CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP011407	Vibrio parahaemolyticus strain FORC_014 chromosome 2, complete sequence	1 crisprs	DEDDh,csa3,cas3	0	1
NZ_CP011406	Vibrio parahaemolyticus strain FORC_014 chromosome 1, complete sequence	0 crisprs	cas3,DinG,csa3,csx1,DEDDh,c2c9_V-U4,WYL	0	7
NZ_CP011408	Vibrio parahaemolyticus strain FORC_014 plasmid pFORC14, complete sequence	1 crisprs	NA	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP011407_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011407_1

68165-68262

Orphan

Consensus_repeat	Method
TATTTTTAAAATGCCTTTTCAAAAA	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of NZ_CP011407_1

>merge|NZ_CP011407|1|68165-68262|CRISPRCasFinder
TATTTTTAAAATGCCTTTTCAAAAATTTGAAACCGCGCAATTAAAGAATCCAGAAAAACAAGATCGCAATCAATATTTTTAAAACGCCTTTTCAAAAA

>NZ_CP011407|1|1|68165-68262|CRISPRCasFinder
TATTTTTAAAATGCCTTTTCAAAAA	TTTGAAACCGCGCAATTAAAGAATCCAGAAAAACAAGATCGCAATCAA
TATTTTTAAAACGCCTTTTCAAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011407.1\|WP_063517878.1\|70747_71659_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223730
NZ_CP011407.1\|WP_025508929.1\|64658_65369_-\|DNA-polymerase-III-subunit-epsilon	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|236392
NZ_CP011407.1\|WP_058964679.1\|60558_61398_-\|S-formylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|178061
NZ_CP011407.1\|WP_063517880.1\|75960_78189_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011407.1\|WP_005464959.1\|58560_59652_-\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|143635
NZ_CP011407.1\|WP_005464972.1\|63788_64658_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176159
NZ_CP011407.1\|WP_005460779.1\|70034_70670_+\|RpiB/LacA/LacB-family-sugar-phosphate-isomerase	unknown	unknown	gnl\|CDD\|181746
NZ_CP011407.1\|WP_005482884.1\|71757_72687_+\|sugar-kinase	unknown	unknown	gnl\|CDD\|238571
NZ_CP011407.1\|WP_063517879.1\|73507_75142_-\|transporter	unknown	unknown	gnl\|CDD\|271371
NZ_CP011407.1\|WP_079771557.1\|67323_68121_-\|DNA-binding-transcriptional-regulator-KdgR	unknown	unknown	gnl\|CDD\|185046
NZ_CP011407.1\|WP_005487072.1\|78489_80262_+\|Na+:solute-symporter	unknown	unknown	gnl\|CDD\|271371
NZ_CP011407.1\|WP_063517877.1\|69141_69666_+\|YgjV-family-protein	unknown	unknown	gnl\|CDD\|378474
NZ_CP011407.1\|WP_063517876.1\|68361_69123_+\|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD	unknown	unknown	gnl\|CDD\|181605
NZ_CP011407.1\|WP_005467181.1\|69673_69994_+\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380366
NZ_CP011407.1\|WP_005460834.1\|72698_73322_+\|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase	unknown	unknown	gnl\|CDD\|235577
NZ_CP011407.1\|WP_005464962.1\|61459_62608_-\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176260
NZ_CP011407.1\|WP_063517874.1\|58146_58551_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011407.1\|WP_005482867.1\|65371_67240_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|225457
NZ_CP011407.1\|WP_005482833.1\|59651_60113_-\|oxidoreductase	unknown	unknown	gnl\|CDD\|226429
NZ_CP011407.1\|WP_005464979.1\|62901_63708_+\|arylamine-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366312

