity: 0.727

ctcgccgagcgcggcagccagatcagtggcggg	CRISPR spacer
ctcgccgagcgcggcatcccgatcctctccctg	Protospacer
**************** ** ****  .  *  *

66. spacer 1.11|29201|30|NZ_CP011163|PILER-CR matches to NZ_CP013739 (Streptomyces globisporus C-1027 plasmid SGLP1, complete sequence) position: , mismatch: 9, identity: 0.7

gagatcggtgccggtgcgcaaaccaagaac	CRISPR spacer
cagagcggtgccggtgcgcatacctctggg	Protospacer
 *** *************** ***   ..

67. spacer 1.13|29309|33|NZ_CP011163|PILER-CR matches to MH271303 (Microbacterium phage MementoMori, complete genome) position: , mismatch: 9, identity: 0.727

ctcgccgagcgcggcagccagatcagtggcggg	CRISPR spacer
ctcgccgagcgcggcatcccgatcctctccctg	Protospacer
**************** ** ****  .  *  *

68. spacer 1.13|29309|33|NZ_CP011163|PILER-CR matches to MN813682 (Microbacterium phage Matzah, complete genome) position: , mismatch: 9, identity: 0.727

ctcgccgagcgcggcagccagatcagtggcggg	CRISPR spacer
ctcgccgagcgcggcatcccgatcctctccctg	Protospacer
**************** ** ****  .  *  *

69. spacer 1.13|29309|33|NZ_CP011163|PILER-CR matches to MK937591 (Microbacterium phage Cinna, complete genome) position: , mismatch: 9, identity: 0.727

ctcgccgagcgcggcagccagatcagtggcggg	CRISPR spacer
ctcgccgagcgcggcatcccgatcctctccctg	Protospacer
**************** ** ****  .  *  *

70. spacer 1.2|29194|35|NZ_CP011163|CRT matches to NZ_AP017604 (Sphingopyxis sp. EG6 plasmid pSREG01, complete sequence) position: , mismatch: 10, identity: 0.714

tccatcgagatcggtgccggtgcgcaaaccaagaa	CRISPR spacer
gccgtcgcgatcggtgccggtgcgcagcacctggg	Protospacer
 **.*** ******************.  *  *..

71. spacer 1.4|29302|38|NZ_CP011163|CRT matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.737

agcatcctcgccgagcgcggcagccagatcagtggcgg	CRISPR spacer
atgttcttcgtcgagcgcggcagccagatcatggggct	Protospacer
*   **.***.********************  **

72. spacer 1.5|29359|35|NZ_CP011163|CRT matches to NZ_CP049358 (Deinococcus wulumuqiensis R12 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.714

agcatcgggctggtgggaaccgagctcggcaaggg	CRISPR spacer
agcatcgggcgggtgggcaccgagccgaccatcat	Protospacer
********** ****** *******. . **  .

73. spacer 1.9|29308|33|NZ_CP011163|CRISPRCasFinder matches to NZ_CP023152 (Mycobacterium chimaera strain FLAC0070 plasmid pFLAC0070_1, complete sequence) position: , mismatch: 10, identity: 0.697

ctcgccgagcgcggcagccagatcagtggcggg	CRISPR spacer
gccgccgagcgcagcagcccgatcagcccgtag	Protospacer
 .**********.****** ******.    .*

74. spacer 1.9|29308|33|NZ_CP011163|CRISPRCasFinder matches to NZ_AP012556 (Mycobacterium avium subsp. hominissuis TH135 plasmid pMAH135, complete sequence) position: , mismatch: 10, identity: 0.697

ctcgccgagcgcggcagccagatcagtggcggg	CRISPR spacer
gccgccgagcgcagcagcccgatcagcccgtag	Protospacer
 .**********.****** ******.    .*

75. spacer 1.9|29308|33|NZ_CP011163|CRISPRCasFinder matches to NC_016588 (Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence) position: , mismatch: 10, identity: 0.697

ctcgccgagcgcggcagccagatcagtggcggg	CRISPR spacer
ctcggcgagcgcggcggccagatcctcctccat	Protospacer
**** **********.********  .  * .

76. spacer 1.13|29309|33|NZ_CP011163|PILER-CR matches to NZ_CP023152 (Mycobacterium chimaera strain FLAC0070 plasmid pFLAC0070_1, complete sequence) position: , mismatch: 10, identity: 0.697

ctcgccgagcgcggcagccagatcagtggcggg	CRISPR spacer
gccgccgagcgcagcagcccgatcagcccgtag	Protospacer
 .**********.****** ******.    .*

77. spacer 1.13|29309|33|NZ_CP011163|PILER-CR matches to NZ_AP012556 (Mycobacterium avium subsp. hominissuis TH135 plasmid pMAH135, complete sequence) position: , mismatch: 10, identity: 0.697

ctcgccgagcgcggcagccagatcagtggcggg	CRISPR spacer
gccgccgagcgcagcagcccgatcagcccgtag	Protospacer
 .**********.****** ******.    .*

78. spacer 1.13|29309|33|NZ_CP011163|PILER-CR matches to NC_016588 (Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence) position: , mismatch: 10, identity: 0.697

ctcgccgagcgcggcagccagatcagtggcggg	CRISPR spacer
ctcggcgagcgcggcggccagatcctcctccat	Protospacer
**** **********.********  .  * .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2899 : 82312

Leptospira_phage(45.45%)

transposase,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_098477673.1\|2899_4001_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6
WP_007971883.1\|4967_6074_+	DNA replication/repair protein RecF	NA	NA	NA	NA
WP_007971884.1\|6188_8633_+	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	1.6e-113	34.7
WP_007971885.1\|8700_9537_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_005912440.1\|9721_10528_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_007968206.1\|10805_11999_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_172453682.1\|12266_12827_+	TonB family protein	NA	NA	NA	NA
WP_007971888.1\|12912_13674_+	MotA/TolQ/ExbB proton channel family protein	NA	NA	NA	NA
WP_005912447.1\|13720_14143_+	biopolymer transporter ExbD	NA	NA	NA	NA
WP_005912449.1\|14146_14560_+	biopolymer transporter ExbD	NA	NA	NA	NA
WP_007971889.1\|15108_15516_+	biopolymer transporter ExbD	NA	NA	NA	NA
WP_007968197.1\|15768_16536_-	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
WP_005912451.1\|16543_16813_-	hypothetical protein	NA	NA	NA	NA
WP_007971891.1\|16887_18348_-	cardiolipin synthase	NA	NA	NA	NA
WP_088409191.1\|18648_19374_+	YafY family transcriptional regulator	NA	NA	NA	NA
WP_042805567.1\|19422_19788_+	DUF1330 domain-containing protein	NA	NA	NA	NA
WP_007971897.1\|19911_21039_-	PA0069 family radical SAM protein	NA	NA	NA	NA
WP_007971900.1\|21224_21926_-	2OG-Fe(II) oxygenase	E3SK61	Synechococcus_phage	1.0e-17	47.2
WP_007968187.1\|22190_23531_-	outer membrane protein transport protein	NA	NA	NA	NA
WP_003482177.1\|23755_24448_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_042805569.1\|24556_24877_+	DUF1820 family protein	NA	NA	NA	NA
WP_007971907.1\|26030_27557_-	S41 family peptidase	A0A0R6PIZ1	Moraxella_phage	2.2e-25	28.9
WP_022557789.1\|27659_28958_-	peptidoglycan DD-metalloendopeptidase family protein	NA	NA	NA	NA
WP_007971911.1\|29055_29655_+	hypothetical protein	NA	NA	NA	NA
WP_088370743.1\|29814_31611_+	M28 family peptidase	NA	NA	NA	NA
WP_088370744.1\|32015_33103_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007969091.1\|33507_34470_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_098477673.1\|34658_35761_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6
WP_173668619.1\|37610_37976_-	hypothetical protein	NA	NA	NA	NA
WP_007964895.1\|37982_39464_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_088409192.1\|39660_44133_-	glutamate synthase large subunit	NA	NA	NA	NA
WP_022557799.1\|44334_44715_-	proteinase inhibitor	NA	NA	NA	NA
WP_007973056.1\|44771_46049_+	DNA topoisomerase IB	A0A0U2TSJ7	Niemeyer_virus	7.1e-41	35.1
WP_003482129.1\|46265_46610_-	hypothetical protein	NA	NA	NA	NA
WP_003482061.1\|47049_47436_+	BlaI/MecI/CopY family transcriptional regulator	NA	NA	NA	NA
WP_007973059.1\|47439_49182_+	hypothetical protein	NA	NA	NA	NA
WP_042675361.1\|50370_50880_+	hypothetical protein	NA	NA	NA	NA
WP_042805848.1\|50912_52094_+	saccharopine dehydrogenase NADP-binding domain-containing protein	NA	NA	NA	NA
WP_007964877.1\|52234_53020_-	DUF1868 domain-containing protein	NA	NA	NA	NA
WP_173668620.1\|53031_55689_-	TonB-dependent receptor	NA	NA	NA	NA
WP_042805849.1\|55791_56949_+	ROK family protein	NA	NA	NA	NA
WP_173668621.1\|57093_59283_+	avirulence protein	NA	NA	NA	NA
WP_088409193.1\|59770_61276_-	ribonuclease H-like domain-containing protein	NA	NA	NA	NA
WP_007973073.1\|61272_63768_-	DEAD/DEAH box helicase	A0A1B1IUF6	uncultured_Mediterranean_phage	1.5e-07	35.1
WP_162269129.1\|63945_64608_+	hemolysin III family protein	NA	NA	NA	NA
WP_029818122.1\|64673_64931_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_042675357.1\|64918_65218_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_007973076.1\|65397_66297_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_007973078.1\|66355_67093_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_007973080.1\|67218_68130_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_088409605.1\|68344_69418_-	hypothetical protein	NA	NA	NA	NA
WP_098477673.1\|70474_71576_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6
WP_162829046.1\|73310_74627_+	type III effector HopG1	NA	NA	NA	NA
WP_007970250.1\|75024_75468_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_088409194.1\|75769_76912_-	glycoside hydrolase family 5 protein	NA	NA	NA	NA
WP_007970254.1\|77697_78771_-	glycoside hydrolase family 5 protein	NA	NA	NA	NA
WP_007970257.1\|79080_80139_+	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L339	Tupanvirus	1.3e-77	45.4
WP_098477673.1\|81210_82312_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6

DBSCAN-SWA_2

379357 : 439873

Leptospira_phage(57.14%)

transposase,tRNA,integrase

attL 401203:401219|attR 444461:444477

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088370744.1\|379357_380444_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_098477673.1\|380553_381655_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6
WP_007974272.1\|382491_384330_-	dihydroxy-acid dehydratase	NA	NA	NA	NA
WP_007974270.1\|384715_386077_+	cellulase family glycosylhydrolase	NA	NA	NA	NA
WP_082332486.1\|386125_386392_+	YkgJ family cysteine cluster protein	NA	NA	NA	NA
WP_003485643.1\|386432_386978_-	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_007974266.1\|388914_390174_+	HD-GYP domain-containing protein	NA	NA	NA	NA
WP_007974265.1\|390617_391148_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_007974262.1\|391315_392308_+	transporter	NA	NA	NA	NA
WP_007968429.1\|392341_393109_+	coniferyl-alcohol dehydrogenase	NA	NA	NA	NA
WP_007974260.1\|393139_394633_+	benzaldehyde dehydrogenase	NA	NA	NA	NA
WP_088409214.1\|396043_397228_+	4-hydroxybenzoate 3-monooxygenase	NA	NA	NA	NA
WP_039731177.1\|397680_398193_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_007968439.1\|398304_399804_-	glycerol kinase GlpK	NA	NA	NA	NA
WP_007968441.1\|399944_400766_-	aquaporin family protein	NA	NA	NA	NA
WP_042676213.1\|400940_402455_-	glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
401203:401219	attL	NA	NA	NA	NA
WP_007968445.1\|402678_403506_-	DeoR family transcriptional regulator	NA	NA	NA	NA
WP_007974253.1\|404001_404985_-	oxidoreductase	NA	NA	NA	NA
WP_007974252.1\|405085_406162_-	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_007974251.1\|406414_407278_+	CoA transferase subunit A	NA	NA	NA	NA
WP_007974250.1\|407274_408063_+	CoA-transferase subunit beta	NA	NA	NA	NA
WP_088409215.1\|408059_409268_+	3-oxoadipyl-CoA thiolase	NA	NA	NA	NA
WP_007974248.1\|409346_410081_+	protocatechuate 3,4-dioxygenase subunit beta	NA	NA	NA	NA
WP_007968458.1\|410085_410649_+	protocatechuate 3,4-dioxygenase subunit alpha	NA	NA	NA	NA
WP_042806138.1\|411006_412359_+	3-carboxy-cis,cis-muconate cycloisomerase	NA	NA	NA	NA
WP_007974245.1\|413177_413591_+	4-carboxymuconolactone decarboxylase	NA	NA	NA	NA
WP_088409216.1\|413705_414632_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_042806136.1\|415187_416048_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_007968468.1\|416196_417057_+	serine protein kinase RIO	NA	NA	NA	NA
WP_007974240.1\|417329_418298_+	alpha/beta hydrolase	A0A167RJ59	Powai_lake_megavirus	2.4e-25	29.8
WP_007974239.1\|418592_419273_-	DUF2490 domain-containing protein	NA	NA	NA	NA
WP_007974237.1\|419509_421414_-\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
WP_003485699.1\|421986_422460_-	hypothetical protein	NA	NA	NA	NA
WP_007968475.1\|422617_423577_+	pyridoxal-phosphate dependent enzyme	NA	NA	NA	NA
WP_033481400.1\|423561_424179_+	YdcF family protein	NA	NA	NA	NA
WP_007974235.1\|424221_424641_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_007968478.1\|424876_425782_-	lipid A hydroxylase LpxO	S4VR59	Pandoravirus	1.2e-37	39.5
WP_007968479.1\|426030_426915_-	malonyl-ACP O-methyltransferase BioC	NA	NA	NA	NA
WP_088409217.1\|426982_427765_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_007974230.1\|427809_428571_-	pimeloyl-ACP methyl ester esterase BioH	NA	NA	NA	NA
WP_007968484.1\|428672_429053_-	hypothetical protein	NA	NA	NA	NA
WP_007968486.1\|429240_430446_-	8-amino-7-oxononanoate synthase	NA	NA	NA	NA
WP_007968487.1\|430530_431565_-	biotin synthase BioB	NA	NA	NA	NA
WP_007974227.1\|431614_432340_+	ComF family protein	NA	NA	NA	NA
WP_007974225.1\|432588_433494_-	4-hydroxybenzoate octaprenyltransferase	NA	NA	NA	NA
WP_007974223.1\|434214_435408_+\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	6.7e-110	50.9
WP_007969091.1\|436106_437069_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_098477673.1\|437501_438603_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6
WP_088370746.1\|438786_439873_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
444461:444477	attR	NA	NA	NA	NA

DBSCAN-SWA_3

627586 : 671364

Ralstonia_phage(42.86%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007969091.1\|627586_628549_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007962146.1\|628905_629886_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_042805038.1\|630339_631887_+	hypothetical protein	NA	NA	NA	NA
WP_162829050.1\|632102_632252_-	hypothetical protein	NA	NA	NA	NA
WP_088370746.1\|633536_634623_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_088409230.1\|634670_636194_+	S53 family peptidase	NA	NA	NA	NA
WP_042805667.1\|636302_636812_-	hypothetical protein	NA	NA	NA	NA
WP_007972284.1\|637719_638667_-	mitochondrial fission ELM1 family protein	NA	NA	NA	NA
WP_007963336.1\|638800_639391_+	malonic semialdehyde reductase	NA	NA	NA	NA
WP_007972283.1\|639622_640366_+	polyisoprenoid-binding protein	NA	NA	NA	NA
WP_042805666.1\|640897_642100_+	histidine-type phosphatase	NA	NA	NA	NA
WP_007963342.1\|642182_642977_-	siderophore-interacting protein	NA	NA	NA	NA
WP_088409231.1\|644015_645662_+	malonate decarboxylase subunit alpha	NA	NA	NA	NA
WP_005914105.1\|645671_645989_+	malonate decarboxylase acyl carrier protein	NA	NA	NA	NA
WP_173668635.1\|646125_647028_+	biotin-independent malonate decarboxylase subunit beta	NA	NA	NA	NA
WP_007962423.1\|647018_647723_+	biotin-independent malonate decarboxylase subunit gamma	NA	NA	NA	NA
WP_007972276.1\|647725_648367_+	malonate decarboxylase holo-[acyl-carrier-protein] synthase	NA	NA	NA	NA
WP_007972275.1\|648363_649233_+	triphosphoribosyl-dephospho-CoA synthase MdcB	NA	NA	NA	NA
WP_007972274.1\|649459_650380_+	malonate decarboxylase subunit epsilon	NA	NA	NA	NA
WP_007972273.1\|650467_651823_+	hypothetical protein	NA	NA	NA	NA
WP_007972272.1\|651901_652621_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_007962444.1\|652770_653394_-	HAD hydrolase-like protein	NA	NA	NA	NA
WP_108702724.1\|653587_653782_-	methylenetetrahydrofolate reductase C-terminal domain-containing protein	NA	NA	NA	NA
WP_007962633.1\|653788_654208_-	STAS domain-containing protein	NA	NA	NA	NA
WP_007969522.1\|654204_654636_-	ATP-binding protein	NA	NA	NA	NA
WP_046735593.1\|654632_656693_-	SpoIIE family protein phosphatase	NA	NA	NA	NA
WP_040966309.1\|656876_657476_+	hypothetical protein	NA	NA	NA	NA
WP_007969516.1\|657472_658795_+	DUF2974 domain-containing protein	NA	NA	NA	NA
WP_007962146.1\|659167_660148_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_007962641.1\|660372_661374_+	glycosyl hydrolase 53 family protein	NA	NA	NA	NA
WP_007969611.1\|661786_664474_+	pyruvate dehydrogenase (acetyl-transferring), homodimeric type	NA	NA	NA	NA
WP_007962146.1\|664620_665601_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_007969613.1\|665819_666932_+	DNA cytosine methyltransferase	A0A1P8CX13	Bacillus_phage	3.9e-11	31.1
WP_088370757.1\|666928_667978_+	DNA cytosine methyltransferase	A7XXH6	Thermus_virus	1.4e-26	28.5
WP_007969617.1\|668003_668969_+	HNH endonuclease	NA	NA	NA	NA
WP_042805131.1\|669089_669599_+	hypothetical protein	NA	NA	NA	NA
WP_098477673.1\|670262_671364_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6