Protein	Function_ID	Function_description	E-value
NZ_CP011407.1\|WP_063517878.1\|70747_71659_+\|alpha/beta-hydrolase	gnl\|CDD\|223730	COG0657, Aes, Esterase/lipase [Lipid metabolism].	2.83481e-18
NZ_CP011407.1\|WP_025508929.1\|64658_65369_-\|DNA-polymerase-III-subunit-epsilon	gnl\|CDD\|236392	PRK09146, PRK09146, DNA polymerase III subunit epsilon; Validated.	4.25942e-39
NZ_CP011407.1\|WP_058964679.1\|60558_61398_-\|S-formylglutathione-hydrolase	gnl\|CDD\|178061	PLN02442, PLN02442, S-formylglutathione hydrolase.	5.30907e-143
NZ_CP011407.1\|WP_005464959.1\|58560_59652_-\|GGDEF-domain-containing-protein	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	5.06677e-44
NZ_CP011407.1\|WP_005464972.1\|63788_64658_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176159	cd08470, PBP2_CrgA_like_1, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding domain. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 1. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.14139e-108
NZ_CP011407.1\|WP_005460779.1\|70034_70670_+\|RpiB/LacA/LacB-family-sugar-phosphate-isomerase	gnl\|CDD\|181746	PRK09273, PRK09273, hypothetical protein; Provisional.	2.15977e-144
NZ_CP011407.1\|WP_005482884.1\|71757_72687_+\|sugar-kinase	gnl\|CDD\|238571	cd01166, KdgK, 2-keto-3-deoxygluconate kinase (KdgK) phosphorylates 2-keto-3-deoxygluconate (KDG) to form 2-keto-3-deoxy-6-phosphogluconate (KDGP). KDG is the common intermediate product, that allows organisms to channel D-glucuronate and/or D-galacturinate into the glycolysis and therefore use polymers, like pectin and xylan as carbon sources.	1.15929e-102
NZ_CP011407.1\|WP_063517879.1\|73507_75142_-\|transporter	gnl\|CDD\|271371	cd11477, SLC5sbd_u1, Uncharacterized bacterial solute carrier 5 subfamily; putative solute-binding domain. SLC5 (also called the sodium/glucose cotransporter family or solute sodium symporter family) is a family of proteins that co-transports Na+ with sugars, amino acids, inorganic ions or vitamins. Prokaryotic members of this family include Vibrio parahaemolyticus glucose/galactose (vSGLT), and Escherichia coli proline (PutP) and pantothenate (PutF) cotransporters. One member of the SLC5 family, human SGLT3, has been characterized as a glucose sensor and not a transporter. This subfamily belongs to the solute carrier 5 (SLC5) transporter family.	3.56035e-96
NZ_CP011407.1\|WP_079771557.1\|67323_68121_-\|DNA-binding-transcriptional-regulator-KdgR	gnl\|CDD\|185046	PRK15090, PRK15090, DNA-binding transcriptional regulator KdgR; Provisional.	0
NZ_CP011407.1\|WP_005487072.1\|78489_80262_+\|Na+:solute-symporter	gnl\|CDD\|271371	cd11477, SLC5sbd_u1, Uncharacterized bacterial solute carrier 5 subfamily; putative solute-binding domain. SLC5 (also called the sodium/glucose cotransporter family or solute sodium symporter family) is a family of proteins that co-transports Na+ with sugars, amino acids, inorganic ions or vitamins. Prokaryotic members of this family include Vibrio parahaemolyticus glucose/galactose (vSGLT), and Escherichia coli proline (PutP) and pantothenate (PutF) cotransporters. One member of the SLC5 family, human SGLT3, has been characterized as a glucose sensor and not a transporter. This subfamily belongs to the solute carrier 5 (SLC5) transporter family.	5.61429e-121
NZ_CP011407.1\|WP_063517877.1\|69141_69666_+\|YgjV-family-protein	gnl\|CDD\|378474	pfam10688, Imp-YgjV, Bacterial inner membrane protein. This is a family of inner membrane proteins. Many of the members are YgjV protein.	4.92986e-49
NZ_CP011407.1\|WP_063517876.1\|68361_69123_+\|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD	gnl\|CDD\|181605	PRK08993, PRK08993, 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD.	0
NZ_CP011407.1\|WP_005467181.1\|69673_69994_+\|cupin-domain-containing-protein	gnl\|CDD\|380366	cd02238, cupin_KdgF, pectin degradation protein KdgF and related proteins, cupin domain. This family includes bacterial and archaeal pectin degradation protein KdgF that catalyzes the linearization of unsaturated uronates from both pectin and alginate, which are polysaccharides found in the cell walls of plants and brown algae, respectively, and represent an important source of carbon. These polysaccharides, mostly consisting of chains of uronates, can be metabolized by bacteria through a pathway of enzymatic steps to the key metabolite 2-keto-3-deoxygluconate (KDG). Pectin degradation is used by many plant-pathogenic bacteria during infection, and also, pectin and alginate can both represent abundant sources of carbohydrate for the production of biofuels. These proteins belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold.	1.13072e-54
NZ_CP011407.1\|WP_005464962.1\|61459_62608_-\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	gnl\|CDD\|176260	cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding.	0
NZ_CP011407.1\|WP_005460834.1\|72698_73322_+\|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase	gnl\|CDD\|235577	PRK05718, PRK05718, keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional.	4.28455e-121
NZ_CP011407.1\|WP_005482867.1\|65371_67240_-\|CBS-domain-containing-protein	gnl\|CDD\|225457	COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms].	2.84814e-139
NZ_CP011407.1\|WP_005482833.1\|59651_60113_-\|oxidoreductase	gnl\|CDD\|226429	COG3915, COG3915, Uncharacterized protein conserved in bacteria [Function unknown].	3.9997e-40
NZ_CP011407.1\|WP_005464979.1\|62901_63708_+\|arylamine-N-acetyltransferase	gnl\|CDD\|366312	pfam00797, Acetyltransf_2, N-acetyltransferase. Arylamine N-acetyltransferase (NAT) is a cytosolic enzyme of approximately 30kDa. It facilitates the transfer of an acetyl group from Acetyl Coenzyme A on to a wide range of arylamine, N-hydroxyarylamines and hydrazines. Acetylation of these compounds generally results in inactivation. NAT is found in many species from Mycobacteria (M. tuberculosis, M. smegmatis etc) to man. It was the first enzyme to be observed to have polymorphic activity amongst human individuals. NAT is responsible for the inactivation of Isoniazid (a drug used to treat Tuberculosis) in humans. The NAT protein has also been shown to be involved in the breakdown of folic acid.	3.12343e-97

>NZ_CP011407.1|WP_079771557.1|67323_68121_-|DNA-binding-transcriptional-regulator-KdgR
MKGATMEKSTQPEAVSSVLKVFHILQALGEQKAIGVSELSQRLMMSKATTYRFLQTMKSLGYVSQEGEADKYSLTLKLFELGAKSLEYVDLIELADKEMRHISEQTNEALHLGALDENAIIYIHKIDSGYNLRMQSRIGRRNPLYSTAIGKVLLSERDESFVRDVLSDVEFIKHTEKTLENTNQVLEELAKVRDFHYAVDNEEQEPGLRCIAAPIYDRFGQIIAGLSISFPTIRFDEERMEYYVGLLHQAGKNISEQLGYHDYPA
>NZ_CP011407.1|WP_005482867.1|65371_67240_-|CBS-domain-containing-protein
MGTSVTPNIFDFLIKIDPFDKLPEPVVESIANSVKVKYLVRGETIGFSALCDQRYLYIIRTGAIEQRTPNGELRARLGQDDQFGFTFLDPLENAEDGYQAEAIEDSLLYLIPHSELKLVSEEHPEFADYFAAQANVRLSSAVKYVCRKEEKGLFFRTVGEIASENIAIVDVNDSIRSVAQTMCGKQRSSCAVVMKEGEIIGLVTDRDMTKSVVAQDMDTNQPIADVMTPNPVLIEDDAKVIQAISLMLQYNIRCLPVVHGKQVKGLLTTTHLVHNHRTQSLFLIEKIKYASSLNALAALKEERQTIFQALVESGVSAEIQGRVMSMIMDAFTRRIIQLNEELLGPPPCDYAWLVAGSHARNEVHMLSDQDSAIVLSDDATEEHKLYFTHLAMRVCNGLAACGYPLCDGKYMAASPKWCQPIRRWKEYYQKWVASPEYNKLLSISVFLEVRAIHGNREFVDQIQQHLHDCIQKSPSFIPALVRDAIDTQPPLGIFNNLVLEKGGENSNTLNIKKYALNLIIDLARIFSLAAGGSLTGTEERFRYAAQHGTLSKDSVENIIGAYRFITQVRFRHQLNAILAGTTPDNHIAPDDFSSFERKHLKDAFKIISELQDVAKLKFVKGA
>NZ_CP011407.1|WP_025508929.1|64658_65369_-|DNA-polymerase-III-subunit-epsilon
MIKRWFKRWETPLSPEQKRQAIHVIDDWPMVLKDYLQQPLVDDSTTLKNLSFVALDFETTGVDAQGDKILSIGVVDLTLDGIDIASSKEWYICHGQFIKPETAKINGLTPQDLAKGLPLDEGMNRLLERITGKVVLAHGCCIEKAFIHAYFSSRYQVEDFPAYFIDTLQIEKQFSYAGKSGAHSSYQLDDLRRYYHLPGYLSHSAASDALACAELFLVQSKKLTALPDVTLRQLMR
>NZ_CP011407.1|WP_005464972.1|63788_64658_+|LysR-family-transcriptional-regulator
MANWEGVSEFVAVAETNSFTGAAAKLKTSVAQISRRVSALEERLAVKLLHRTTRKVSLSEAGQLYYQQCKHLVEGLELAELAVTQMQTEPRGLLRVTAPVTYGEMNLAPLLHQFLEKYPRVDLDLVLTNQKLDLIEQGVDVAIRLGRLQDSSMIAKRLSSRQTYVCASPMYLERFGEPHTLSELGRHQCLVGSVDYWHFKENKRDKSLRVSGRIKCNSGFALVDAAKRGLGLVQLPDYYVQEALDSGELVEVLTDYRDDREGIWALYPQSRNLSPKVRLLIDFLAQELA
>NZ_CP011407.1|WP_005464979.1|62901_63708_+|arylamine-N-acetyltransferase
MNKTDLNAYLTKLGLPSELPADLESLHKIHVAQHRCLPFENFDISLQRGISVEIEDIIQKTVYHSRGGYCFELNGLMLDVLKTLGFEARSLLGRVHVMGTPTGRSHQITLVTLDEQAWIVDVGFGSNTPRAPLPFILNQVIQTDLQTFRFVEDAQFGYFLQVLSTDGTDTWNNLYSFDLEFVFAGDIACGNFFTSTSPNSRFTSARVAAKATESGLVTLLNYTLKYTSQGEQTELELEPGQAYLDALKEYFGIELDAQYGDLRPLPDA