DBSCAN-SWA_4

765138 : 841616

Leptospira_phage(18.18%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088370746.1\|765138_766226_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_042805257.1\|766994_767348_-	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
WP_042805258.1\|767617_770239_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	8.8e-46	26.6
WP_088409245.1\|772625_773711_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_003484084.1\|774090_775473_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	9.3e-55	35.7
WP_173362018.1\|775781_776840_+	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_007969488.1\|776871_777534_+	maleylacetoacetate isomerase	NA	NA	NA	NA
WP_003484093.1\|778062_779196_-	PilT/PilU family type 4a pilus ATPase	NA	NA	NA	NA
WP_173362029.1\|779378_779678_+	DUF4398 domain-containing protein	NA	NA	NA	NA
WP_007964831.1\|779674_780565_+	hypothetical protein	NA	NA	NA	NA
WP_003484103.1\|780916_781135_+	YdcH family protein	NA	NA	NA	NA
WP_007964832.1\|781373_782744_+	pyridoxal-phosphate dependent enzyme	A0A1X9I5F1	Streptococcus_phage	2.0e-49	38.5
WP_007971000.1\|782832_784020_+	cystathionine gamma-synthase	NA	NA	NA	NA
WP_007971002.1\|784392_787512_+	glycosyltransferase	A0A218MKE2	uncultured_virus	1.4e-13	24.4
WP_007971003.1\|787594_788389_+	ABC transporter permease	NA	NA	NA	NA
WP_007964837.1\|788385_789672_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.2e-10	22.5
WP_007971004.1\|789748_791896_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_007971005.1\|791895_794412_+	glycosyltransferase family 4 protein	A0A2K9VGK0	Pontimonas_phage	4.2e-05	27.9
WP_003484125.1\|794523_795564_+	GDP-mannose 4,6-dehydratase	M1HVB5	Paramecium_bursaria_Chlorella_virus	5.8e-102	54.2
WP_007971006.1\|795541_796441_+	GDP-mannose 4,6-dehydratase	NA	NA	NA	NA
WP_157883144.1\|796490_797411_+	hypothetical protein	NA	NA	NA	NA
WP_157883145.1\|797497_798463_+	hypothetical protein	NA	NA	NA	NA
WP_088370746.1\|799042_800129_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007961930.1\|801038_801437_-	GtrA family protein	NA	NA	NA	NA
WP_007971504.1\|801433_802729_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_007971505.1\|802751_803696_-	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_005929637.1\|803697_804426_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_007962550.1\|804428_805730_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_088409246.1\|805729_807118_-	UbiA family prenyltransferase	NA	NA	NA	NA
WP_007962553.1\|807220_808207_-	flippase-like domain-containing protein	NA	NA	NA	NA
WP_007971513.1\|808222_809167_-	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_007962558.1\|809166_809913_-	electron transfer flavoprotein subunit beta/FixA family protein	NA	NA	NA	NA
WP_007971515.1\|810119_811175_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	3.2e-79	45.0
WP_007971516.1\|811226_812114_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	1.5e-93	57.4
WP_007971517.1\|812110_812668_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	3.9e-44	48.3
WP_007962671.1\|812664_813564_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	4.1e-27	36.2
WP_088370744.1\|813649_814736_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007971518.1\|815103_816270_+	nucleotide sugar dehydrogenase	M1HZB2	Paramecium_bursaria_Chlorella_virus	1.9e-117	58.4
WP_007971519.1\|816544_817948_-	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	7.2e-47	29.8
WP_007971520.1\|817994_819341_-	phosphomannomutase/phosphoglucomutase	A0A127AWJ1	Bacillus_phage	7.5e-33	27.1
WP_007962676.1\|819475_820207_+	CoA transferase subunit A	NA	NA	NA	NA
WP_007962677.1\|820206_820839_+	CoA transferase subunit B	NA	NA	NA	NA
WP_007971521.1\|820869_822519_-	electron transfer flavoprotein-ubiquinone oxidoreductase	NA	NA	NA	NA
WP_007971522.1\|822634_823231_+	alpha-ketoglutarate-dependent dioxygenase AlkB	A0A2K9L0M4	Tupanvirus	9.6e-25	34.3
WP_022559971.1\|823693_824338_-	membrane integrity-associated transporter subunit PqiC	NA	NA	NA	NA
WP_003484185.1\|824334_825261_-	MCE family protein	NA	NA	NA	NA
WP_007969506.1\|825263_826100_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	4.5e-12	31.4
WP_007962042.1\|826185_827298_-	ABC transporter permease	NA	NA	NA	NA
WP_007962040.1\|827466_828726_+	threonine/serine exporter family protein	NA	NA	NA	NA
WP_007969091.1\|828796_829759_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007970417.1\|829861_830323_-	H-NS histone family protein	NA	NA	NA	NA
WP_042805328.1\|830466_832161_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_007964196.1\|832505_832907_-	DUF4124 domain-containing protein	NA	NA	NA	NA
WP_005913472.1\|833038_833812_+	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
WP_007964195.1\|833834_834290_+	hypothetical protein	NA	NA	NA	NA
WP_007970422.1\|834286_834769_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_157835077.1\|834818_834962_+	hypothetical protein	NA	NA	NA	NA
WP_007970423.1\|835591_835975_+	hypothetical protein	NA	NA	NA	NA
WP_042805331.1\|836282_838256_-	transglycosylase SLT domain-containing protein	A0A0H3V0Q1	Geobacillus_virus	3.5e-15	36.7
WP_007962146.1\|840635_841616_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6

DBSCAN-SWA_5

902798 : 984766

Ralstonia_phage(30.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007962146.1\|902798_903779_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_007969828.1\|903903_907101_+	YadA-like family protein	NA	NA	NA	NA
WP_042805188.1\|907203_909129_+	S8 family serine peptidase	A0A217EQY2	Bacillus_phage	9.7e-18	32.0
WP_088409254.1\|909668_916685_+	hypothetical protein	NA	NA	NA	NA
WP_007972735.1\|916910_918794_+	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	1.8e-24	33.2
WP_042805770.1\|918923_920651_+	type II secretion system ATPase GspE	NA	NA	NA	NA
WP_088409255.1\|920826_922044_+	type II secretion system F family protein	NA	NA	NA	NA
WP_033481101.1\|922284_922716_+	type II secretion system major pseudopilin GspG	NA	NA	NA	NA
WP_088409256.1\|922725_923235_+	GspH/FimT family pseudopilin	NA	NA	NA	NA
WP_007965181.1\|923231_923648_+	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
WP_007965183.1\|923644_924280_+	type II secretion system protein J	NA	NA	NA	NA
WP_042675433.1\|924276_925128_+	general secretion pathway protein GspK	NA	NA	NA	NA
WP_007965187.1\|925124_926246_+	PilN domain-containing protein	NA	NA	NA	NA
WP_007972728.1\|926229_926883_+	type II secretion system protein M	NA	NA	NA	NA
WP_007972727.1\|926872_927670_+	hypothetical protein	NA	NA	NA	NA
WP_007972726.1\|927666_929958_+	type II secretion system secretin GspD	A7BJX1	Enterobacteria_phage	3.6e-11	22.6
WP_131454214.1\|930031_930304_+	hypothetical protein	NA	NA	NA	NA
WP_042805772.1\|930417_931245_+	hypothetical protein	NA	NA	NA	NA
WP_007965195.1\|931658_932387_-	UTRA domain-containing protein	NA	NA	NA	NA
WP_007972724.1\|932492_933068_-	nicotinamide mononucleotide transporter	NA	NA	NA	NA
WP_088409257.1\|933292_935455_-	TonB-dependent receptor	NA	NA	NA	NA
WP_007972722.1\|935486_936644_-	phosphotransferase	NA	NA	NA	NA
WP_007972718.1\|937262_938102_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_007972716.1\|938229_939264_+	hypothetical protein	NA	NA	NA	NA
WP_042805768.1\|941232_942528_+	hypothetical protein	NA	NA	NA	NA
WP_007972714.1\|942509_943478_+	hypothetical protein	NA	NA	NA	NA
WP_007965213.1\|945237_945693_+	hypothetical protein	NA	NA	NA	NA
WP_088409258.1\|945998_947085_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.2e-43	36.8
WP_042805110.1\|947480_949625_+	UDP-forming cellulose synthase catalytic subunit	NA	NA	NA	NA
WP_082336374.1\|949630_951997_+	cellulose biosynthesis cyclic di-GMP-binding regulatory protein BcsB	NA	NA	NA	NA
WP_088370759.1\|953147_957677_+	cellulose biosynthesis protein BcsC	NA	NA	NA	NA
WP_022559930.1\|959559_959985_-	hypothetical protein	NA	NA	NA	NA
WP_007963670.1\|960331_960754_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	1.5e-40	61.5
WP_007963672.1\|961087_961603_+	peptide deformylase	NA	NA	NA	NA
WP_088409259.1\|961821_962766_-	DegV family protein	NA	NA	NA	NA
WP_131438865.1\|963247_963661_+	hypothetical protein	NA	NA	NA	NA
WP_082336469.1\|963578_964064_+	glycosyl hydrolase family 5	NA	NA	NA	NA
WP_007972231.1\|964453_966043_-	rhamnogalacturonase B	NA	NA	NA	NA
WP_042805654.1\|966397_966712_-	hypothetical protein	NA	NA	NA	NA
WP_007972234.1\|967012_968293_-	amidohydrolase family protein	NA	NA	NA	NA
WP_007972236.1\|968289_969699_-	amidohydrolase	NA	NA	NA	NA
WP_173362041.1\|969832_970399_+	DUF924 family protein	A0A1V0SIY0	Klosneuvirus	1.2e-16	38.1
WP_007963687.1\|971622_972549_-	Grx4 family monothiol glutaredoxin	NA	NA	NA	NA
WP_007963688.1\|972594_973386_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_007972239.1\|973518_974190_-	methyltransferase	NA	NA	NA	NA
WP_007963690.1\|974658_975309_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_007963696.1\|975308_976580_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_088409260.1\|976872_978849_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	7.1e-40	32.5
WP_088409261.1\|978845_980243_+	HlyD family type I secretion periplasmic adaptor subunit	NA	NA	NA	NA
WP_007962146.1\|980294_981275_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_007969091.1\|981479_982442_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007962146.1\|982556_983537_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_007969091.1\|983803_984766_-\|transposase	IS1595 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

1413880 : 1510181

111

Xanthomonas_virus(25.0%)

terminase,tail,head,capsid,protease,portal,transposase,tRNA,integrase

attL 1469869:1469928|attR 1509127:1510201

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007972915.1\|1413880_1414804_+\|tRNA	methionyl-tRNA formyltransferase	NA	NA	NA	NA
WP_007964231.1\|1414803_1416114_+	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
WP_007972912.1\|1416164_1417886_+	glycosyltransferase family 39 protein	NA	NA	NA	NA
WP_007972910.1\|1418051_1419329_+	O-antigen ligase family protein	NA	NA	NA	NA
WP_007972908.1\|1419526_1420351_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_080720841.1\|1420351_1421410_+	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
WP_007964242.1\|1421499_1423005_-	PH domain-containing protein	NA	NA	NA	NA
WP_007972905.1\|1423001_1423478_-	PH domain-containing protein	NA	NA	NA	NA
WP_007972904.1\|1423616_1424750_-	GTP cyclohydrolase II RibA	A0A2H4PQS2	Staphylococcus_phage	6.1e-28	40.9
WP_007964247.1\|1424995_1425517_+	N-acetyltransferase	NA	NA	NA	NA
WP_173668623.1\|1425713_1426730_-	lauroyl acyltransferase	NA	NA	NA	NA
WP_022560115.1\|1426728_1427169_+\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_007972894.1\|1427277_1429155_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.8e-37	35.5
WP_007964253.1\|1429347_1429668_+	hypothetical protein	NA	NA	NA	NA
WP_042805811.1\|1430272_1430515_-	AlpA family phage regulatory protein	A0A2H4J8C8	uncultured_Caudovirales_phage	1.2e-05	36.8
WP_157883152.1\|1430495_1430672_-	hypothetical protein	NA	NA	NA	NA
WP_007972892.1\|1430661_1431054_-	hypothetical protein	NA	NA	NA	NA
WP_042805810.1\|1431040_1431397_-	hypothetical protein	NA	NA	NA	NA
WP_007972889.1\|1431386_1432073_-	hypothetical protein	NA	NA	NA	NA
WP_007972887.1\|1432069_1432444_-	hypothetical protein	NA	NA	NA	NA
WP_131438881.1\|1432454_1432712_-	hypothetical protein	NA	NA	NA	NA
WP_042805807.1\|1432704_1432887_-	hypothetical protein	NA	NA	NA	NA
WP_007972882.1\|1432883_1433333_-	hypothetical protein	NA	NA	NA	NA
WP_042805805.1\|1433329_1434016_-	phage antirepressor KilAC domain-containing protein	A0A1B0YZY9	Pseudomonas_phage	2.6e-26	38.7
WP_162269133.1\|1434054_1434207_-	hypothetical protein	NA	NA	NA	NA
WP_007972878.1\|1434305_1434755_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_042805804.1\|1434760_1434982_-	hypothetical protein	NA	NA	NA	NA
WP_088409298.1\|1436289_1436604_-	hypothetical protein	NA	NA	NA	NA
WP_088409299.1\|1436607_1436898_-	hypothetical protein	NA	NA	NA	NA
WP_131454203.1\|1437082_1437466_-	hypothetical protein	NA	NA	NA	NA
WP_088409300.1\|1437556_1437799_-	hypothetical protein	NA	NA	NA	NA
WP_042805628.1\|1437801_1438479_-	helix-turn-helix transcriptional regulator	E5AGE6	Erwinia_phage	1.3e-17	29.5
WP_007972180.1\|1438560_1438869_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_042805627.1\|1439093_1439432_+	hypothetical protein	NA	NA	NA	NA
WP_042805626.1\|1439428_1439623_+	hypothetical protein	NA	NA	NA	NA
WP_042805625.1\|1440174_1440474_+	hypothetical protein	NA	NA	NA	NA
WP_100084206.1\|1440470_1441820_+	AAA family ATPase	O80281	Escherichia_phage	1.5e-49	32.5
WP_088370866.1\|1441809_1442217_+	hypothetical protein	NA	NA	NA	NA
WP_042805623.1\|1442213_1442732_+	hypothetical protein	NA	NA	NA	NA
WP_007972174.1\|1442814_1443120_-	putative addiction module antidote protein	NA	NA	NA	NA
WP_042805622.1\|1443152_1443443_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	1.3e-19	50.5
WP_007972171.1\|1444190_1444847_+	glycoside hydrolase family 19 protein	A0A1B0Z086	Pseudomonas_phage	4.9e-38	45.4
WP_007972169.1\|1444843_1445347_+	hypothetical protein	Q2NPA5	Xanthomonas_phage	2.1e-20	40.0
WP_042805621.1\|1445343_1445562_+	hypothetical protein	NA	NA	NA	NA
WP_007972167.1\|1445720_1446317_+	hypothetical protein	NA	NA	NA	NA
WP_100084205.1\|1446244_1447654_+	SGNH/GDSL hydrolase family protein	Q52PM7	Xanthomonas_phage	4.7e-62	38.5
WP_131438860.1\|1447671_1447965_+	hypothetical protein	NA	NA	NA	NA
WP_162045088.1\|1447967_1448132_+	hypothetical protein	NA	NA	NA	NA
WP_042805619.1\|1448128_1448335_+	hypothetical protein	A0A1V0E8A3	Vibrio_phage	2.4e-07	45.9
WP_162829049.1\|1448331_1448478_+	hypothetical protein	NA	NA	NA	NA
WP_007972163.1\|1448477_1448906_+	HNH endonuclease	NA	NA	NA	NA
WP_042805618.1\|1449003_1449384_+	hypothetical protein	A0A0U4JIP6	Pseudomonas_phage	9.4e-34	57.1
WP_088409301.1\|1449386_1451063_+\|terminase	terminase large subunit	A0A0U4B0C7	Pseudomonas_phage	3.2e-235	71.3
WP_173362039.1\|1451062_1452385_+\|portal	phage portal protein	C7BGG8	Burkholderia_phage	1.3e-61	37.6
WP_042805615.1\|1452350_1453088_+\|protease	Clp protease ClpP	C7BGG9	Burkholderia_phage	2.4e-49	52.8
WP_088409302.1\|1453155_1454400_+\|capsid	phage major capsid protein	C7BGH0	Burkholderia_phage	6.1e-82	42.4
WP_088409303.1\|1454460_1454961_+	hypothetical protein	NA	NA	NA	NA
WP_007972155.1\|1454964_1455384_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_042805612.1\|1455380_1455731_+\|head	phage head closure protein	Q7Y5K6	Xanthomonas_virus	2.3e-10	37.0
WP_100084204.1\|1455723_1456185_+	HK97 gp10 family phage protein	I7GSL4	Xanthomonas_virus	5.9e-22	43.4
WP_007972148.1\|1456181_1456535_+	DUF3168 domain-containing protein	C4ML11	Xanthomonas_virus	1.2e-11	35.3
WP_007972147.1\|1456544_1457045_+	HNH endonuclease	A5H1K2	Xanthomonas_virus	9.5e-26	42.1
WP_042805631.1\|1457159_1457804_+\|tail	phage tail protein	A0A0H5BBY3	Pseudomonas_phage	4.8e-62	58.4
WP_007972145.1\|1457800_1458103_+	hypothetical protein	NA	NA	NA	NA
WP_050780443.1\|1458150_1458411_+	DUF1799 domain-containing protein	I6PD79	Cronobacter_phage	2.1e-08	39.7
WP_007972144.1\|1458407_1461275_+\|tail	phage tail tape measure protein	A5H1M1	Xanthomonas_virus	4.7e-77	29.1
WP_157883153.1\|1461271_1461631_+	hypothetical protein	A5H1M2	Xanthomonas_virus	3.1e-18	41.5
WP_007972143.1\|1461627_1462095_+	DUF1833 family protein	Q52PL0	Xanthomonas_phage	6.8e-34	45.8
WP_007972142.1\|1462094_1462487_+	hypothetical protein	Q2NPH1	Xanthomonas_virus	2.4e-32	52.8
WP_042805609.1\|1462477_1466875_+	hypothetical protein	C4ML20	Xanthomonas_virus	0.0e+00	50.6
WP_007972140.1\|1466871_1467183_+	hypothetical protein	NA	NA	NA	NA
WP_007972139.1\|1467182_1467860_+	hypothetical protein	NA	NA	NA	NA
WP_088370865.1\|1467861_1468512_+	hypothetical protein	NA	NA	NA	NA
WP_088370864.1\|1468587_1468944_+	hypothetical protein	NA	NA	NA	NA
WP_157883154.1\|1469067_1469856_+	hypothetical protein	NA	NA	NA	NA
1469869:1469928	attL	NA	NA	NA	NA
WP_007969091.1\|1469960_1470923_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_088370863.1\|1470952_1471162_+	hypothetical protein	NA	NA	NA	NA
WP_131470017.1\|1471145_1471550_+	hypothetical protein	NA	NA	NA	NA
WP_007969091.1\|1471540_1472503_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_088370836.1\|1472770_1473857_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_088370758.1\|1473891_1474731_-	DUF4102 domain-containing protein	NA	NA	NA	NA
WP_042805040.1\|1475081_1476272_+\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	1.2e-119	57.2
WP_007969091.1\|1476753_1477716_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007962146.1\|1478135_1479116_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_042805820.1\|1479298_1479580_-	hypothetical protein	NA	NA	NA	NA
WP_033481013.1\|1480114_1481398_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_042805821.1\|1481394_1481637_+	hypothetical protein	NA	NA	NA	NA
WP_007972943.1\|1481630_1482011_-	response regulator	NA	NA	NA	NA
WP_007972946.1\|1482220_1485763_+	PAS domain-containing protein	NA	NA	NA	NA
WP_007965129.1\|1486214_1486787_+	hypothetical protein	NA	NA	NA	NA
WP_007972948.1\|1486925_1487264_-	hypothetical protein	NA	NA	NA	NA
WP_022560071.1\|1487346_1488246_-	manganese catalase family protein	NA	NA	NA	NA
WP_007972952.1\|1488384_1488891_-	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_022560070.1\|1489373_1489568_+	hypothetical protein	NA	NA	NA	NA
WP_007972955.1\|1489883_1491098_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_042805824.1\|1491405_1492719_+	histidine kinase	Q9EYF3	Enterobacteria_phage	4.4e-22	32.5
WP_007965134.1\|1492715_1493492_+	response regulator transcription factor	NA	NA	NA	NA
WP_007972959.1\|1493669_1494041_+	hypothetical protein	NA	NA	NA	NA
WP_007972960.1\|1494349_1495945_+	APC family permease	NA	NA	NA	NA
WP_080720651.1\|1496114_1496804_-	hypothetical protein	NA	NA	NA	NA
WP_007972962.1\|1497268_1498195_+	DUF2236 domain-containing protein	NA	NA	NA	NA
WP_042805825.1\|1498395_1500465_-	M13 family metallopeptidase	A0A1V0SHG2	Klosneuvirus	1.3e-65	25.7
WP_007972964.1\|1500613_1501309_-	glycosyltransferase	NA	NA	NA	NA
WP_007972965.1\|1501680_1502676_-	aldo/keto reductase	NA	NA	NA	NA
WP_007972966.1\|1502816_1503386_-	flavodoxin family protein	NA	NA	NA	NA
WP_007965151.1\|1503682_1504579_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_007965152.1\|1504685_1505096_+	DoxX family protein	NA	NA	NA	NA
WP_007972967.1\|1505125_1505944_+	dioxygenase	NA	NA	NA	NA
WP_003489593.1\|1506151_1507396_+	putative DNA modification/repair radical SAM protein	NA	NA	NA	NA
WP_007972968.1\|1507686_1509123_+	UdgX family uracil-DNA binding protein	NA	NA	NA	NA
WP_007969091.1\|1509218_1510181_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
1509127:1510201	attR	NA	NA	NA	NA