>NZ_CP011407.1|WP_005464962.1|61459_62608_-|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase
MTLEIKPGQTHIKSKAMVAWAAGEPLKMEEVDVQLPKAGEVLVRIVATGVCHTDAFTLSGDDPEGIFPSILGHEGGGIVEMVGEGVTSVEVGDHVIPLYTAECGECKFCKSGKTNLCQAVRETQGKGLMPDGTSRFSINGETIFHYMGCSTFSEYTVLPEISLAKVNKQAPLEEVCLLGCGVTTGMGAVLNTAKVEKGDTVAIFGLGGIGLSAIIGARMAGASRIIGIDINESKFDLAKQLGATDVINPQKFDKPIQEVIVEMTDGGVDYSFECIGNVNVMRQALECCHKGWGESVIIGVAGAGQEISTRPFQLVTGRVWRGSAFGGVKGRSELPEIVNRYMAGEFGLQEFITHTMGLEDVNKAFDLMHEGKSIRTVIHMDK
>NZ_CP011407.1|WP_058964679.1|60558_61398_-|S-formylglutathione-hydrolase
MTIENVSQTKVFGGWHKQYTHDSKALNCTMRFAIFLPPNATKSNPVPALYWLSGLTCTDENFMQKACAFRMAAELGIAIIAPDTSPRGEGVADDASYDLGQGAGFYLNATQAPWSLHYHMYDYVTQELPAIIEANFPVSDVKSISGHSMGGHGALTIGLKNPTIYRSISAFSPISNPMQCPWGQKAFTAYLGTDIESWKQYDASELLKKEKSPLPILVDQGDADGFLSEQLKPEVLLAAAKQHGSELNLRMQSGYDHSYYFISSFIDNHLNFHAKYLFA
>NZ_CP011407.1|WP_005482833.1|59651_60113_-|oxidoreductase
MKKIVSLSLLLFAPFLSANSITFSSPQQPSVTLKLEELQSLPTTSYTTDLPWIQQSSEFLGVKLSTLLTHVYGSIPEQVDIGSLNNYHSTLSRKDIVRYQPILAYQQDHHYIKVRNKGPYWVIYPLSQYPELDHNEYHAQMVWQVNEMKIKQK
>NZ_CP011407.1|WP_005464959.1|58560_59652_-|GGDEF-domain-containing-protein
MKLSEAYPIKQKNYSTTSKMLLLVFATSLLLANVILLQQTRVLAQSFTDEQKQATWFLFQLSKELSELVSEARRLDENVLKIEGAELQYELAWSRFDLLINSKDVYTFFSRNHIQQYFLQLFNEFKELEPLLVEAKTGDSQAAAQFYRATQTLYLNLVEFVNQNFRLTSQVYETQKDESQRLMKAQYMLFATFVLSILSLTYFFYRESHFHRKLALSDPLTGLGNRNALFVTLRNNTRNRTAFSLCLLDLNGFKNVNDTYGHQAGDTVLCEIAKRLKDMNIDSFSTYRMGGDEFAVVIESSDVDAEEAKKHIHSVFDTPVLNANNVSSLSTSIGVAHYPSDSDNVDFLISIADKRMYKMKFQR
>NZ_CP011407.1|WP_063517874.1|58146_58551_-|hypothetical-protein
MMRKFMQVLLLLAVIAAGVLAWVFIPSHETIGQKTLEQALNDDYSLVGHRIYSTDPDAGNRFGYFVLATGQSIEEQEPFLVTSDQFIRMEQTGDNTLSVTVNGRIYQYHNDLWVPKPDGKLQHFLVSATANYVR
>NZ_CP011407.1|WP_063517876.1|68361_69123_+|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD
MILDSFNLEGKVAIVTGCDTGLGQGMALGLAKAGCDIVGVNISEPTETIEKVEAEGRKFVDIRANLMKLDDIPTIVDRAVTELGRIDILVNNAGIIRRNDAIEFSEQDWDDVMNINVKSVFFMSQAVAKQFIAQGEGGKIINIASMLSFQGGIRVPSYTASKSGVMGVTRLMANEWASHGINVNAIAPGYMATNNTAALRADEQRNKEIIDRIPAARWGTPEDLAGPCVFLASKAADYINGYTIAVDGGWLAR