DBSCAN-SWA_7

1530651 : 1588980

Ralstonia_phage(25.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007962146.1\|1530651_1531632_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_007972669.1\|1531752_1532532_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_042805752.1\|1532833_1533049_+	hypothetical protein	NA	NA	NA	NA
WP_007972665.1\|1533467_1534844_+	D-serine/D-alanine/glycine transporter	NA	NA	NA	NA
WP_007975311.1\|1535504_1536485_-\|transposase	IS5-like element ISXfu2 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.5
WP_042805751.1\|1537341_1538244_+	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_040965500.1\|1538558_1539257_-	AIM24 family protein	NA	NA	NA	NA
WP_088409307.1\|1539681_1541355_-	alpha,alpha-trehalase TreA	NA	NA	NA	NA
WP_007969374.1\|1541627_1542398_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_173362017.1\|1544944_1545850_+	hypothetical protein	NA	NA	NA	NA
WP_007975178.1\|1546312_1547257_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_003489747.1\|1547394_1548324_-	GAF domain-containing protein	NA	NA	NA	NA
WP_007969725.1\|1548884_1551764_-	insulinase family protein	NA	NA	NA	NA
WP_042805164.1\|1551867_1554609_+	PAS domain S-box protein	G3MA91	Bacillus_virus	3.6e-10	29.2
WP_088370744.1\|1554691_1555779_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007975511.1\|1555984_1556965_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.3e-98	61.0
WP_042675720.1\|1557721_1559908_-	cache domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	3.4e-11	65.7
WP_007973696.1\|1561557_1563045_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	1.7e-126	57.1
WP_042675723.1\|1563449_1564430_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.4e-17	39.2
WP_007973693.1\|1564614_1566264_+	M28 family peptidase	NA	NA	NA	NA
WP_007973691.1\|1567331_1569269_+	glucans biosynthesis glucosyltransferase MdoH	NA	NA	NA	NA
WP_007973690.1\|1569429_1570098_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_007965004.1\|1570102_1571155_+	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	1.1e-18	33.5
WP_007965008.1\|1571185_1571923_+	response regulator transcription factor	NA	NA	NA	NA
WP_007973688.1\|1571953_1572868_+	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_088409308.1\|1573422_1574223_-	DUF481 domain-containing protein	NA	NA	NA	NA
WP_005916857.1\|1574771_1575737_+	YafY family transcriptional regulator	NA	NA	NA	NA
WP_003482775.1\|1575846_1576416_-	lipocalin family protein	NA	NA	NA	NA
WP_007965016.1\|1576790_1577102_+	hypothetical protein	NA	NA	NA	NA
WP_007973684.1\|1577169_1579263_+	S9 family peptidase	NA	NA	NA	NA
WP_007973682.1\|1579653_1580838_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_042805972.1\|1580947_1583083_+	oligopeptidase B	F2Y2Z7	Organic_Lake_phycodnavirus	1.8e-28	25.1
WP_003482768.1\|1583444_1583843_+	YbaN family protein	NA	NA	NA	NA
WP_022558202.1\|1583899_1584154_+	lipoprotein	NA	NA	NA	NA
WP_007973677.1\|1584143_1584998_+	diaminopimelate epimerase	NA	NA	NA	NA
WP_007973676.1\|1584994_1585666_+	DUF484 family protein	NA	NA	NA	NA
WP_007965029.1\|1585846_1586764_+	tyrosine recombinase XerC	S5M872	Bacillus_phage	1.0e-12	26.8
WP_003482763.1\|1586960_1587512_+\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_007973673.1\|1587612_1588980_+\|protease	ATP-dependent protease ATPase subunit HslU	A0A2H5BJT2	Erwinia_phage	8.1e-43	29.7

DBSCAN-SWA_8

1673857 : 1735094

Leptospira_phage(20.0%)

holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088370746.1\|1673857_1674944_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007974058.1\|1677472_1679869_+	alpha-N-acetylglucosaminidase	NA	NA	NA	NA
WP_007974059.1\|1679984_1681151_+	DUF1624 domain-containing protein	NA	NA	NA	NA
WP_005925199.1\|1681407_1682130_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_007974063.1\|1682173_1683451_+	sugar MFS transporter	NA	NA	NA	NA
WP_003482633.1\|1683491_1684559_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_007974064.1\|1684565_1685594_+	SIS domain-containing protein	NA	NA	NA	NA
WP_007974066.1\|1685596_1686751_+	N-acetylglucosamine-6-phosphate deacetylase	NA	NA	NA	NA
WP_123766542.1\|1687355_1687559_-	hypothetical protein	NA	NA	NA	NA
WP_007974068.1\|1687674_1690344_+	TonB-dependent receptor	NA	NA	NA	NA
WP_007968611.1\|1690505_1691738_-	multifunctional CCA addition/repair protein	K4IEX3	Salmonella_phage	2.1e-74	42.9
WP_088370744.1\|1692207_1693294_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007968614.1\|1694898_1696371_-	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_007974073.1\|1696411_1698391_-\|holin	choline BCCT transporter BetT	A0A2I7QNT1	Vibrio_phage	4.5e-18	25.8
WP_005911045.1\|1698672_1699410_-	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_007968619.1\|1699459_1700275_-	thiol:disulfide interchange protein DsbA/DsbL	NA	NA	NA	NA
WP_007974075.1\|1700366_1701017_-	thiol:disulfide interchange protein DsbA/DsbL	NA	NA	NA	NA
WP_007968623.1\|1701111_1701909_-	cytochrome c4	NA	NA	NA	NA
WP_003482606.1\|1702052_1702697_+	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_042806044.1\|1702951_1703932_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_042676238.1\|1704036_1704873_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_082336548.1\|1705157_1706522_+	glutamate--cysteine ligase	NA	NA	NA	NA
WP_042676239.1\|1706709_1708212_-	HAMP domain-containing protein	W8CYF6	Bacillus_phage	8.7e-14	24.4
WP_003482593.1\|1708208_1708988_-	response regulator transcription factor	NA	NA	NA	NA
WP_007968638.1\|1709065_1710166_+	glycosyltransferase	A0A142BZU7	Faustovirus	5.2e-16	29.8
WP_088409315.1\|1710604_1710973_+	hypothetical protein	NA	NA	NA	NA
WP_005911021.1\|1711297_1711573_+	metal/formaldehyde-sensitive transcriptional repressor	NA	NA	NA	NA
WP_007974085.1\|1711640_1712750_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	3.8e-35	30.4
WP_007968641.1\|1712818_1713394_+	S-(hydroxymethyl)glutathione synthase	NA	NA	NA	NA
WP_007974087.1\|1713452_1714283_+	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_082336549.1\|1714332_1714626_+	hypothetical protein	NA	NA	NA	NA
WP_007974089.1\|1714823_1716224_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_007974092.1\|1716350_1717142_+	PhzF family phenazine biosynthesis protein	NA	NA	NA	NA
WP_007968645.1\|1717138_1718050_+	DMT family transporter	NA	NA	NA	NA
WP_007974093.1\|1718085_1718424_-	hypothetical protein	NA	NA	NA	NA
WP_005910999.1\|1718632_1720294_-	energy-dependent translational throttle protein EttA	A0A1B0RXA0	Streptococcus_phage	5.4e-41	28.8
WP_007974095.1\|1720519_1721017_+	RcnB family protein	NA	NA	NA	NA
WP_007974096.1\|1721215_1722469_+	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	4.6e-101	54.4
WP_003490311.1\|1722585_1723110_+	transcriptional repressor NrdR	NA	NA	NA	NA
WP_007974097.1\|1723106_1723592_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_007974099.1\|1723588_1724698_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	3.4e-47	36.2
WP_007974101.1\|1724795_1725419_-	hypothetical protein	NA	NA	NA	NA
WP_007974104.1\|1725984_1726587_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	2.1e-27	39.2
WP_088409316.1\|1726583_1727723_+	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	3.9e-51	34.3
WP_003490334.1\|1728062_1728527_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.7e-24	40.9
WP_007968663.1\|1728523_1728994_+	transcription antitermination factor NusB	NA	NA	NA	NA
WP_007974108.1\|1729216_1730191_+	thiamine-phosphate kinase	NA	NA	NA	NA
WP_098477673.1\|1730778_1731881_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6
WP_007962146.1\|1732612_1733593_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_007969091.1\|1734131_1735094_-\|transposase	IS1595 family transposase	NA	NA	NA	NA

DBSCAN-SWA_9

2034508 : 2099804

Leptospira_phage(23.08%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088370744.1\|2034508_2035596_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_042805420.1\|2036169_2036967_+	avirulence protein	NA	NA	NA	NA
WP_007970917.1\|2038027_2041183_+	TonB-dependent receptor	NA	NA	NA	NA
WP_007970916.1\|2041504_2042263_+	SapC family protein	NA	NA	NA	NA
WP_007970915.1\|2042267_2043314_+	cupin-like domain-containing protein	NA	NA	NA	NA
WP_007970913.1\|2043354_2044872_+	tryptophan 7-halogenase	A0A1D7SEI2	Cyanophage	4.3e-53	32.1
WP_007970911.1\|2045092_2046100_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_007970909.1\|2046236_2046635_-	hypothetical protein	NA	NA	NA	NA
WP_088409339.1\|2049389_2050466_+	lipase	NA	NA	NA	NA
WP_007969091.1\|2050616_2051579_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007969911.1\|2051896_2053279_-	APC family permease	NA	NA	NA	NA
WP_007969910.1\|2053472_2054237_+	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_042675204.1\|2054307_2054547_+	hypothetical protein	NA	NA	NA	NA
WP_007969908.1\|2054620_2055562_+	proline iminopeptidase-family hydrolase	NA	NA	NA	NA
WP_088409340.1\|2056360_2057416_+	pectate lyase	A0A140XB77	Dickeya_phage	3.2e-23	47.4
WP_007971732.1\|2057825_2059214_+	amino acid permease	NA	NA	NA	NA
WP_007971730.1\|2059798_2061028_+	dipeptidase	NA	NA	NA	NA
WP_007971728.1\|2061369_2062767_+	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_042805542.1\|2062766_2063783_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_022558831.1\|2063817_2064615_-	prolyl oligopeptidase family serine peptidase	NA	NA	NA	NA
WP_003487859.1\|2064756_2066118_-	magnesium transporter	NA	NA	NA	NA
WP_007971726.1\|2066532_2068263_-	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	8.7e-10	23.4
WP_005913389.1\|2068321_2068591_-	HPr family phosphocarrier protein	NA	NA	NA	NA
WP_003487850.1\|2068583_2068976_-	PTS fructose IIA component family protein	NA	NA	NA	NA
WP_007971724.1\|2069496_2070369_-	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	4.5e-07	30.5
WP_003487845.1\|2070365_2071316_-	HPr kinase/phosphorylase	NA	NA	NA	NA
WP_007964339.1\|2071312_2071771_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_005913379.1\|2071792_2072110_-	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_088409341.1\|2072197_2073637_-	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_007964348.1\|2073677_2074397_-	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-26	33.8
WP_022558839.1\|2074396_2074957_-	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_003487834.1\|2074934_2075510_-	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_007971718.1\|2075506_2076055_-	HAD hydrolase family protein	NA	NA	NA	NA
WP_007964354.1\|2076103_2077105_-	KpsF/GutQ family sugar-phosphate isomerase	E3T535	Cafeteria_roenbergensis_virus	1.9e-12	24.9
WP_005913369.1\|2077158_2077386_+	BolA/IbaG family iron-sulfur metabolism protein	NA	NA	NA	NA
WP_007964357.1\|2077629_2078904_+	UDP-N-acetylglucosamine 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_007964359.1\|2078900_2079230_+	hypothetical protein	NA	NA	NA	NA
WP_042675742.1\|2079438_2080122_-	DUF3108 domain-containing protein	NA	NA	NA	NA
WP_042805362.1\|2080125_2080953_-	DUF3108 domain-containing protein	NA	NA	NA	NA
WP_007966107.1\|2081019_2081688_-	phosphoribosylglycinamide formyltransferase	E3SNR5	Prochlorococcus_phage	1.8e-19	36.2
WP_007970594.1\|2081711_2082170_-	hypothetical protein	NA	NA	NA	NA
WP_007966111.1\|2082187_2083213_-	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	2.1e-72	43.8
WP_007970596.1\|2083341_2084454_+	DUF2066 domain-containing protein	NA	NA	NA	NA
WP_007966114.1\|2084450_2085617_+	AI-2E family transporter	NA	NA	NA	NA
WP_007970599.1\|2085613_2086315_+	DnaA regulatory inactivator Hda	NA	NA	NA	NA
WP_088370746.1\|2086552_2087639_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007966117.1\|2088213_2088924_-	nucleotidyltransferase family protein	A0A1D7XFC1	Escherichia_phage	9.7e-08	33.0
WP_007966119.1\|2088920_2089940_-	phosphotransferase	NA	NA	NA	NA
WP_042675747.1\|2089997_2090270_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_007966124.1\|2090778_2092272_-	M20 family metallopeptidase	NA	NA	NA	NA
WP_007966126.1\|2092397_2092805_+	helix-hairpin-helix domain-containing protein	NA	NA	NA	NA
WP_088409342.1\|2093229_2094087_+	HutD family protein	NA	NA	NA	NA
WP_088370744.1\|2094519_2095607_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_088409343.1\|2097149_2098112_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007975311.1\|2098823_2099804_-\|transposase	IS5-like element ISXfu2 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.5