>NZ_CP011407.1|WP_063517877.1|69141_69666_+|YgjV-family-protein
MVDTTILAQALGFISFGLGFSVFYQKNDRHLKILMLIFNLNHLLHFLLLGSMVSALSALLSALRTTTAIFVSSKLVAAVFIVISLVSGFWVAEQWRDLWPIIGTVIGTYSVFCLSGIRMRIGFLLGASCWLTNNILVGSIGGTLLEMTVIVMNLLTIYRLYRQQSESMINQSSY
>NZ_CP011407.1|WP_005467181.1|69673_69994_+|cupin-domain-containing-protein
MFVFNQDIPMEDLGEGISRKVLAHSDNMMSVEVHFEEGAIGAMHSHPHEQLTYVLSGEFEFTIGDEKKIVKTGDTMYKEPNIEHGCVCLKAGVLIDTFTPMRKDFV
>NZ_CP011407.1|WP_005460779.1|70034_70670_+|RpiB/LacA/LacB-family-sugar-phosphate-isomerase
MKIALMMENSQAAKNAMVAGELNSVAGGLGHDVFNVGMTDENDHHLTYIHLGIMASILLNSKAVDFVVTGCGTGQGALMSCNLHPGVVCGYCLEPSDAFLFNQINNGNAISLAFAKGFGWAGELNVRYIFEKAFTGKRGEGYPIERAAPQQANAAILNNVKSAVAKDVVEGLRAIDQELVKTAVGSTQFQECFFAHCQVPEIAEYVKSLLD
>NZ_CP011407.1|WP_063517878.1|70747_71659_+|alpha/beta-hydrolase
MHVAPITSLQTWFPEHLVLPLWSEPQIPSHLVQSYQERNPNELLPDRAVFEITHPEIVVFEPEQSNGIGILLMPGGGYQRVSVDKEGADSARVLNQAGFTVFVMTYRMPNEGHEFGAWTPLADAQRAMRLVRQLPLASHLSSIGVLGFSAGGHVAASLATSHALDIYPLQDEADRVSAKPDFCALMYPVISMNTDIAHMGSRAELLANLERESDLLRFSLEKQVTSDMPPCFLLHASDDTAVSAENSLVFWQALRQHEISTEMHLFEQGKHGFGIRDAQGLPVAAWPQLLSAWLQNLAEKARR
>NZ_CP011407.1|WP_005482884.1|71757_72687_+|sugar-kinase
MNPISRVAIIGECMVELKKHDGVLQQGFGGDTLNTAVYLSRLTKQHGVETSYVTGLGHDPFSREMLTAWREEGINTDMVYLSEDKLPGIYAIETAEDGERSFFYWRNDAAAKYWLRERALLSLVKDLCQHQMIYLSGISLAIISDDCRQMLIELLTMCRKEGVKIAFDNNFRPKLWPNIEQARDFYSKILSVTDMAFLTFDDEVMLWGDKHEDEAISRTKNFGVKEIIVKRGADDCFVVTQDQQHTVAALKVDAVVDTTAAGDSFSAGYLAKRILGGDVAESALAGHKVAGTVIQHRGAIIPSQAMPTI
>NZ_CP011407.1|WP_005460834.1|72698_73322_+|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase
MKDLNQQLSEIKVVPVIAIKDAGKAVKLAQVLIENGLPCAEVTFRTEDAALAIKNMREAYPEMLIGAGTVLTSAQVDEAIDAGVDFIVSPGFNPTTVKYCQQRNVTIVPGVNNPSLVEQAMEMGLRTLKFFPAEPSGGVAMLKALSAVYPVKFMPTGGVSPSNVKDYLSISSVLACGGTWMVPGDLIDNEQWDELAKLVREVAGIIE
>NZ_CP011407.1|WP_063517879.1|73507_75142_-|transporter
MTLLDSMIVMIYLLFIGIAAWLFRRFSTSSNDFLQGGGTMMWWMAGATAFMTQFSAWTFTGAAAKAYEDGISVMFIFWGNALGFFVAAAFFARRYRRLRVETAMEVIRVRFGHTSEQLFTWLSFPLTLIAVSGGAWTVSVTNVIQLILLIAITLVIGYTALQRFDSPSEVFAYTTPIYGEQIRMPSLFVMWAIAMLLQQTMSNNHTLSCYRFLTTANDKDATKAAFVAGVLFVFAPVLWFMPAWFVAAQNIDLLAIYPALEQSANNAAYLYYIQHYMPQGLLGLVMVALVAATIAPLSSAHNRNAGIVVKSLYQVWFNPNATSRQQLMVGKIATIVSGILATVTALLLASVESYSLFDMMIVFAAFIQMPINIPSLLALVSLKTPNWSGWATVMVGCAVSLFMMFIFDVQWLSSSPLTPRESKDLSVVATLAVHLLVTGCFFLFTRVFYAKEPPSIQQSRTALAIQLATPISDEEQSPINHKQGLYVGSITALAGMLLILAGVVLAGSSQSIFVAIGCIVLLFSLFLLQPTLHSKRAWQKQRTK
>NZ_CP011407.1|WP_063517880.1|75960_78189_+|hypothetical-protein
MKKHTLALCLAAILAPAAHAAEIKVEDLTWKAITFGQSTDMNFGSTILPEKVGVNQVTVNGEAVAAGKLASTFTIESRGGKLANSHEGLSFYYTELPTDVNFTLSADVVLEQLGPETGATPNRQEGAGLMVRDILGAERLVPQPEGHEEFPSASNMVMNLMRSHTRANDGMTNINASFREGVYQPWGTPGNRLSRVDYVEGVPYGTAETYRMTLTRTNDGFKVSYRNGEKFVEQAVKGANANIVEMQNSDSQYVGFFASRNAKMTVSNVDLQLAAADTVDAPKYAAKQGELVFQIASSPRSATKEYPVQARANYSGEFEVLHNGKVVAKQTVTAGELFSQWLTLDSGANQMEVRFTAIDGPNKETQAHRYSVDVVSLPDPMTLYVAPNGSDKGNGSQAQPLDFATAVELLPAGGTIILKDGDYQGMEIPLTASGSVDKLKHLRAEGDNVRFVSELRHEANYWHYQGIEVAGAQFIVHGSHNTFEKMVTHGAPDTGFVITSPENIGRALWASYNQVIESESYNNMDPSQINADGFAAKMRIGDGNTFIRCLSHHNIDDGWDLFNKVEDGANGAVTILDSISFSNGRTLDVANKGGTIGNGFKLGGEGIPVPHVVKNSLSFNNNMDGFTDNFNPGALVLSDNVSIDNKRFNYLFRKSPYSGEIEQGTFTNNRSYRFHVSSKYDDVINSAKSTGNALVENGTTYTSDGKAVDSKMLAPLKQASVIDTQQAIPGKQEAMQLKQLIH
>NZ_CP011407.1|WP_005487072.1|78489_80262_+|Na+:solute-symporter
MEYDYLVIAGYFALMVAISLLFKKMASNSTSDYFRGGGKMLWWMVGATAFMTQFSAWTFTGAAGKAFNDGFAVLAVFVGNMVAYVFAYFYFARRFRQMRVDTPTEGVKRRFGNTNEQFFTWVIIPLSVINAGVWLNGLGVFASAVFNADIVTTIWVTGLAVLAISLLSGAWGVVASDFIQTLVVAVISIACAAVALYVVGGPGEIVENFPGGFIMGPDMNYPLLLVCTFIFFVVKQLQSINNMQESYRFLNAKDSKNASKAALMALVMMLFGAVIWFIPPWASAILYPDAATQYSSLGAKASDAVYLVFARETMPLGTVGLLMAGLFAATMSSMDSALNRNSGIFVRSFYSNIVRKGQASDKELLRAGQIACLVNGILVIMMAQFFNSLKHLSLFDLMMQVATLLQSPILVPLFLGIIIRRTPKWAPWATVVVGMFVSWSVVKIFTPEFVGSWFGMDELTRREAGEMRTMITIAAHLVFTAGFFCLSTLFYKEETDTHKETTAEFFKDVDTECVAEEGQDIVDRMQRAKLGTLVIYMAAGLTLMVLIPNPLWGRLLFLACAASVFAVGYGLKKSAKLDTQPSKVAATTTQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1091391 : 1097985