DBSCAN-SWA_10

2172127 : 2231706

Pseudomonas_phage(37.5%)

transposase,tail,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_050780463.1\|2172127_2172535_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_007974410.1\|2172534_2176206_-	putative Ig domain-containing protein	A0A0A1IX03	Pseudomonas_phage	2.4e-86	27.9
WP_042806161.1\|2176195_2176429_-	hypothetical protein	A0A0A1IV01	Pseudomonas_phage	2.4e-16	62.1
WP_007974412.1\|2176425_2176854_-	hypothetical protein	NA	NA	NA	NA
WP_007974415.1\|2176844_2177936_-	DUF2163 domain-containing protein	NA	NA	NA	NA
WP_131438905.1\|2177928_2179128_-	hypothetical protein	B7SE08	Pseudomonas_virus	2.3e-78	42.2
WP_050780464.1\|2179131_2181906_-\|tail	phage tail length tape measure family protein	A0A2H4J7J3	uncultured_Caudovirales_phage	1.5e-43	25.7
WP_007974420.1\|2182079_2182595_-	hypothetical protein	A0A0S4L2X3	Pseudomonas_phage	1.4e-24	46.6
WP_088409352.1\|2182594_2183353_-	hypothetical protein	Q5ZQX2	Pseudomonas_phage	3.4e-43	37.2
WP_042806163.1\|2183349_2183535_-	hypothetical protein	NA	NA	NA	NA
WP_088409353.1\|2183531_2184008_-	hypothetical protein	A0A0S4L2X9	Pseudomonas_phage	2.6e-33	48.4
WP_007974425.1\|2184004_2184478_-	DUF1320 domain-containing protein	J9SNI4	Pseudomonas_phage	1.8e-34	50.0
WP_088370746.1\|2184544_2185632_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007967299.1\|2186196_2186625_-	Rnf electron transport complex subunit RnfB	NA	NA	NA	NA
WP_007971195.1\|2186626_2187217_-	HAD family hydrolase	NA	NA	NA	NA
WP_007971192.1\|2187663_2189748_-\|tRNA	methionine--tRNA ligase	NA	NA	NA	NA
WP_003485424.1\|2189997_2190447_-	DUF2147 domain-containing protein	NA	NA	NA	NA
WP_007971190.1\|2190678_2194275_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_005924907.1\|2194287_2195181_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	5.1e-22	31.1
WP_022559734.1\|2195319_2195709_-	VOC family protein	NA	NA	NA	NA
WP_007971187.1\|2196056_2197454_+	S-methylmethionine permease	NA	NA	NA	NA
WP_007971186.1\|2197450_2198416_+	homocysteine S-methyltransferase	NA	NA	NA	NA
WP_088409354.1\|2198604_2200488_-	DUF885 family protein	NA	NA	NA	NA
WP_007965588.1\|2200762_2201539_-	queuosine precursor transporter	NA	NA	NA	NA
WP_042805466.1\|2201543_2202218_-	DUF502 domain-containing protein	A0A2I7S9X1	Vibrio_phage	4.9e-09	28.3
WP_088409355.1\|2202642_2204004_+	hypothetical protein	NA	NA	NA	NA
WP_088370746.1\|2204472_2205560_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_088409356.1\|2205644_2207207_-	alginate export family protein	NA	NA	NA	NA
WP_007965592.1\|2207587_2207950_+	PadR family transcriptional regulator	NA	NA	NA	NA
WP_088409357.1\|2207946_2208876_+	sensor domain-containing protein	NA	NA	NA	NA
WP_007973091.1\|2209004_2210348_-	polyhydroxyalkanoate depolymerase	NA	NA	NA	NA
WP_007973092.1\|2210650_2211253_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_007965599.1\|2211326_2211773_+	CopD family protein	NA	NA	NA	NA
WP_007973094.1\|2212389_2213268_-	type III secretion system effector protein	NA	NA	NA	NA
WP_007966722.1\|2213621_2214686_-	hypothetical protein	NA	NA	NA	NA
WP_046932707.1\|2214754_2215042_+	hypothetical protein	NA	NA	NA	NA
WP_007966720.1\|2215310_2216846_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	4.4e-98	41.6
WP_007973097.1\|2216861_2217683_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	7.7e-65	51.2
WP_005924942.1\|2218190_2219150_-	acetyl-CoA carboxylase carboxyltransferase subunit alpha	NA	NA	NA	NA
WP_007973101.1\|2219326_2222917_-	DNA polymerase III subunit alpha	A0A291AVA6	Streptomyces_phage	3.4e-181	36.3
WP_007965609.1\|2223183_2223930_-	ribonuclease HII	G9E3X7	Emiliania_huxleyi_virus	3.5e-24	36.9
WP_007965611.1\|2223926_2225231_-	lipid-A-disaccharide synthase	NA	NA	NA	NA
WP_003485381.1\|2225227_2226019_-	acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase	NA	NA	NA	NA
WP_003485378.1\|2226044_2226503_-	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_007965614.1\|2226499_2227513_-	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
WP_005911715.1\|2227641_2227833_+	hypothetical protein	NA	NA	NA	NA
WP_007973104.1\|2227909_2230276_-	outer membrane protein assembly factor BamA	NA	NA	NA	NA
WP_007973106.1\|2230359_2231706_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA

DBSCAN-SWA_11

2241299 : 2300105

Ralstonia_phage(20.0%)

coat,transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022559712.1\|2241299_2242334_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_007973125.1\|2242330_2244682_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_007973127.1\|2244698_2245469_-	molecular chaperone	NA	NA	NA	NA
WP_008576696.1\|2245477_2246029_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_007962146.1\|2246226_2247207_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_007971765.1\|2247480_2248257_+	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_088409359.1\|2248253_2250863_+	[protein-PII] uridylyltransferase	NA	NA	NA	NA
WP_007971767.1\|2250885_2252088_+	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
WP_007966645.1\|2252277_2252634_+	arsenate reductase	NA	NA	NA	NA
WP_007971770.1\|2252880_2254011_+	succinyl-diaminopimelate desuccinylase	NA	NA	NA	NA
WP_007971771.1\|2254303_2255998_+	asparagine synthase B	A0A0P0C1V4	Ostreococcus_lucimarinus_virus	2.7e-88	39.1
WP_033481302.1\|2256065_2257118_-	right-handed parallel beta-helix repeat-containing protein	NA	NA	NA	NA
WP_007971775.1\|2257562_2259701_-	TonB-dependent receptor	NA	NA	NA	NA
WP_162269137.1\|2260127_2262545_-	penicillin acylase family protein	NA	NA	NA	NA
WP_087945314.1\|2262641_2263178_+	bacterioferritin	NA	NA	NA	NA
WP_007971781.1\|2263444_2264101_-	thiopurine S-methyltransferase	NA	NA	NA	NA
WP_007971783.1\|2264530_2266774_-	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	1.0e-82	35.0
WP_007966661.1\|2266835_2267687_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_014089765.1\|2267809_2268250_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_173362037.1\|2268291_2269764_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_007966664.1\|2269774_2270968_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_007966665.1\|2270974_2272555_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_088409617.1\|2272996_2275186_-	glycoside hydrolase family 3 protein	NA	NA	NA	NA
WP_007971104.1\|2275363_2277133_-	M14 family metallopeptidase	NA	NA	NA	NA
WP_042805455.1\|2277496_2279062_+	MFS transporter	A0A0P0IY73	Acinetobacter_phage	1.8e-22	24.8
WP_007966672.1\|2279069_2279678_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_005911777.1\|2279984_2280173_-	hypothetical protein	NA	NA	NA	NA
WP_042675912.1\|2280399_2280669_+	N-acetyltransferase	NA	NA	NA	NA
WP_007966673.1\|2280720_2281566_+	DUF3298 and DUF4163 domain-containing protein	NA	NA	NA	NA
WP_007966674.1\|2281632_2282133_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_042805453.1\|2282365_2284564_-	dipeptidyl carboxypeptidase II	A0A1V0SID3	Klosneuvirus	2.8e-45	28.2
WP_088370746.1\|2285347_2286434_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007966679.1\|2286772_2287552_-	ferredoxin--NADP reductase	NA	NA	NA	NA
WP_007971094.1\|2287752_2289633_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.7e-25	38.5
WP_007962146.1\|2289755_2290736_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_088370746.1\|2290825_2291912_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007969635.1\|2292128_2293646_+	fumarate hydratase	NA	NA	NA	NA
WP_173362020.1\|2294707_2295346_+	carbonic anhydrase	NA	NA	NA	NA
WP_088409361.1\|2295700_2296834_-	phospholipase A	NA	NA	NA	NA
WP_007972080.1\|2297092_2297578_-	DUF456 domain-containing protein	NA	NA	NA	NA
WP_003483561.1\|2297805_2298021_+	cold-shock protein	A0A1X9IGI9	Lactococcus_phage	5.0e-16	59.7
WP_007966687.1\|2298159_2298639_-	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
WP_007966688.1\|2298771_2299200_-	hypothetical protein	NA	NA	NA	NA
WP_007972081.1\|2299274_2300105_+\|tRNA	tRNA threonylcarbamoyladenosine dehydratase	NA	NA	NA	NA

DBSCAN-SWA_12

2534976 : 2574106

Ralstonia_phage(42.86%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007962146.1\|2534976_2535957_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_003488133.1\|2536159_2536384_-	putative selenoprotein	NA	NA	NA	NA
WP_088409380.1\|2536383_2538456_-	carbon starvation protein A	NA	NA	NA	NA
WP_007963825.1\|2538687_2539545_+	pirin family protein	NA	NA	NA	NA
WP_007963827.1\|2539576_2540011_+	OsmC family protein	NA	NA	NA	NA
WP_007963829.1\|2540418_2540880_-	hypothetical protein	NA	NA	NA	NA
WP_007963831.1\|2541127_2542018_-	pirin family protein	NA	NA	NA	NA
WP_007963834.1\|2542762_2543143_+	hypothetical protein	NA	NA	NA	NA
WP_007962146.1\|2543218_2544199_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_007963836.1\|2544374_2545088_-	deoxyribonuclease V	NA	NA	NA	NA
WP_007971667.1\|2545191_2545941_+	2,3-diphosphoglycerate-dependent phosphoglycerate mutase	NA	NA	NA	NA
WP_007963839.1\|2546084_2546399_+	hypothetical protein	NA	NA	NA	NA
WP_007971665.1\|2546672_2548775_+	M13 family metallopeptidase	E3T4I7	Cafeteria_roenbergensis_virus	1.5e-83	31.9
WP_088370744.1\|2549068_2550156_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_088409381.1\|2550207_2551536_+	phospholipase D family protein	NA	NA	NA	NA
WP_088409382.1\|2551792_2552920_-	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
WP_003488107.1\|2552916_2553723_-	protein-glutamate O-methyltransferase CheR	NA	NA	NA	NA
WP_007971661.1\|2553727_2555011_-	EAL domain-containing response regulator	NA	NA	NA	NA
WP_005913227.1\|2555037_2555553_-	purine-binding chemotaxis protein CheW	NA	NA	NA	NA
WP_007971660.1\|2555563_2557720_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.9e-10	62.1
WP_007963855.1\|2557786_2559796_-	chemotaxis protein CheA	NA	NA	NA	NA
WP_003488096.1\|2559814_2560144_-	STAS domain-containing protein	NA	NA	NA	NA
WP_007971658.1\|2561064_2561391_+	hypothetical protein	NA	NA	NA	NA
WP_007969091.1\|2562737_2563700_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_088409383.1\|2565015_2566102_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	7.6e-44	37.2
WP_007969713.1\|2566899_2570364_-	transcription-repair coupling factor	NA	NA	NA	NA
WP_003488532.1\|2571009_2571552_-	N-acetyltransferase	NA	NA	NA	NA
WP_172955843.1\|2571942_2572893_-	23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ	NA	NA	NA	NA
WP_007962146.1\|2573125_2574106_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6

DBSCAN-SWA_13

2722962 : 2797938

Leptospira_phage(27.27%)

transposase,tRNA,integrase

attL 2769071:2769130|attR 2779698:2780867

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007972426.1\|2722962_2724357_-\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	1.4e-79	38.1
WP_007966300.1\|2724561_2724900_+	iron-sulfur cluster assembly accessory protein	NA	NA	NA	NA
WP_003485869.1\|2725302_2725734_+	30S ribosomal protein S6	NA	NA	NA	NA
WP_002804494.1\|2725745_2725976_+	30S ribosomal protein S18	NA	NA	NA	NA
WP_007966301.1\|2726223_2726673_+	50S ribosomal protein L9	NA	NA	NA	NA
WP_007972428.1\|2726822_2727788_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_088409621.1\|2727971_2731475_+	chromosome segregation protein SMC	NA	NA	NA	NA
WP_005914888.1\|2731531_2732263_+	cell division protein ZipA	NA	NA	NA	NA
WP_042805701.1\|2732269_2732653_+	hypothetical protein	NA	NA	NA	NA
WP_007972432.1\|2732800_2733922_-	pyridoxal phosphate-dependent aminotransferase	A0A1X6WGT4	Pacmanvirus	4.5e-07	24.4
WP_007972434.1\|2734265_2736767_+	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	7.4e-119	40.1
WP_007972436.1\|2736763_2737726_+	EF-P lysine aminoacylase GenX	A0A1V0SAC0	Catovirus	2.8e-18	26.2
WP_007966318.1\|2737834_2738521_+	DUF3011 domain-containing protein	NA	NA	NA	NA
WP_007972437.1\|2738713_2739778_+	S-methyl-5-thioribose-1-phosphate isomerase	NA	NA	NA	NA
WP_007966320.1\|2739987_2742687_+	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	4.4e-109	34.4
WP_042675792.1\|2742913_2745382_+	membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family	NA	NA	NA	NA
WP_005914878.1\|2745805_2746534_-	hypothetical protein	NA	NA	NA	NA
WP_007972442.1\|2746794_2748462_-	urocanate hydratase	NA	NA	NA	NA
WP_007966323.1\|2748478_2749336_-	N-formylglutamate deformylase	NA	NA	NA	NA
WP_007972444.1\|2749517_2751059_-	histidine ammonia-lyase	A0A1V0S940	Catovirus	1.8e-78	41.1
WP_007972446.1\|2751072_2752278_-	imidazolonepropionase	NA	NA	NA	NA
WP_042805703.1\|2752338_2753709_+	formimidoylglutamate deiminase	NA	NA	NA	NA
WP_007972450.1\|2754024_2754762_+	histidine utilization repressor	NA	NA	NA	NA
WP_033481359.1\|2754945_2755944_-	restriction endonuclease	NA	NA	NA	NA
WP_007972454.1\|2756495_2757053_-	phasin family protein	NA	NA	NA	NA
WP_008576246.1\|2757215_2757491_-	polyhydroxyalkanoic acid system family protein	NA	NA	NA	NA
WP_022559593.1\|2757727_2758537_+	FHA domain-containing protein	NA	NA	NA	NA
WP_007972456.1\|2758478_2759135_-	protein-methionine-sulfoxide reductase heme-binding subunit MsrQ	NA	NA	NA	NA
WP_007969340.1\|2759259_2760228_-	protein-methionine-sulfoxide reductase catalytic subunit MsrP	NA	NA	NA	NA
WP_007969337.1\|2760405_2761491_+	phosphoserine transaminase	M1Q1P2	Streptococcus_phage	2.2e-75	43.3
WP_007969335.1\|2761575_2762784_+	prephenate dehydratase	NA	NA	NA	NA
WP_007969333.1\|2762906_2764229_+	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_088409622.1\|2764553_2765021_-	energy transducer TonB	NA	NA	NA	NA
WP_042805225.1\|2765377_2766040_-	energy transducer TonB	NA	NA	NA	NA
WP_007969978.1\|2766151_2767432_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	7.4e-99	55.4
2769071:2769130	attL	NA	NA	NA	NA
WP_088370746.1\|2769114_2770201_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007969395.1\|2770796_2771813_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_162269138.1\|2772343_2773822_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_007969091.1\|2774617_2775580_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_131469963.1\|2775794_2775989_-	hypothetical protein	NA	NA	NA	NA
WP_088409397.1\|2776523_2777387_-	hypothetical protein	NA	NA	NA	NA
WP_088370746.1\|2778625_2779713_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007970178.1\|2779787_2780261_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_007970176.1\|2780257_2780914_+	hydrolase	NA	NA	NA	NA
2779698:2780867	attR	NA	NA	NA	NA
WP_088409398.1\|2780950_2781334_+	DoxX family protein	NA	NA	NA	NA
WP_007970171.1\|2781447_2783295_+	amidohydrolase	NA	NA	NA	NA
WP_088409399.1\|2783389_2785030_+	MFS transporter	NA	NA	NA	NA
WP_042805275.1\|2785035_2785266_+	DUF1427 family protein	NA	NA	NA	NA
WP_042674992.1\|2785262_2785421_+	XapX domain-containing protein	NA	NA	NA	NA
WP_007963473.1\|2785587_2786565_-	siroheme synthase	NA	NA	NA	NA
WP_005916070.1\|2788453_2788711_+	stress-induced protein	NA	NA	NA	NA
WP_088409400.1\|2789356_2789866_+	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_022559233.1\|2789968_2790889_+	M14 family metallocarboxypeptidase	NA	NA	NA	NA
WP_007963479.1\|2791291_2791990_+	DUF1349 domain-containing protein	NA	NA	NA	NA
WP_088409401.1\|2792114_2793926_-	phosphodiesterase	NA	NA	NA	NA
WP_088370746.1\|2794347_2795435_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007969091.1\|2796975_2797938_+\|transposase	IS1595 family transposase	NA	NA	NA	NA

DBSCAN-SWA_14

2823679 : 2876374

Xanthomonas_phage(52.38%)

transposase,integrase

attL 2841591:2841650|attR 2870757:2871915

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088409404.1\|2823679_2824767_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.8e-43	36.8
WP_007969966.1\|2826138_2827452_+	sorbosone dehydrogenase family protein	NA	NA	NA	NA
WP_088409405.1\|2827679_2828687_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_042805224.1\|2829003_2829282_-	hypothetical protein	NA	NA	NA	NA
WP_007969972.1\|2829420_2829843_-	DedA family protein	NA	NA	NA	NA
WP_157883174.1\|2830104_2830626_-	oxidoreductase	NA	NA	NA	NA
WP_088370784.1\|2830947_2831910_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_082336398.1\|2832731_2836880_+	PAS domain-containing protein	NA	NA	NA	NA
WP_007962306.1\|2837087_2837453_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_007962305.1\|2837430_2838084_-	phophatidylserine decarboxylase associated domain-containing protein	NA	NA	NA	NA
WP_007970204.1\|2838116_2838953_-	putative DNA-binding domain-containing protein	NA	NA	NA	NA
WP_007970203.1\|2839005_2839935_-	DUF692 domain-containing protein	NA	NA	NA	NA
2841591:2841650	attL	NA	NA	NA	NA
WP_007962146.1\|2841652_2842633_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_017158593.1\|2843432_2844377_-	AAA family ATPase	NA	NA	NA	NA
WP_007971045.1\|2844384_2845044_-	hypothetical protein	NA	NA	NA	NA
WP_017158592.1\|2845070_2846249_-	aminotransferase class III-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_007971047.1\|2846310_2847354_-	sulfotransferase family protein	NA	NA	NA	NA
WP_088409407.1\|2847346_2848192_-	TauD/TfdA family dioxygenase	NA	NA	NA	NA
WP_007969091.1\|2848310_2849273_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007971051.1\|2849460_2850735_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_007971053.1\|2850743_2853737_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.4e-87	27.9
WP_088409408.1\|2853858_2855136_+	lytic murein transglycosylase	NA	NA	NA	NA
WP_088370744.1\|2856477_2857564_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_088409409.1\|2857608_2857809_+	hypothetical protein	Q9XJ91	Xanthomonas_phage	1.4e-28	95.5
WP_022559204.1\|2857819_2858140_+	hypothetical protein	Q4LAU3	Stenotrophomonas_phage	3.5e-21	44.2
WP_088409410.1\|2858141_2859458_+	hypothetical protein	Q4LAU4	Stenotrophomonas_phage	7.6e-131	56.9
WP_088409411.1\|2859645_2859942_+	hypothetical protein	A0A1W6DXU7	Xanthomonas_phage	4.2e-13	44.8
WP_088409412.1\|2859996_2860392_+	DUF4124 domain-containing protein	A0A077JCA3	Xanthomonas_phage	5.9e-31	56.1
WP_157883158.1\|2860818_2861268_-	hypothetical protein	NA	NA	NA	NA
WP_157883159.1\|2861418_2861664_+	hypothetical protein	NA	NA	NA	NA
WP_162269128.1\|2861829_2861970_+	hypothetical protein	NA	NA	NA	NA
WP_173668627.1\|2861959_2862679_+	hypothetical protein	NA	NA	NA	NA
WP_011347636.1\|2863005_2863302_+	hypothetical protein	NA	NA	NA	NA
WP_042805193.1\|2863305_2863509_+	hypothetical protein	A0A1D6ZIU2	Xanthomonas_phage	4.8e-29	97.0
WP_042805195.1\|2863521_2863752_+	methyltransferase	A0A1W6DXZ2	Xanthomonas_phage	2.1e-28	94.7
WP_007969856.1\|2863889_2865323_+	hypothetical protein	A0A1D6ZIU5	Xanthomonas_phage	2.3e-173	76.9
WP_007970474.1\|2865322_2865652_+	DUF2523 domain-containing protein	A0A1D6ZIU0	Xanthomonas_phage	1.6e-53	95.4
WP_007969859.1\|2865651_2866845_+	hypothetical protein	A0A1W6DXR3	Xanthomonas_phage	1.5e-210	91.4
WP_007970477.1\|2866846_2867527_+	conjugal transfer protein TrbP	A0A1W6DY89	Xanthomonas_phage	1.6e-92	76.5
WP_007970491.1\|2867990_2868317_+	hypothetical protein	S0F2N2	Stenotrophomonas_phage	5.4e-14	38.2
WP_088370786.1\|2868383_2868695_+	chloride channel protein	A0A1W6DXV7	Xanthomonas_phage	1.4e-48	88.3
WP_131438840.1\|2868713_2869010_-	hypothetical protein	A0A1W6DXU7	Xanthomonas_phage	7.1e-13	44.8
WP_007962146.1\|2869773_2870754_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_088370746.1\|2871979_2873066_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
2870757:2871915	attR	NA	NA	NA	NA
WP_162045071.1\|2873478_2873619_-	hypothetical protein	NA	NA	NA	NA
WP_082336388.1\|2873615_2873801_-	hypothetical protein	NA	NA	NA	NA
WP_131438830.1\|2873784_2874027_-	hypothetical protein	NA	NA	NA	NA
WP_007969847.1\|2874166_2874568_+	hypothetical protein	NA	NA	NA	NA
WP_157883160.1\|2875272_2876374_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	41.2

DBSCAN-SWA_15

2879566 : 2937677

Leptospira_phage(35.0%)

transposase,integrase

attL 2871910:2871969|attR 2925318:2926514

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2871910:2871969	attL	NA	NA	NA	NA
WP_088370744.1\|2879566_2880654_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_157883161.1\|2881538_2882426_-\|integrase	integrase arm-type DNA-binding domain-containing protein	G9L697	Escherichia_phage	3.6e-76	50.9
WP_007969691.1\|2882732_2884298_-	glutamine-hydrolyzing GMP synthase	NA	NA	NA	NA
WP_007969694.1\|2884424_2885882_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	3.1e-85	38.9
WP_007969695.1\|2886062_2886974_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	2.3e-30	35.1
WP_007963232.1\|2887024_2887345_+	DUF1244 domain-containing protein	NA	NA	NA	NA
WP_088370746.1\|2887718_2888805_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007963234.1\|2889044_2890895_-	cation:proton antiporter	NA	NA	NA	NA
WP_007963236.1\|2891068_2891962_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	5.8e-66	49.1
WP_007970136.1\|2891961_2893869_-	polysaccharide biosynthesis protein	K7Y9E1	Megavirus	3.4e-23	25.2
WP_007970135.1\|2893882_2894851_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_003489647.1\|2894850_2896029_-	lipopolysaccharide assembly protein LapB	NA	NA	NA	NA
WP_042805267.1\|2896035_2896341_-	LapA family protein	NA	NA	NA	NA
WP_003489651.1\|2896407_2896719_-	integration host factor subunit beta	A7KV42	Bacillus_phage	1.3e-09	38.9
WP_003489652.1\|2896807_2898493_-	30S ribosomal protein S1	NA	NA	NA	NA
WP_007970132.1\|2898675_2899359_-	(d)CMP kinase	NA	NA	NA	NA
WP_005913193.1\|2899531_2899657_+	50S ribosomal protein L36	NA	NA	NA	NA
WP_007970129.1\|2899905_2900247_+	hypothetical protein	NA	NA	NA	NA
WP_007963274.1\|2900480_2901515_+	agmatine deiminase family protein	M1I7C5	Paramecium_bursaria_Chlorella_virus	5.9e-38	29.9
WP_003489660.1\|2901640_2902525_+	carbon-nitrogen hydrolase	M1IKC7	Paramecium_bursaria_Chlorella_virus	1.5e-50	38.3
WP_007970127.1\|2902528_2903065_+	N-acetyltransferase	NA	NA	NA	NA
WP_022559257.1\|2903057_2904278_+	TraB/GumN family protein	NA	NA	NA	NA
WP_088409417.1\|2904399_2905248_-	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_088370744.1\|2905299_2906386_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007970730.1\|2906556_2909694_-	discoidin domain-containing protein	NA	NA	NA	NA
WP_007964654.1\|2909720_2910557_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_007970732.1\|2910553_2911438_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_042805387.1\|2911434_2912805_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011051505.1\|2912808_2914428_-	hypothetical protein	NA	NA	NA	NA
WP_088409418.1\|2914531_2917510_-	TonB-dependent receptor	NA	NA	NA	NA
WP_007970737.1\|2917647_2918670_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_008571805.1\|2919053_2919323_-	BolA family transcriptional regulator	NA	NA	NA	NA
WP_005922519.1\|2919319_2919619_-	YciI family protein	NA	NA	NA	NA
WP_042675289.1\|2919992_2920898_+	segregation/condensation protein A	NA	NA	NA	NA
WP_173668628.1\|2920875_2922114_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.7e-21	33.5
WP_007970741.1\|2922106_2923741_+	pseudouridine synthase	NA	NA	NA	NA
WP_007970742.1\|2923822_2924527_-\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	1.1e-16	31.2
WP_088370789.1\|2924493_2924811_+\|transposase	transposase	NA	NA	NA	NA
WP_042805392.1\|2924834_2925323_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_088370746.1\|2925387_2926474_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_139792837.1\|2926675_2927041_-	hypothetical protein	Q9ETV7	Enterobacteria_phage	2.3e-13	60.3
2925318:2926514	attR	NA	NA	NA	NA
WP_057663003.1\|2927208_2927640_+	DUF3757 domain-containing protein	NA	NA	NA	NA
WP_162269139.1\|2928179_2929222_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.2e-43	41.6
WP_088370746.1\|2929274_2930362_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_157883164.1\|2930426_2932049_-	gamma-glutamyltransferase	NA	NA	NA	NA
WP_088409422.1\|2932074_2933901_-	TonB-dependent receptor	NA	NA	NA	NA
WP_007962146.1\|2933931_2934912_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_088409423.1\|2934963_2936304_-	TonB-dependent receptor plug domain-containing protein	A0A0P0I887	Acinetobacter_phage	4.0e-10	29.1
WP_088370746.1\|2936590_2937677_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8

DBSCAN-SWA_16

3016254 : 3026960

Leptospira_phage(16.67%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088370746.1\|3016254_3017341_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_003481884.1\|3019429_3019642_-	carbon storage regulator CsrA	J7I430	Pseudomonas_phage	1.3e-13	76.5
WP_007966762.1\|3019781_3022430_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	9.7e-85	40.0
WP_007966764.1\|3022531_3023020_-	recombination regulator RecX	NA	NA	NA	NA
WP_003481871.1\|3023347_3024382_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	5.1e-114	61.3
WP_007972059.1\|3024554_3025196_-	transcriptional repressor LexA	A0A1W6JNS2	Morganella_phage	2.4e-13	40.2
WP_007966769.1\|3025283_3026960_-	2-polyprenylphenol 6-hydroxylase	G8DDN0	Micromonas_pusilla_virus	1.9e-41	29.4

DBSCAN-SWA_17

3202910 : 3264396

Leptospira_phage(21.43%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042675216.1\|3202910_3203426_-\|tRNA	tRNA adenosine(34) deaminase TadA	S4VYT2	Pandoravirus	3.3e-05	39.3
WP_022559153.1\|3203422_3203890_-	manganese-binding transcriptional regulator MntR	NA	NA	NA	NA
WP_007971276.1\|3204032_3205367_+	Nramp family divalent metal transporter	NA	NA	NA	NA
WP_007964368.1\|3206060_3206885_+	alpha/beta hydrolase	A0A076YK43	Mycobacterium_phage	1.6e-14	27.1
WP_088370746.1\|3207284_3208371_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_088370805.1\|3208573_3210007_+	NAD(P)-binding domain-containing protein	A0A2H4J2Q2	uncultured_Caudovirales_phage	1.3e-06	32.9
WP_007970063.1\|3209999_3210932_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_007963788.1\|3212345_3212708_-	hypothetical protein	NA	NA	NA	NA
WP_007970069.1\|3212691_3213261_-	molybdenum cofactor guanylyltransferase	NA	NA	NA	NA
WP_033481031.1\|3213298_3214573_-	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_022559150.1\|3214752_3215028_+	hypothetical protein	NA	NA	NA	NA
WP_088409443.1\|3215064_3216057_-	exodeoxyribonuclease III	NA	NA	NA	NA
WP_042805251.1\|3216204_3216975_+	OBAP family protein	NA	NA	NA	NA
WP_050780419.1\|3217169_3218300_-	glutathione-dependent formaldehyde dehydrogenase	A0A0K0KVL7	Prochlorococcus_phage	2.4e-08	28.5
WP_007969091.1\|3218331_3219294_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007963799.1\|3219431_3219962_-	hypothetical protein	NA	NA	NA	NA
WP_007963801.1\|3219965_3220544_-	DUF4142 domain-containing protein	NA	NA	NA	NA
WP_088370746.1\|3221078_3222165_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_165496288.1\|3222162_3222339_-	hypothetical protein	NA	NA	NA	NA
WP_162269140.1\|3222421_3225085_-	TonB-dependent receptor	NA	NA	NA	NA
WP_173362053.1\|3225270_3226476_+	molybdopterin-synthase adenylyltransferase MoeB	NA	NA	NA	NA
WP_007973397.1\|3226823_3228044_-	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_007963808.1\|3228355_3229753_-	ribosome biogenesis GTPase Der	NA	NA	NA	NA
WP_007973396.1\|3229763_3230981_-	outer membrane protein assembly factor BamB	NA	NA	NA	NA
WP_007973395.1\|3230980_3231619_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_007973394.1\|3231689_3232550_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_088409445.1\|3232546_3233335_-	type IV pilus biogenesis/stability protein PilW	NA	NA	NA	NA
WP_050780456.1\|3233345_3234527_-	23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN	NA	NA	NA	NA
WP_007963814.1\|3234569_3234995_-	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	1.5e-19	41.7
WP_007963815.1\|3235213_3235846_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_088409446.1\|3235870_3238243_+	3-hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase family protein	NA	NA	NA	NA
WP_007973391.1\|3238407_3239613_+	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
WP_003482896.1\|3239929_3240331_-	fluoride efflux transporter CrcB	NA	NA	NA	NA
WP_042675084.1\|3240510_3241884_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	6.8e-74	38.2
WP_088409447.1\|3242120_3246287_+	type III effector	NA	NA	NA	NA
WP_007973389.1\|3246406_3247078_-	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_173362054.1\|3247142_3249050_-	DUF3857 domain-containing protein	NA	NA	NA	NA
WP_003482906.1\|3249217_3251575_-	DNA translocase FtsK	G1D482	Mycobacterium_virus	2.5e-84	45.8
WP_007964266.1\|3251858_3252827_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	1.5e-64	44.5
WP_007973386.1\|3252884_3254003_+	N-acetyltransferase	NA	NA	NA	NA
WP_007964270.1\|3254265_3255015_+\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_002813418.1\|3255095_3255314_+	translation initiation factor IF-1	NA	NA	NA	NA
WP_088409448.1\|3255588_3257871_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	7.9e-176	45.0
WP_005914463.1\|3258013_3258334_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	1.0e-12	45.7
WP_007964277.1\|3258587_3259046_+	NUDIX hydrolase	NA	NA	NA	NA
WP_007973382.1\|3259042_3260179_+\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_007964280.1\|3260178_3260793_+	high frequency lysogenization protein HflD	NA	NA	NA	NA
WP_014090132.1\|3260852_3262130_+	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.3e-14	32.2
WP_042805922.1\|3262216_3262504_+	hypothetical protein	NA	NA	NA	NA
WP_088370746.1\|3263309_3264396_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8

DBSCAN-SWA_18

3309312 : 3374933

uncultured_Caudovirales_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_098477673.1\|3309312_3310414_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6
WP_007969671.1\|3310641_3311013_+	flagellar hook-basal body complex protein FliE	NA	NA	NA	NA
WP_088370806.1\|3311026_3312751_+	flagellar M-ring protein FliF	NA	NA	NA	NA
WP_005918162.1\|3312761_3313751_+	flagellar motor switch protein FliG	NA	NA	NA	NA
WP_005918165.1\|3313747_3314368_+	flagellar assembly protein FliH	NA	NA	NA	NA
WP_005918170.1\|3314364_3315741_+	FliI/YscN family ATPase	NA	NA	NA	NA
WP_005918178.1\|3315744_3316200_+	flagellar export protein FliJ	NA	NA	NA	NA
WP_042805142.1\|3316196_3317489_+	flagellar hook-length control protein FliK	NA	NA	NA	NA
WP_173362021.1\|3317654_3318206_+	flagellar basal body-associated FliL family protein	NA	NA	NA	NA
WP_005917976.1\|3318216_3319230_+	flagellar motor switch protein FliM	NA	NA	NA	NA
WP_007969679.1\|3319226_3319565_+	flagellar motor switch protein FliN	NA	NA	NA	NA
WP_005921346.1\|3319561_3319969_+	flagellar biosynthetic protein FliO	NA	NA	NA	NA
WP_007969680.1\|3319970_3320816_+	flagellar type III secretion system pore protein FliP	NA	NA	NA	NA
WP_088370746.1\|3321024_3322111_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_005917968.1\|3322901_3323171_+	flagellar biosynthetic protein FliQ	NA	NA	NA	NA
WP_007975658.1\|3323184_3323976_+	flagellar biosynthetic protein FliR	NA	NA	NA	NA
WP_088370746.1\|3324348_3325435_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_089112489.1\|3328686_3331608_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	3.5e-11	37.0
WP_007970797.1\|3331878_3333966_+	bifunctional diguanylate cyclase/phosphodiesterase	G3MA91	Bacillus_virus	1.5e-19	34.3
WP_007970795.1\|3334119_3335250_+	flagellar biosynthesis protein FlhB	NA	NA	NA	NA
WP_029819345.1\|3335267_3337340_+	flagellar biosynthesis protein FlhA	NA	NA	NA	NA
WP_088370808.1\|3338277_3339969_+	flagellar biosynthesis protein FlhF	NA	NA	NA	NA
WP_005918202.1\|3339955_3340840_+	MinD/ParA family protein	NA	NA	NA	NA
WP_005918198.1\|3340836_3341604_+	RNA polymerase sigma factor FliA	NA	NA	NA	NA
WP_002813536.1\|3341626_3342019_+	chemotaxis protein CheY	NA	NA	NA	NA
WP_007970783.1\|3342018_3342645_+	protein phosphatase CheZ	NA	NA	NA	NA
WP_007970781.1\|3342647_3344306_+	chemotaxis protein CheA	NA	NA	NA	NA
WP_088409452.1\|3344546_3345624_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.7e-41	36.4
WP_131454219.1\|3345621_3346731_-	hypothetical protein	NA	NA	NA	NA
WP_007962146.1\|3346849_3347830_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_005914940.1\|3352372_3353113_+	flagellar motor protein	NA	NA	NA	NA
WP_005931860.1\|3353119_3354094_+	flagellar motor protein MotD	NA	NA	NA	NA
WP_003489696.1\|3354095_3354878_+	ParA family protein	Q8JL10	Natrialba_phage	5.9e-14	37.1
WP_007971282.1\|3354874_3356149_+	chemotaxis protein CheW	NA	NA	NA	NA
WP_003489692.1\|3356251_3356560_+	STAS domain-containing protein	NA	NA	NA	NA
WP_002806565.1\|3356556_3356922_+	response regulator	W8CYM9	Bacillus_phage	2.7e-14	39.3
WP_007971284.1\|3356955_3358956_+	chemotaxis protein CheA	NA	NA	NA	NA
WP_042805473.1\|3359196_3361488_+	MCP four helix bundle domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.5e-09	61.7
WP_033481115.1\|3361806_3362340_+	hypothetical protein	NA	NA	NA	NA
WP_007971288.1\|3362872_3365050_+	cache domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	3.2e-09	53.6
WP_042805474.1\|3365122_3367912_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.3e-10	47.8
WP_007962534.1\|3368214_3368976_+	transporter	NA	NA	NA	NA
WP_042805475.1\|3368989_3371359_+	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	4.9e-11	54.4
WP_088409453.1\|3371579_3373838_+	MCP four helix bundle domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	3.3e-09	60.0
WP_007962146.1\|3373952_3374933_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6