Vibrio_phage(100.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021483992.1\|1091391_1091760_-	phage related family protein	A0A1W6UGD7	Vibrio_phage	1.3e-61	100.0
WP_063518144.1\|1091949_1092255_+	hypothetical protein	NA	NA	NA	NA
WP_063518145.1\|1092254_1092527_+	hypothetical protein	NA	NA	NA	NA
WP_043048356.1\|1092526_1092727_+	hypothetical protein	C3W4P3	Vibrio_phage	5.1e-23	75.4
WP_043048353.1\|1092716_1093817_+	replication initiation factor family protein	Q8W6E3	Vibrio_phage	2.3e-157	76.1
WP_063518146.1\|1093788_1094124_+	DUF1293 domain-containing protein	Q858R2	Vibrio_phage	4.9e-34	65.8
WP_005376279.1\|1094126_1094372_+	hypothetical protein	R9TMT7	Vibrio_phage	4.8e-07	43.9
WP_048626399.1\|1094400_1094592_+	hypothetical protein	G8IRU8	Vibrio_phage	8.4e-07	53.2
WP_063518147.1\|1094726_1096220_+	hypothetical protein	NA	NA	NA	NA
WP_005376274.1\|1096219_1096552_+	hypothetical protein	NA	NA	NA	NA
WP_063518148.1\|1096557_1097985_+	toxin	R9TQ09	Vibrio_phage	1.1e-122	51.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP011406

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

798797 : 805499

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025592817.1\|798797_799937_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	6.5e-62	41.4
WP_017448803.1\|799954_801205_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	2.1e-98	47.9
WP_005482986.1\|801332_801782_+	transcriptional regulator NrdR	NA	NA	NA	NA
WP_015296329.1\|801789_802914_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	1.8e-48	36.0
WP_005483039.1\|802926_803580_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.6e-33	37.5
WP_005496254.1\|803749_804859_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.5e-63	39.6
WP_005440184.1\|805028_805499_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.7e-32	49.3

DBSCAN-SWA_2

1154706 : 1234899

Vibrio_phage(68.89%)

terminase,head,tRNA,portal,tail,integrase,capsid,protease

attL 1155489:1155513|attR 1190754:1190778

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005481860.1\|1154706_1155513_-	exodeoxyribonuclease III	A0A0N9QXX6	Chrysochromulina_ericina_virus	3.9e-13	28.2
1155489:1155513	attL	NA	NA	NA	NA
WP_063517278.1\|1155646_1156669_-\|integrase	tyrosine-type recombinase/integrase	R9TMQ4	Vibrio_phage	1.3e-101	54.7
WP_063517279.1\|1156655_1158101_-	hypothetical protein	R9TRQ8	Vibrio_phage	1.5e-164	62.5
WP_063517280.1\|1158293_1159880_-	DUF4041 domain-containing protein	A0A142LP25	Marinitoga_camini_virus	1.3e-79	63.8
WP_063517281.1\|1159914_1160565_-	phage repressor protein CI	R9TR74	Vibrio_phage	9.3e-82	68.6
WP_045588167.1\|1160712_1160925_+	hypothetical protein	R9TMQ7	Vibrio_phage	1.2e-22	75.7
WP_063517282.1\|1161036_1161576_+	transcriptional regulator	U3PIJ8	Vibrio_phage	4.7e-55	59.8
WP_029559288.1\|1161585_1161921_+	hypothetical protein	NA	NA	NA	NA
WP_063517283.1\|1161988_1162633_+	hypothetical protein	R9TNP8	Vibrio_phage	2.5e-18	37.1
WP_063517284.1\|1162629_1163037_+	hypothetical protein	A0A2I7RNG1	Vibrio_phage	4.4e-37	60.2
WP_063517285.1\|1163047_1163590_+	hypothetical protein	U3PDF3	Vibrio_phage	1.4e-83	82.3
WP_079771525.1\|1163688_1166244_+	replication endonuclease	A0A166YHE2	Vibrio_phage	7.4e-308	64.5
WP_063517286.1\|1166313_1166823_-	DUF2335 domain-containing protein	S5WJ01	Leptospira_phage	7.2e-05	32.7
WP_063517287.1\|1166809_1167193_-	hypothetical protein	NA	NA	NA	NA
WP_154020290.1\|1167989_1168241_+	hypothetical protein	U3PDF9	Vibrio_phage	1.2e-16	65.7
WP_079771420.1\|1168242_1168494_-	ogr/Delta-like zinc finger family protein	R9TNQ2	Vibrio_phage	6.6e-36	86.7
WP_154020277.1\|1168711_1168861_+	hypothetical protein	NA	NA	NA	NA
WP_063517289.1\|1168904_1169930_-\|portal	phage portal protein	A0A2I7RNI9	Vibrio_phage	1.4e-148	75.1
WP_063517290.1\|1169926_1171702_-\|terminase	terminase	A0A2I7RNI3	Vibrio_phage	5.7e-307	90.2
WP_063517291.1\|1171868_1172726_+\|capsid	phage capsid protein	A0A2I7RNH1	Vibrio_phage	9.4e-90	69.3
WP_063517292.1\|1172725_1173730_+\|capsid	phage major capsid protein, P2 family	R9TPZ5	Vibrio_phage	8.7e-111	63.4
WP_063517293.1\|1173742_1174468_+\|terminase	terminase endonuclease subunit	U3PCG2	Vibrio_phage	6.3e-95	70.3
WP_063517294.1\|1174583_1175003_+\|head	head protein	A0A2I7RNH7	Vibrio_phage	2.6e-53	77.0
WP_063517295.1\|1174999_1175491_+\|tail	phage tail protein	A0A2I7RNH2	Vibrio_phage	2.3e-77	86.9
WP_063517296.1\|1175474_1176131_+	hypothetical protein	A0A2I7RNI6	Vibrio_phage	4.7e-97	81.2
WP_063517297.1\|1176134_1177265_+	DUF2586 family protein	A0A2I7RNI8	Vibrio_phage	3.1e-181	84.0
WP_025605246.1\|1177268_1177718_+	DUF2597 family protein	A0A2I7RNI0	Vibrio_phage	9.6e-78	96.0
WP_031856783.1\|1177730_1177949_+	molecular chaperone DnaK	A0A2I7RNJ6	Vibrio_phage	1.2e-22	73.5
WP_063517298.1\|1177945_1178443_+	hypothetical protein	A0A2I7S7C4	Vibrio_phage	2.0e-23	49.6
WP_063517299.1\|1178439_1178670_+	hypothetical protein	W6B371	Vibrio_phage	3.5e-07	42.9
WP_045607483.1\|1178672_1178957_+	hypothetical protein	NA	NA	NA	NA
WP_047508669.1\|1178953_1179217_+	hypothetical protein	A0A1D9C9R9	Salinivibrio_phage	1.7e-18	55.3
WP_154020278.1\|1179234_1179399_+	hypothetical protein	Q1I0Y8	Pasteurella_virus	9.4e-07	45.3
WP_063517300.1\|1179410_1181297_+\|tail	phage tail tape measure protein	A0A1D9C9V3	Salinivibrio_phage	3.9e-221	59.0
WP