DBSCAN-SWA_19

3422999 : 3488832

Leptospira_phage(23.08%)

transposase,tRNA,integrase

attL 3412115:3412131|attR 3495724:3495740

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3412115:3412131	attL	NA	NA	NA	NA
WP_007973515.1\|3422999_3424517_-\|tRNA	lysine--tRNA ligase	A0A2K9KZX5	Tupanvirus	7.2e-85	39.7
WP_099050317.1\|3424727_3425853_-	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	9.4e-05	39.7
WP_042805941.1\|3427209_3428424_+	acyltransferase family protein	NA	NA	NA	NA
WP_007973510.1\|3428750_3430490_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	4.2e-44	28.6
WP_007973508.1\|3430486_3431407_-	hypothetical protein	NA	NA	NA	NA
WP_003486289.1\|3431423_3431888_-	transcription elongation factor GreA	NA	NA	NA	NA
WP_007973506.1\|3431896_3435139_-	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
WP_007962953.1\|3435147_3435591_-	hypothetical protein	NA	NA	NA	NA
WP_042674829.1\|3435590_3436766_-	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	6.3e-44	31.8
WP_007962949.1\|3437005_3437722_-	4-hydroxy-tetrahydrodipicolinate reductase	NA	NA	NA	NA
WP_042674827.1\|3438130_3438850_-	MOSC domain-containing protein	NA	NA	NA	NA
WP_046121198.1\|3438846_3440049_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_007962945.1\|3440276_3440777_-	hypothetical protein	NA	NA	NA	NA
WP_022559069.1\|3440836_3441091_-	hypothetical protein	NA	NA	NA	NA
WP_007962944.1\|3441092_3442952_-	ferrous iron transporter B	NA	NA	NA	NA
WP_003486267.1\|3442948_3443197_-	ferrous iron transport protein A	NA	NA	NA	NA
WP_088370811.1\|3443311_3444109_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_042674819.1\|3444105_3444495_+	VOC family protein	NA	NA	NA	NA
WP_088409459.1\|3444601_3445498_+	hydroxymethylglutaryl-CoA lyase	A0A1V0SKU2	Klosneuvirus	1.7e-33	33.3
WP_007962940.1\|3445634_3446405_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	3.4e-14	32.2
WP_007962938.1\|3446525_3447092_+	elongation factor P-like protein YeiP	NA	NA	NA	NA
WP_007962937.1\|3447091_3447478_+	hypothetical protein	NA	NA	NA	NA
WP_007973497.1\|3447705_3449562_-	DUF4105 domain-containing protein	NA	NA	NA	NA
WP_005915396.1\|3449558_3449858_-	DUF2388 domain-containing protein	NA	NA	NA	NA
WP_007973496.1\|3449892_3451311_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_007973495.1\|3451519_3452761_+	phosphoglycerate dehydrogenase	A0A1V0SBV6	Catovirus	9.7e-104	47.9
WP_087945324.1\|3452901_3453513_-	NUDIX hydrolase	NA	NA	NA	NA
WP_022559057.1\|3453654_3455127_+	amino acid permease	NA	NA	NA	NA
WP_007962121.1\|3455203_3456634_+	amino acid permease	NA	NA	NA	NA
WP_007962123.1\|3456723_3457377_+	methylthioribulose 1-phosphate dehydratase	NA	NA	NA	NA
WP_005915388.1\|3457412_3457979_+	acireductone dioxygenase	NA	NA	NA	NA
WP_007962134.1\|3457981_3458680_+	acireductone synthase	NA	NA	NA	NA
WP_088409460.1\|3458863_3459940_+	peptidase C13	NA	NA	NA	NA
WP_088370804.1\|3460141_3461228_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.9e-42	36.4
WP_088409461.1\|3461364_3462951_-	calcineurin-like phosphoesterase C-terminal domain-containing protein	NA	NA	NA	NA
WP_007963934.1\|3463119_3463740_-	bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE	NA	NA	NA	NA
WP_007970958.1\|3463729_3464506_-	imidazole glycerol phosphate synthase subunit HisF	NA	NA	NA	NA
WP_007970957.1\|3464499_3465234_-	1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase	NA	NA	NA	NA
WP_007963930.1\|3465230_3465833_-	imidazole glycerol phosphate synthase subunit HisH	NA	NA	NA	NA
WP_007963926.1\|3465829_3466957_-	bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB	NA	NA	NA	NA
WP_007970954.1\|3466953_3468045_-	histidinol-phosphate transaminase	NA	NA	NA	NA
WP_007970952.1\|3468041_3469337_-	histidinol dehydrogenase	NA	NA	NA	NA
WP_007970951.1\|3469333_3470248_-	ATP phosphoribosyltransferase	NA	NA	NA	NA
WP_007970950.1\|3470257_3470581_-	DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_042675106.1\|3471206_3472619_-\|tRNA	histidine--tRNA ligase	A0A2K9L6G5	Tupanvirus	1.0e-40	28.4
WP_172955836.1\|3472822_3473488_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_088409462.1\|3473573_3474296_-	murein L,D-transpeptidase catalytic domain family protein	NA	NA	NA	NA
WP_173362027.1\|3474396_3475707_-	threonine synthase	NA	NA	NA	NA
WP_042675108.1\|3475862_3476177_+	EthD family reductase	NA	NA	NA	NA
WP_088409629.1\|3476251_3477220_-	homoserine kinase	NA	NA	NA	NA
WP_007970947.1\|3477261_3479769_-	bifunctional aspartate kinase/homoserine dehydrogenase I	NA	NA	NA	NA
WP_007970946.1\|3480455_3480956_-	tryptophan-rich sensory protein	NA	NA	NA	NA
WP_088409463.1\|3481421_3482831_+\|integrase	site-specific integrase	A0A0A0YR56	Pseudomonas_phage	4.9e-11	25.2
WP_131438933.1\|3482976_3483228_+	hypothetical protein	NA	NA	NA	NA
WP_007975311.1\|3483542_3484523_-\|transposase	IS5-like element ISXfu2 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.5
WP_088370744.1\|3484722_3485809_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_088409630.1\|3485818_3486769_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_131469987.1\|3486812_3487352_+	hypothetical protein	NA	NA	NA	NA
WP_088370746.1\|3487744_3488832_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
3495724:3495740	attR	NA	NA	NA	NA

DBSCAN-SWA_20

3492057 : 3566793

Leptospira_phage(21.43%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088370746.1\|3492057_3493145_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_088409631.1\|3493504_3494395_-	CDP-diacylglycerol diphosphatase	NA	NA	NA	NA
WP_162269141.1\|3494551_3499975_-	hypothetical protein	NA	NA	NA	NA
WP_007962146.1\|3500221_3501202_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_088409465.1\|3501432_3502086_+	response regulator transcription factor	NA	NA	NA	NA
WP_098477673.1\|3502737_3503840_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6
WP_007969656.1\|3505447_3508726_-	response regulator	A0A1V0SGX0	Hokovirus	2.1e-33	34.5
WP_007975311.1\|3509721_3510702_-\|transposase	IS5-like element ISXfu2 family transposase	A0A077K814	Ralstonia_phage	1.1e-97	59.5
WP_088409467.1\|3510704_3511358_+	EAL domain-containing protein	NA	NA	NA	NA
WP_007971012.1\|3511674_3512112_-	hypothetical protein	NA	NA	NA	NA
WP_007971013.1\|3512274_3513042_+	glutaminyl-peptide cyclotransferase	NA	NA	NA	NA
WP_007971014.1\|3513217_3514018_-	amidohydrolase	NA	NA	NA	NA
WP_088409468.1\|3514158_3515307_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_007971018.1\|3515534_3516179_+	heme ABC exporter ATP-binding protein CcmA	G3M9Y6	Bacillus_virus	1.6e-12	25.9
WP_007971020.1\|3516175_3516871_+	heme exporter protein CcmB	NA	NA	NA	NA
WP_007971022.1\|3516965_3517718_+	cytochrome c biogenesis protein CcsA	NA	NA	NA	NA
WP_042805445.1\|3517714_3517885_+	heme exporter protein CcmD	NA	NA	NA	NA
WP_088409469.1\|3517881_3518352_+	cytochrome c maturation protein CcmE	NA	NA	NA	NA
WP_007971024.1\|3518523_3520461_+	heme lyase CcmF/NrfE family subunit	NA	NA	NA	NA
WP_007964622.1\|3520453_3521056_+	DsbE family thiol:disulfide interchange protein	NA	NA	NA	NA
WP_007971028.1\|3521052_3521487_+	cytochrome c-type biogenesis protein CcmH	NA	NA	NA	NA
WP_007971030.1\|3521486_3522500_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_007964615.1\|3522807_3524010_+	homoserine O-acetyltransferase	NA	NA	NA	NA
WP_042805446.1\|3524161_3524776_+	DUF1294 domain-containing protein	NA	NA	NA	NA
WP_007971033.1\|3524847_3526533_-	thiol reductant ABC exporter subunit CydC	W8CYL7	Bacillus_phage	1.3e-13	24.6
WP_007971035.1\|3526529_3528266_-	thiol reductant ABC exporter subunit CydD	W8CYL7	Bacillus_phage	3.1e-15	25.6
WP_088409470.1\|3528418_3530056_+	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_088370814.1\|3530072_3531224_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_022559279.1\|3531309_3531420_+	cytochrome bd-I oxidase subunit CydX	NA	NA	NA	NA
WP_007969091.1\|3531588_3532551_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_042805684.1\|3533965_3535879_-	CocE/NonD family hydrolase	NA	NA	NA	NA
WP_007963649.1\|3536202_3538608_+	glycoside hydrolase family 95 protein	NA	NA	NA	NA
WP_007972357.1\|3538926_3540171_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.2e-90	44.3
WP_007972360.1\|3540330_3541485_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.5e-45	36.8
WP_088409471.1\|3541498_3541759_-	hypothetical protein	NA	NA	NA	NA
WP_042675045.1\|3541755_3543054_-	argininosuccinate lyase	NA	NA	NA	NA
WP_007963662.1\|3543178_3544129_-	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
WP_007972363.1\|3544125_3544737_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_007972364.1\|3544742_3546086_-	acetylglutamate kinase	NA	NA	NA	NA
WP_007972366.1\|3546130_3547231_-	acetylornithine deacetylase	NA	NA	NA	NA
WP_007961904.1\|3547236_3547689_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_007972368.1\|3547930_3549172_-	argininosuccinate synthase	NA	NA	NA	NA
WP_007963158.1\|3549242_3550268_-	N-acetylornithine carbamoyltransferase	NA	NA	NA	NA
WP_042674899.1\|3550579_3551074_-	hypothetical protein	NA	NA	NA	NA
WP_162269142.1\|3551251_3552676_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	1.9e-42	34.5
WP_088409473.1\|3552949_3553387_+	SufE family protein	NA	NA	NA	NA
WP_003486939.1\|3553383_3554634_+	MFS transporter	NA	NA	NA	NA
WP_022559292.1\|3554835_3555876_-	RNA polymerase-binding protein DksA	NA	NA	NA	NA
WP_042805683.1\|3555960_3556254_+	membrane protein insertion efficiency factor YidD	NA	NA	NA	NA
WP_007972373.1\|3556250_3557600_+	dihydroorotase	NA	NA	NA	NA
WP_007972375.1\|3557599_3558442_+	M23 family metallopeptidase	A0A075BS18	Microcystis_phage	1.7e-14	43.0
WP_007972377.1\|3558774_3560139_+	ethanolamine permease	NA	NA	NA	NA
WP_007972379.1\|3560135_3561545_+	ethanolamine ammonia-lyase subunit EutB	NA	NA	NA	NA
WP_007972380.1\|3561541_3562357_+	ethanolamine ammonia-lyase subunit EutC	NA	NA	NA	NA
WP_022559300.1\|3562413_3562704_-	hypothetical protein	NA	NA	NA	NA
WP_033481149.1\|3562797_3563679_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_098477673.1\|3564232_3565335_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6
WP_007962146.1\|3565812_3566793_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6

DBSCAN-SWA_21

3805087 : 3939466

117

Stenotrophomonas_phage(20.59%)

terminase,holin,tail,capsid,protease,portal,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007969091.1\|3805087_3806050_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007969292.1\|3806145_3806703_-	hypothetical protein	NA	NA	NA	NA
WP_007969022.1\|3806712_3809307_-	Fe/S-dependent 2-methylisocitrate dehydratase AcnD	NA	NA	NA	NA
WP_007969021.1\|3809527_3810682_-	2-methylcitrate synthase	NA	NA	NA	NA
WP_007970235.1\|3810757_3811654_-	methylisocitrate lyase	NA	NA	NA	NA
WP_172955784.1\|3811780_3813400_+	propionate catabolism operon regulatory protein PrpR	NA	NA	NA	NA
WP_039732060.1\|3813631_3813958_-	hypothetical protein	NA	NA	NA	NA
WP_003483889.1\|3814588_3814942_-	PilZ domain-containing protein	NA	NA	NA	NA
WP_007969013.1\|3814938_3815898_-	DNA polymerase III subunit delta'	NA	NA	NA	NA
WP_007973280.1\|3815894_3816968_-	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_007973281.1\|3817028_3818384_-	aminodeoxychorismate synthase component I	NA	NA	NA	NA
WP_042805907.1\|3818547_3819783_-	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_002814322.1\|3819924_3820164_-	acyl carrier protein	B2ZXV3	Ralstonia_phage	5.9e-10	44.6
WP_007973285.1\|3820368_3821112_-	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	1.4e-12	29.7
WP_007973287.1\|3821194_3822139_-	ACP S-malonyltransferase	NA	NA	NA	NA
WP_007973288.1\|3822419_3822860_-	MEKHLA domain-containing protein	NA	NA	NA	NA
WP_007969005.1\|3823101_3824079_-	ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_010368401.1\|3824169_3824364_-	50S ribosomal protein L32	NA	NA	NA	NA
WP_007973293.1\|3824462_3824972_-	DUF177 domain-containing protein	NA	NA	NA	NA
WP_042805908.1\|3825083_3825659_+	septum formation inhibitor Maf	NA	NA	NA	NA
WP_007973296.1\|3825947_3827534_-	hypothetical protein	NA	NA	NA	NA
WP_088409490.1\|3828785_3830627_-	glycosyltransferase family 39 protein	NA	NA	NA	NA
WP_088409491.1\|3830664_3831618_+	MoxR family ATPase	NA	NA	NA	NA
WP_007968996.1\|3831623_3832580_+	DUF58 domain-containing protein	NA	NA	NA	NA
WP_007973299.1\|3832572_3834525_+	DUF3488 domain-containing transglutaminase family protein	NA	NA	NA	NA
WP_007968994.1\|3834521_3835055_+	Slp family lipoprotein	NA	NA	NA	NA
WP_007968993.1\|3835174_3835525_-	histidine triad nucleotide-binding protein	NA	NA	NA	NA
WP_003483843.1\|3835618_3836212_-	recombination protein RecR	NA	NA	NA	NA
WP_005913896.1\|3836309_3836630_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_007973302.1\|3836636_3838706_-	DNA polymerase III subunit gamma/tau	E7DN81	Pneumococcus_phage	1.8e-46	41.0
WP_042676280.1\|3839490_3839937_-	molybdenum cofactor biosynthesis protein MoaE	NA	NA	NA	NA
WP_042676279.1\|3839933_3840179_-	MoaD/ThiS family protein	NA	NA	NA	NA
WP_007973304.1\|3840175_3840673_-	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
WP_007968987.1\|3840698_3841079_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_007973305.1\|3841075_3842107_-	GTP 3',8-cyclase MoaA	NA	NA	NA	NA
WP_007973306.1\|3842106_3842856_-	MBL fold metallo-hydrolase	A0A0A0RUN7	Bacillus_phage	1.4e-09	26.0
WP_007973307.1\|3842855_3843605_-	3-deoxy-D-manno-octulosonic acid kinase	NA	NA	NA	NA
WP_007973308.1\|3843625_3844675_+	glycosyltransferase family 9 protein	NA	NA	NA	NA
WP_007968982.1\|3844857_3845262_-	hypothetical protein	A0A1C9C5K8	Heterosigma_akashiwo_virus	1.5e-16	35.9
WP_007973309.1\|3845804_3846509_+	serine/threonine-protein phosphatase	NA	NA	NA	NA
WP_007968978.1\|3846806_3847541_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	1.5e-35	40.4
WP_007973310.1\|3847549_3848002_-	ribonuclease HI	A0A1Q2U2R0	Vibrio_phage	4.7e-40	55.4
WP_007973311.1\|3848029_3848686_-	hypothetical protein	NA	NA	NA	NA
WP_007973312.1\|3848698_3849466_+	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
WP_007973314.1\|3849462_3850641_+	lytic transglycosylase domain-containing protein	NA	NA	NA	NA
WP_088409492.1\|3851271_3853242_-	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_002806049.1\|3853880_3854153_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	2.2e-21	64.0
WP_088409493.1\|3854366_3856838_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	1.4e-223	52.0
WP_003483788.1\|3856982_3858269_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	5.3e-137	59.9
WP_002806026.1\|3858394_3859021_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	1.0e-56	57.4
WP_007973333.1\|3859113_3860406_-	trigger factor	NA	NA	NA	NA
WP_088370744.1\|3861990_3863078_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_131469915.1\|3863620_3863869_+	hypothetical protein	NA	NA	NA	NA
WP_088409494.1\|3864064_3864250_+	hypothetical protein	NA	NA	NA	NA
WP_131469917.1\|3864980_3867251_-	hypothetical protein	NA	NA	NA	NA
WP_007962146.1\|3867767_3868748_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_088409496.1\|3869309_3870014_-	site-specific DNA-methyltransferase	V9IQV5	Stenotrophomonas_phage	2.2e-105	75.7
WP_088409497.1\|3869931_3870177_-	Com family DNA-binding transcriptional regulator	V9IQK2	Stenotrophomonas_phage	4.1e-14	53.8
WP_088409498.1\|3870203_3871220_-\|portal	phage portal protein	A0A2H4J922	uncultured_Caudovirales_phage	1.9e-134	70.1
WP_173668631.1\|3871219_3872977_-\|terminase	terminase ATPase subunit family protein	V9IQL5	Stenotrophomonas_phage	4.2e-262	75.3
WP_088409500.1\|3873123_3873969_+\|capsid	GPO family capsid scaffolding protein	V9IQG8	Stenotrophomonas_phage	3.1e-69	62.7
WP_088409501.1\|3874026_3875043_+\|capsid	phage major capsid protein, P2 family	Q9ZXM3	Pseudomonas_virus	7.1e-145	72.0
WP_088409502.1\|3875048_3875780_+\|terminase	terminase	Q9ZXM2	Pseudomonas_virus	5.8e-64	57.8
WP_098477673.1\|3875941_3877044_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6
WP_088409504.1\|3877295_3877697_+\|tail	phage tail protein	A0A2H4JG54	uncultured_Caudovirales_phage	4.5e-34	57.3
WP_088409505.1\|3877693_3878680_+	phage late control D family protein	V9IQM7	Stenotrophomonas_phage	5.7e-91	54.3
WP_007969091.1\|3879053_3880016_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_157883169.1\|3880025_3880580_-	hypothetical protein	NA	NA	NA	NA
WP_088409506.1\|3881489_3882576_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.9e-42	36.4
WP_042805158.1\|3884706_3884925_+	hypothetical protein	NA	NA	NA	NA
WP_042805157.1\|3884921_3885209_+	hypothetical protein	NA	NA	NA	NA
WP_042805155.1\|3885208_3885481_+	hypothetical protein	NA	NA	NA	NA
WP_050780411.1\|3885560_3885986_+	hypothetical protein	NA	NA	NA	NA
WP_082336380.1\|3885978_3886161_+	hypothetical protein	NA	NA	NA	NA
WP_042805159.1\|3886153_3886426_+	hypothetical protein	NA	NA	NA	NA
WP_042805154.1\|3886422_3886659_+	hypothetical protein	NA	NA	NA	NA
WP_007969718.1\|3886651_3888433_+	DNA cytosine methyltransferase	Q9ZXI4	Pseudomonas_virus	4.4e-166	62.0
WP_042805153.1\|3888697_3888904_+	hypothetical protein	NA	NA	NA	NA
WP_042805151.1\|3888900_3889122_+	hypothetical protein	V9IQX6	Stenotrophomonas_phage	1.3e-14	64.3
WP_007969717.1\|3889121_3890306_+	hypothetical protein	V9IQN0	Stenotrophomonas_phage	4.9e-129	58.6
WP_005927840.1\|3891015_3891777_+	Bax inhibitor-1/YccA family protein	NA	NA	NA	NA
WP_007973703.1\|3891921_3892929_-	isocitrate dehydrogenase	NA	NA	NA	NA
WP_007973704.1\|3893155_3893551_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_033481211.1\|3893547_3893856_-	glutaredoxin 3	A0A2L0UZG6	Agrobacterium_phage	2.7e-07	43.2
WP_162269145.1\|3893945_3895652_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_007968952.1\|3895834_3896524_+	phosphate regulon transcriptional regulator PhoB	W8CYM9	Bacillus_phage	3.8e-33	35.7
WP_007973705.1\|3896596_3897925_+	phosphate regulon sensor histidine kinase PhoR	W8CYF6	Bacillus_phage	6.4e-29	33.3
WP_003483747.1\|3898037_3900140_+	polyphosphate kinase 1	NA	NA	NA	NA
WP_007968947.1\|3900318_3901839_+	exopolyphosphatase	NA	NA	NA	NA
WP_007973707.1\|3902050_3903187_+	glycosyltransferase family 1 protein	NA	NA	NA	NA
WP_007968943.1\|3903167_3903710_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_007973708.1\|3904109_3904853_+	UDP-2,3-diacylglucosamine diphosphatase	NA	NA	NA	NA
WP_007973709.1\|3905041_3905461_-	hypothetical protein	NA	NA	NA	NA
WP_173362058.1\|3907426_3908272_-	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_003483730.1\|3908446_3909913_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.1e-85	39.9
WP_007973712.1\|3909943_3910690_-	CvpA family protein	NA	NA	NA	NA
WP_042805975.1\|3910903_3911986_-	SPOR domain-containing protein	NA	NA	NA	NA
WP_007973716.1\|3912053_3913352_-	bifunctional tetrahydrofolate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_088409507.1\|3913681_3914326_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_173362059.1\|3914419_3916504_-	S46 family peptidase	NA	NA	NA	NA
WP_007973719.1\|3916747_3918829_-\|holin	phospholipase C, phosphocholine-specific	NA	NA	NA	NA
WP_007973721.1\|3918937_3921358_+	TonB-dependent receptor	NA	NA	NA	NA
WP_007973723.1\|3921629_3922664_+	L-threonine 3-dehydrogenase	NA	NA	NA	NA
WP_007973725.1\|3923055_3923772_-	hypothetical protein	NA	NA	NA	NA
WP_007968921.1\|3924054_3925086_-	sulfate/molybdate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-25	32.7
WP_007973727.1\|3925093_3926047_-	sulfate ABC transporter permease subunit CysW	NA	NA	NA	NA
WP_007968918.1\|3926043_3926904_-	sulfate ABC transporter permease subunit CysT	NA	NA	NA	NA
WP_007968916.1\|3926907_3928005_-	sulfate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_007973729.1\|3928094_3929303_+	glycine C-acetyltransferase	V5LQ39	Emiliania_huxleyi_virus	5.0e-20	27.0
WP_033481210.1\|3929305_3929698_+	HNH endonuclease	NA	NA	NA	NA
WP_007973731.1\|3929648_3930509_-	rRNA pseudouridine synthase	NA	NA	NA	NA
WP_007968908.1\|3930528_3931044_-	hypothetical protein	NA	NA	NA	NA
WP_005915855.1\|3931236_3932334_-	OmpA family protein	NA	NA	NA	NA
WP_057661857.1\|3932748_3933771_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_007973735.1\|3933977_3936017_+	NADPH-dependent 2,4-dienoyl-CoA reductase	NA	NA	NA	NA
WP_088370746.1\|3936159_3937246_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007969091.1\|3938503_3939466_-\|transposase	IS1595 family transposase	NA	NA	NA	NA

DBSCAN-SWA_22

4062045 : 4119757

Leptospira_phage(23.08%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007962146.1\|4062045_4063026_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_088409635.1\|4063644_4065516_+	type III secretion system effector protein	NA	NA	NA	NA
WP_088370746.1\|4065512_4066600_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_042805081.1\|4067553_4067796_+	DUF378 domain-containing protein	NA	NA	NA	NA
WP_007969432.1\|4067866_4068838_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_007969434.1\|4068897_4069785_-	EamA family transporter	NA	NA	NA	NA
WP_007962146.1\|4070162_4071143_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_042805563.1\|4072198_4072450_+	DUF2867 domain-containing protein	NA	NA	NA	NA
WP_005912915.1\|4072537_4072831_+	hypothetical protein	NA	NA	NA	NA
WP_007971874.1\|4073030_4073834_-	DUF4349 domain-containing protein	NA	NA	NA	NA
WP_007971872.1\|4073830_4074229_-	aldehyde-activating protein	NA	NA	NA	NA
WP_042674840.1\|4074570_4076376_+	DUF885 domain-containing protein	NA	NA	NA	NA
WP_007971867.1\|4076593_4078426_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.0e-30	26.5
WP_007971865.1\|4078599_4079196_-	plasmid pRiA4b ORF-3 family protein	NA	NA	NA	NA
WP_007971862.1\|4079399_4082459_-	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_007971860.1\|4082455_4083562_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_022558952.1\|4083584_4084421_-	MipA/OmpV family protein	NA	NA	NA	NA
WP_007971856.1\|4084440_4085910_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_005912893.1\|4086014_4086704_+	response regulator transcription factor	Q6XM27	Feldmannia_irregularis_virus	8.0e-07	27.5
WP_007971854.1\|4086700_4087894_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	2.8e-23	25.7
WP_007971853.1\|4087957_4089223_-	cation:proton antiporter	NA	NA	NA	NA
WP_050780440.1\|4089368_4091045_-	serine hydrolase	NA	NA	NA	NA
WP_007963982.1\|4090986_4091487_-	ribonuclease E activity regulator RraA	NA	NA	NA	NA
WP_007971849.1\|4092087_4092918_+	DUF72 domain-containing protein	NA	NA	NA	NA
WP_007971847.1\|4093320_4094268_+	DMT family transporter	NA	NA	NA	NA
WP_088409517.1\|4094727_4095815_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007971843.1\|4096965_4097688_-	pseudouridine synthase	NA	NA	NA	NA
WP_042805558.1\|4097800_4100212_-	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	9.6e-15	35.8
WP_088409518.1\|4100469_4102368_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.7e-62	37.3
WP_042805556.1\|4103140_4103383_+	RNA-binding S4 domain-containing protein	NA	NA	NA	NA
WP_007963995.1\|4103379_4103700_+	hypothetical protein	NA	NA	NA	NA
WP_007963996.1\|4103726_4104128_-	MAPEG family protein	NA	NA	NA	NA
WP_007969592.1\|4104153_4104690_-	DUF4019 domain-containing protein	NA	NA	NA	NA
WP_057659909.1\|4105090_4105345_-	hypothetical protein	NA	NA	NA	NA
WP_007969593.1\|4105421_4106648_-	hypothetical protein	NA	NA	NA	NA
WP_007969594.1\|4106795_4108259_+	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
WP_007964005.1\|4108255_4108801_+	methylated-DNA--[protein]-cysteine S-methyltransferase	A0A1S5V092	Saudi_moumouvirus	2.7e-13	50.6
WP_007964007.1\|4108837_4110136_+	alkaline phosphatase family protein	A0A0M3PB47	Turkeypox_virus	1.3e-55	34.6
WP_088409519.1\|4110262_4111705_+	chloride channel protein	A0A1X9I5Z9	Streptococcus_phage	9.8e-15	32.2
WP_042805086.1\|4111777_4112818_+	zinc-dependent alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_003487537.1\|4112951_4113134_-	30S ribosomal protein THX	NA	NA	NA	NA
WP_007969441.1\|4113577_4113994_-	MerC domain-containing protein	NA	NA	NA	NA
WP_007964018.1\|4114156_4116220_+	TonB-dependent receptor	NA	NA	NA	NA
WP_007969295.1\|4116345_4116861_+	hypothetical protein	NA	NA	NA	NA
WP_007969297.1\|4116815_4117931_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_039569573.1\|4118160_4118451_-	hypothetical protein	NA	NA	NA	NA
WP_088370746.1\|4118669_4119757_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8

DBSCAN-SWA_23

4326397 : 4454695

Leptospira_phage(20.83%)

tail,protease,transposase,tRNA,integrase

attL 4417466:4417525|attR 4435649:4436652

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007962146.1\|4326397_4327378_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_007973632.1\|4327686_4328355_-	phosphoribosylanthranilate isomerase	NA	NA	NA	NA
WP_007973634.1\|4328351_4329125_-\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_007973636.1\|4329300_4329708_-	VOC family protein	NA	NA	NA	NA
WP_042805963.1\|4329704_4331633_-	ferrous iron transporter B	NA	NA	NA	NA
WP_007962932.1\|4332325_4333351_-	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_007973640.1\|4333433_4334507_-	D-glycerate dehydrogenase	M1HUT5	Acanthocystis_turfacea_Chlorella_virus	3.2e-18	26.9
WP_007973642.1\|4334499_4335603_-	chorismate synthase	A0A291AU41	Pandoravirus	1.6e-73	40.4
WP_007963936.1\|4335613_4336540_-	50S ribosomal protein L3 N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_042805965.1\|4336620_4337271_+	SCO family protein	NA	NA	NA	NA
WP_007973647.1\|4337267_4338110_+	phosphatidylserine decarboxylase	NA	NA	NA	NA
WP_007963939.1\|4338339_4339923_-	transglycosylase SLT domain-containing protein	A0A2H4J9N7	uncultured_Caudovirales_phage	5.5e-11	31.5
WP_007963941.1\|4340215_4341721_+	DUF853 family protein	A0A248XCZ8	Klebsiella_phage	4.2e-85	45.9
WP_007973651.1\|4341774_4342395_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_007963946.1\|4342749_4344024_+	DUF4013 domain-containing protein	NA	NA	NA	NA
WP_088409533.1\|4344315_4345402_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_088370828.1\|4345368_4346826_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_007963950.1\|4346936_4347443_+	transcription elongation factor GreB	NA	NA	NA	NA
WP_088409534.1\|4347761_4349135_-	30S ribosomal protein S12 methylthiotransferase RimO	NA	NA	NA	NA
WP_007963954.1\|4349316_4349979_+	dienelactone hydrolase family protein	NA	NA	NA	NA
WP_007963955.1\|4349975_4350410_+	HIT family protein	NA	NA	NA	NA
WP_003486900.1\|4350437_4350605_+	hypothetical protein	NA	NA	NA	NA
WP_022559000.1\|4350850_4351036_+	hypothetical protein	NA	NA	NA	NA
WP_005912996.1\|4351192_4351762_-	dCTP deaminase	S5VM63	Pseudomonas_phage	4.1e-73	70.6
WP_007963958.1\|4351858_4352710_-	iron-sulfur cluster carrier protein ApbC	Q8JL10	Natrialba_phage	7.1e-05	27.0
WP_088409535.1\|4353047_4356032_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	2.7e-14	35.6
WP_007963962.1\|4356393_4359456_+	TonB-dependent receptor	NA	NA	NA	NA
WP_007963964.1\|4359501_4361262_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_042805062.1\|4361613_4363716_+	peptidase	A0A1V0SHG2	Klosneuvirus	1.2e-72	27.7
WP_088409536.1\|4364100_4366200_+	M13 family metallopeptidase	E3T4I7	Cafeteria_roenbergensis_virus	3.3e-72	29.7
WP_007969573.1\|4366383_4368399_+	M13 family metallopeptidase	NA	NA	NA	NA
WP_003486879.1\|4368583_4369279_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_007964761.1\|4369319_4369727_-	MGMT family protein	NA	NA	NA	NA
WP_007975178.1\|4370057_4371002_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_039730924.1\|4371247_4372618_-	glutathione-disulfide reductase	A0A2K5B2C5	Erysipelothrix_phage	1.4e-39	26.0
WP_042805402.1\|4372614_4373865_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_007970778.1\|4373872_4375117_-	DUF418 domain-containing protein	NA	NA	NA	NA
WP_007964764.1\|4375348_4375828_-	peptidylprolyl isomerase	NA	NA	NA	NA
WP_042805401.1\|4375937_4376480_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	1.2e-18	40.2
WP_017168813.1\|4376589_4377339_+	C40 family peptidase	A0A0K2SUC1	Clostridium_phage	1.2e-19	38.5
WP_007964766.1\|4377546_4378038_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_007964767.1\|4378272_4379109_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_042805398.1\|4379118_4380459_-	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_042805397.1\|4380601_4382308_+	alkaline phosphatase	NA	NA	NA	NA
WP_042805396.1\|4382677_4383979_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_003486852.1\|4384010_4384271_+	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_007970765.1\|4384272_4385148_+	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_042805743.1\|4386762_4387230_-	DUF4870 domain-containing protein	NA	NA	NA	NA
WP_007964779.1\|4387330_4388698_-\|protease	metalloprotease PmbA	NA	NA	NA	NA
WP_042805744.1\|4388845_4389424_+	ribosome-associated protein	NA	NA	NA	NA
WP_007972594.1\|4389680_4391126_-\|protease	metalloprotease TldD	NA	NA	NA	NA
WP_007972596.1\|4391223_4391976_+	hypothetical protein	NA	NA	NA	NA
WP_007972598.1\|4391991_4395912_-	TIGR02099 family protein	NA	NA	NA	NA
WP_007972600.1\|4396052_4397552_-	ribonuclease G	NA	NA	NA	NA
WP_007972602.1\|4397552_4398125_-	Maf-like protein	NA	NA	NA	NA
WP_007964795.1\|4398263_4398998_+	SIMPL domain-containing protein	NA	NA	NA	NA
WP_007972604.1\|4399344_4402455_+	TonB-dependent receptor	NA	NA	NA	NA
WP_173362045.1\|4402834_4403443_+	energy transducer TonB	NA	NA	NA	NA
WP_003486825.1\|4403519_4403990_-	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_007972607.1\|4404111_4405647_+	DUF839 domain-containing protein	NA	NA	NA	NA
WP_005912943.1\|4405803_4406217_-	ribosome silencing factor	NA	NA	NA	NA
WP_007972615.1\|4406273_4407143_-	nicotinate-nucleotide adenylyltransferase	NA	NA	NA	NA
WP_007972617.1\|4407139_4408168_-	DNA polymerase III subunit delta	NA	NA	NA	NA
WP_005912936.1\|4408190_4408835_-	hypothetical protein	NA	NA	NA	NA
WP_007972619.1\|4409411_4412054_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	2.6e-175	40.5
WP_007972621.1\|4412121_4412739_-	DUF998 domain-containing protein	NA	NA	NA	NA
WP_007972624.1\|4412952_4413810_+	thioredoxin	A0A1J0GW78	Streptomyces_phage	3.5e-12	42.9
WP_007972625.1\|4414138_4414588_+	DUF4442 domain-containing protein	NA	NA	NA	NA
WP_162269146.1\|4415001_4415877_-	hypothetical protein	NA	NA	NA	NA
WP_007962982.1\|4416618_4417065_-	hypothetical protein	NA	NA	NA	NA
WP_088370830.1\|4417311_4417494_+	hypothetical protein	NA	NA	NA	NA
4417466:4417525	attL	NA	NA	NA	NA
WP_007962146.1\|4417583_4418564_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_007964456.1\|4419562_4420633_-	hypothetical protein	NA	NA	NA	NA
WP_007971055.1\|4420717_4421995_-	lytic murein transglycosylase	NA	NA	NA	NA
WP_007971053.1\|4422116_4425110_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.4e-87	27.9
WP_007971051.1\|4425118_4426393_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_088409537.1\|4426576_4427590_+	DNA-binding protein	NA	NA	NA	NA
WP_098477673.1\|4428790_4429892_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.3e-43	41.6
WP_088370746.1\|4430214_4431302_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_007969091.1\|4432124_4433087_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_088370744.1\|4433547_4434635_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_157835093.1\|4435881_4436037_-	hypothetical protein	NA	NA	NA	NA
WP_007970087.1\|4438289_4439291_-	LysR family transcriptional regulator	NA	NA	NA	NA
4435649:4436652	attR	NA	NA	NA	NA
WP_007965260.1\|4439357_4439717_-	protocatechuate 3,4-dioxygenase subunit alpha	NA	NA	NA	NA
WP_088409539.1\|4439727_4440621_-	gallate dioxygenase	NA	NA	NA	NA
WP_007970084.1\|4440856_4441531_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_042805254.1\|4441703_4442735_-	transporter	NA	NA	NA	NA
WP_007970078.1\|4442893_4443325_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_007970076.1\|4444272_4445454_-	UbiH/UbiF family hydroxylase	NA	NA	NA	NA
WP_007965247.1\|4445450_4446659_-	2-octaprenyl-6-methoxyphenyl hydroxylase	NA	NA	NA	NA
WP_007972921.1\|4447084_4447441_+	DUF3486 family protein	NA	NA	NA	NA
WP_007972923.1\|4447886_4448573_+	hypothetical protein	NA	NA	NA	NA
WP_050780453.1\|4448577_4449306_+	hypothetical protein	J9SH47	Pseudomonas_phage	1.3e-52	65.8
WP_042805813.1\|4449310_4449592_+	hypothetical protein	NA	NA	NA	NA
WP_007972925.1\|4449614_4450394_+	hypothetical protein	NA	NA	NA	NA
WP_088370744.1\|4450588_4451676_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8
WP_088409612.1\|4451908_4454695_+\|tail	phage tail length tape measure family protein	A0A2H4J7J3	uncultured_Caudovirales_phage	1.1e-43	26.4

DBSCAN-SWA_24

4667984 : 4686298

Pseudomonas_phage(56.25%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088409557.1\|4667984_4668905_-	hypothetical protein	Q6QID9	Burkholderia_phage	1.4e-22	32.5
WP_042806087.1\|4668919_4669225_-	hypothetical protein	NA	NA	NA	NA
WP_162269149.1\|4669221_4669377_-	hypothetical protein	NA	NA	NA	NA
WP_042806086.1\|4669376_4669610_-	hypothetical protein	NA	NA	NA	NA
WP_042806085.1\|4669606_4669816_-	hypothetical protein	NA	NA	NA	NA
WP_131454083.1\|4669916_4670378_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_042806082.1\|4670400_4670787_+	outer membrane protein assembly factor BamE	NA	NA	NA	NA
WP_042806080.1\|4670787_4671012_-	hypothetical protein	A0A1L2CVJ2	Pectobacterium_phage	2.9e-14	52.7
WP_042806114.1\|4671201_4671927_+	hypothetical protein	J9Q7Y7	Salmonella_phage	2.7e-37	49.2
WP_157883171.1\|4671923_4672343_+	hypothetical protein	NA	NA	NA	NA
WP_131469762.1\|4672380_4672626_+	hypothetical protein	NA	NA	NA	NA
WP_007974147.1\|4672622_4672934_+	hypothetical protein	Q5ZQY8	Pseudomonas_phage	8.3e-12	38.9
WP_042806113.1\|4672941_4673238_+	hypothetical protein	A0A0S4L0A3	Pseudomonas_phage	1.8e-32	63.3
WP_042806074.1\|4673242_4673794_+	DUF3486 family protein	Q6QIC2	Burkholderia_phage	4.0e-33	47.8
WP_007974143.1\|4673797_4675519_+	hypothetical protein	A0A219VH72	Ochrobactrum_phage	7.7e-99	41.9
WP_088409558.1\|4675515_4677045_+	DUF935 family protein	A0A0S4L5M4	Pseudomonas_phage	1.2e-164	58.4
WP_007974140.1\|4677048_4678323_+	hypothetical protein	J9STS2	Pseudomonas_phage	3.7e-82	60.9
WP_042806071.1\|4678322_4678898_+	phage virion morphogenesis protein	Q5ZQY1	Pseudomonas_phage	1.7e-31	47.9
WP_042806069.1\|4679113_4680262_+	hypothetical protein	A0A0S4L0J5	Pseudomonas_phage	2.7e-76	47.7
WP_042806067.1\|4680290_4680638_+	DUF2190 family protein	NA	NA	NA	NA
WP_007974137.1\|4680707_4681655_+	hypothetical protein	R9U4B8	Rhizobium_phage	6.6e-60	41.3
WP_088409559.1\|4681809_4682091_+	hypothetical protein	NA	NA	NA	NA
WP_007974136.1\|4682162_4682693_+	DUF1320 domain-containing protein	Q5ZQX5	Pseudomonas_phage	4.2e-32	41.9
WP_007974135.1\|4682689_4683160_+	hypothetical protein	A0A0S4L2X9	Pseudomonas_phage	3.5e-30	46.6
WP_042806063.1\|4683156_4683408_+	hypothetical protein	NA	NA	NA	NA
WP_007974134.1\|4683409_4684165_+	hypothetical protein	NA	NA	NA	NA
WP_007974133.1\|4684164_4684677_+	hypothetical protein	A0A0S4L2X3	Pseudomonas_phage	4.0e-19	39.4
WP_162829052.1\|4684718_4684859_+	hypothetical protein	NA	NA	NA	NA
WP_131469764.1\|4684886_4685147_+	hypothetical protein	NA	NA	NA	NA
WP_088370746.1\|4685211_4686298_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.9e-43	36.8

DBSCAN-SWA_25

4770329 : 4847801

Ralstonia_phage(33.33%)

plate,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007962146.1\|4770329_4771310_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_007967045.1\|4771704_4772436_-	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	1.4e-09	27.0
WP_022560281.1\|4772642_4773182_+	hypothetical protein	NA	NA	NA	NA
WP_007967050.1\|4773191_4773623_-	hotdog family protein	NA	NA	NA	NA
WP_007972218.1\|4773609_4775976_-	MMPL family transporter	NA	NA	NA	NA
WP_042676002.1\|4775965_4776193_-	hypothetical protein	NA	NA	NA	NA
WP_172955935.1\|4776316_4776937_-	fatty acyl CoA synthetase	NA	NA	NA	NA
WP_007967056.1\|4776887_4777862_-	acyltransferase	NA	NA	NA	NA
WP_022560285.1\|4777858_4778146_-	ACP dehydratase	NA	NA	NA	NA
WP_005914786.1\|4778157_4778907_-	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_162045091.1\|4778960_4779644_-	ketosynthase	NA	NA	NA	NA
WP_005914783.1\|4779681_4779951_-	acyl carrier protein	NA	NA	NA	NA
WP_007972213.1\|4780250_4781600_+	tryptophan 7-halogenase	NA	NA	NA	NA
WP_007967065.1\|4781596_4782604_+	hypothetical protein	NA	NA	NA	NA
WP_007972212.1\|4782803_4783148_+	hypothetical protein	NA	NA	NA	NA
WP_007967068.1\|4783196_4784540_-	acyl-CoA synthetase	NA	NA	NA	NA
WP_088409565.1\|4785112_4787473_+	S9 family peptidase	NA	NA	NA	NA
WP_042805648.1\|4787865_4788582_+	hypothetical protein	NA	NA	NA	NA
WP_007967074.1\|4788578_4789145_+	hypothetical protein	NA	NA	NA	NA
WP_007967076.1\|4789580_4790480_+	oxygen-dependent coproporphyrinogen oxidase	NA	NA	NA	NA
WP_007969091.1\|4790785_4791748_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_088409566.1\|4792398_4795203_-	DNA polymerase I	A0A218MKQ4	uncultured_virus	7.4e-67	30.1
WP_003487371.1\|4795279_4795570_+	DUF2782 domain-containing protein	NA	NA	NA	NA
WP_007970826.1\|4795880_4796924_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_088409567.1\|4796973_4804107_-	filamentous hemagglutinin N-terminal domain-containing protein	NA	NA	NA	NA
WP_042676013.1\|4804118_4805795_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_007970830.1\|4805791_4806253_-	hypothetical protein	NA	NA	NA	NA
WP_088409568.1\|4806249_4809939_-	protein kinase	Q0N495	Clanis_bilineata_nucleopolyhedrovirus	9.2e-09	29.9
WP_042805414.1\|4809943_4810660_-	serine/threonine-protein phosphatase	NA	NA	NA	NA
WP_033485573.1\|4810656_4811232_-	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_088409569.1\|4811228_4814768_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_042805829.1\|4814764_4816045_-	type VI secretion system protein TssL	NA	NA	NA	NA
WP_007967095.1\|4816026_4817361_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_007967097.1\|4817863_4818754_-	aldo/keto reductase family oxidoreductase	NA	NA	NA	NA
WP_082332431.1\|4819004_4819886_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_007967101.1\|4819944_4821270_-	type VI secretion system-associated FHA domain protein TagH	NA	NA	NA	NA
WP_007967103.1\|4821553_4822102_-	hypothetical protein	NA	NA	NA	NA
WP_007972985.1\|4822098_4824066_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	2.3e-38	28.5
WP_088409570.1\|4824215_4825547_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_007972988.1\|4825776_4826091_-	PAAR domain-containing protein	NA	NA	NA	NA
WP_007967112.1\|4828468_4829008_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_022560311.1\|4829357_4829885_+	RNA polymerase sigma factor	NA	NA	NA	NA
WP_007972993.1\|4829881_4830952_+	FecR domain-containing protein	NA	NA	NA	NA
WP_042805830.1\|4831417_4834303_+	TonB-dependent receptor	NA	NA	NA	NA
WP_007972997.1\|4834406_4835708_+	histidine-type phosphatase	NA	NA	NA	NA
WP_007967121.1\|4835778_4837083_+	hypothetical protein	NA	NA	NA	NA
WP_007973001.1\|4837700_4838444_-	hypothetical protein	NA	NA	NA	NA
WP_007973002.1\|4838848_4840876_-	hypothetical protein	NA	NA	NA	NA
WP_042805832.1\|4841188_4841452_+	hypothetical protein	NA	NA	NA	NA
WP_007969091.1\|4841663_4842626_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_007969091.1\|4842938_4843901_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_088409571.1\|4843960_4846705_-	type VI secretion system ATPase TssH	H6X3M6	Enterobacteria_phage	1.5e-80	29.1
WP_042805202.1\|4846760_4847801_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA

DBSCAN-SWA_26

4884767 : 4940757

Ralstonia_phage(75.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007975178.1\|4884767_4885712_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_088409576.1\|4886619_4887327_-	hypothetical protein	NA	NA	NA	NA
WP_007973941.1\|4887489_4888374_-	peptidylprolyl isomerase	NA	NA	NA	NA
WP_082336540.1\|4888442_4889453_-	glycerophosphodiester phosphodiesterase family protein	NA	NA	NA	NA
WP_007966464.1\|4890040_4891768_-	cation acetate symporter	NA	NA	NA	NA
WP_007966466.1\|4891764_4892082_-	DUF485 domain-containing protein	NA	NA	NA	NA
WP_007966468.1\|4892168_4893551_-	hypothetical protein	NA	NA	NA	NA
WP_022560344.1\|4893846_4895790_+	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	3.3e-82	37.4
WP_005914583.1\|4895965_4896634_+	response regulator transcription factor	NA	NA	NA	NA
WP_007973935.1\|4896935_4897844_-	DUF4424 domain-containing protein	NA	NA	NA	NA
WP_162045107.1\|4898405_4898969_+	redoxin family protein	NA	NA	NA	NA
WP_005922076.1\|4898972_4899176_+	hypothetical protein	NA	NA	NA	NA
WP_007973931.1\|4899381_4901001_-	family 43 glycosylhydrolase	NA	NA	NA	NA
WP_007962146.1\|4901186_4902167_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_088409577.1\|4902266_4902473_+	hypothetical protein	NA	NA	NA	NA
WP_007973929.1\|4902469_4903480_+	aldo/keto reductase	NA	NA	NA	NA
WP_007966479.1\|4903476_4904349_+	amidohydrolase family protein	NA	NA	NA	NA
WP_007973928.1\|4904345_4905116_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_007966483.1\|4905244_4906102_+	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_007973926.1\|4906311_4907634_+	L-fuconate dehydratase	NA	NA	NA	NA
WP_007966486.1\|4907898_4908258_-	L-rhamnose mutarotase	NA	NA	NA	NA
WP_007966490.1\|4909756_4910506_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_033481570.1\|4910949_4911534_+	manganese efflux pump MntP family protein	NA	NA	NA	NA
WP_007973922.1\|4911715_4915168_-	hybrid sensor histidine kinase/response regulator	NA	NA	NA	NA
WP_088409578.1\|4915891_4918534_+	glycosyl hydrolase 115 family protein	NA	NA	NA	NA
WP_088409579.1\|4918625_4921025_-	NdvB protein	NA	NA	NA	NA
WP_007966500.1\|4921027_4922410_-	MFS transporter	NA	NA	NA	NA
WP_042806021.1\|4922567_4923152_+	AAA family ATPase	NA	NA	NA	NA
WP_088409580.1\|4924002_4925733_+	PQQ-binding-like beta-propeller repeat protein	NA	NA	NA	NA
WP_005914565.1\|4926119_4926347_-	hypothetical protein	NA	NA	NA	NA
WP_007966506.1\|4926327_4926777_-	3-dehydroquinate dehydratase	NA	NA	NA	NA
WP_007973916.1\|4926787_4927216_-	hypothetical protein	NA	NA	NA	NA
WP_088409581.1\|4927476_4931331_-	translocation/assembly module TamB	NA	NA	NA	NA
WP_007973914.1\|4931327_4933115_-	outer membrane protein assembly factor	NA	NA	NA	NA
WP_088409582.1\|4934281_4935244_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_123768305.1\|4935491_4935680_-	hypothetical protein	NA	NA	NA	NA
WP_007962146.1\|4936093_4937074_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_007969091.1\|4937188_4938151_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_042806201.1\|4938189_4939458_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_007962146.1\|4939776_4940757_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6

DBSCAN-SWA_27

5038213 : 5122712

Ralstonia_phage(25.0%)

tail,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007962146.1\|5038213_5039194_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_005917020.1\|5039433_5040063_+	thymidine kinase	A0A023W530	Serratia_phage	3.3e-52	55.0
WP_007965298.1\|5040447_5041692_+	GAF domain-containing sensor histidine kinase	NA	NA	NA	NA
WP_007965295.1\|5041850_5043452_-	glucan biosynthesis protein D	NA	NA	NA	NA
WP_088409592.1\|5043520_5044636_-	DUF4380 domain-containing protein	NA	NA	NA	NA
WP_007965291.1\|5045162_5045978_-	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	A0A127AWE5	Bacillus_phage	5.4e-18	27.0
WP_007972253.1\|5052246_5053428_+	benzoate/H(+) symporter BenE family transporter	NA	NA	NA	NA
WP_042805659.1\|5053509_5055414_-	GAF domain-containing protein	B5LWN8	Feldmannia_species_virus	3.3e-18	28.2
WP_007964950.1\|5055410_5056004_-	biliverdin-producing heme oxygenase	NA	NA	NA	NA
WP_088370880.1\|5057821_5059984_-	lytic murein transglycosylase	NA	NA	NA	NA
WP_033481624.1\|5060168_5060375_-	hypothetical protein	NA	NA	NA	NA
WP_082336471.1\|5060567_5060954_-	YchJ family protein	NA	NA	NA	NA
WP_088409593.1\|5060990_5061860_+	TSUP family transporter	NA	NA	NA	NA
WP_007972260.1\|5061895_5065918_-	ATP-binding protein	NA	NA	NA	NA
WP_007962146.1\|5066317_5067298_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_022560433.1\|5067836_5068538_-	DUF4194 domain-containing protein	NA	NA	NA	NA
WP_007964964.1\|5068524_5069994_-	DUF3375 domain-containing protein	NA	NA	NA	NA
WP_003489347.1\|5070013_5070616_-	GTP cyclohydrolase I FolE	E7DN69	Pneumococcus_phage	3.1e-47	49.0
WP_007964968.1\|5070746_5071199_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_082332286.1\|5071287_5071506_+	DUF1656 domain-containing protein	NA	NA	NA	NA
WP_022560435.1\|5071502_5072435_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_007964972.1\|5072431_5073892_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_088409595.1\|5073888_5076222_+	FUSC family protein	NA	NA	NA	NA
WP_007964975.1\|5076460_5077822_-	MFS transporter	Q6JIH2	Burkholderia_virus	1.9e-31	27.1
WP_007964977.1\|5078574_5079477_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_007964979.1\|5079577_5080411_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_162269151.1\|5081240_5082506_+	cardiolipin synthase B	NA	NA	NA	NA
WP_007962146.1\|5082647_5083628_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-100	61.6
WP_007972266.1\|5083690_5084218_-	hypothetical protein	NA	NA	NA	NA
WP_022560440.1\|5084489_5084696_+	hypothetical protein	NA	NA	NA	NA
WP_088409596.1\|5084682_5085789_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_040964294.1\|5085994_5086483_-	hypothetical protein	NA	NA	NA	NA
WP_007969091.1\|5086801_5087764_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_088370882.1\|5087767_5088454_+	hypothetical protein	NA	NA	NA	NA
WP_050780439.1\|5089968_5090691_-	hypothetical protein	NA	NA	NA	NA
WP_088409597.1\|5091301_5094946_-	urea carboxylase	NA	NA	NA	NA
WP_088409598.1\|5095029_5096802_-	allophanate hydrolase	NA	NA	NA	NA
WP_007963580.1\|5097151_5097628_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_007963579.1\|5097690_5098260_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_042675021.1\|5098380_5098953_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_007963576.1\|5099037_5099781_+	glucose 1-dehydrogenase	A0A0M4JSW6	Mollivirus	2.3e-15	28.8
WP_003482333.1\|5101335_5101668_+	hypothetical protein	NA	NA	NA	NA
WP_088409599.1\|5101858_5103784_+	M61 family metallopeptidase	NA	NA	NA	NA
WP_042675015.1\|5103851_5104031_+	hypothetical protein	NA	NA	NA	NA
WP_007963549.1\|5104132_5105527_-	nucleoside hydrolase	NA	NA	NA	NA
WP_088370881.1\|5106098_5108510_-	AAA family ATPase	A0A0K2FLP8	Brevibacillus_phage	3.5e-09	23.4
WP_088370895.1\|5112762_5116167_-	exodeoxyribonuclease V subunit gamma	NA	NA	NA	NA
WP_173668639.1\|5116516_5121265_-	autotransporter domain-containing protein	F5B3Z3	Synechococcus_phage	3.3e-19	45.8
WP_007969699.1\|5121564_5122116_+\|tail	phage tail protein	NA	NA	NA	NA
WP_007968270.1\|5122184_5122712_+\|tail	phage tail protein	A0A0U4JYA4	Arthrobacter_phage	1.0e-09	28.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP011163

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection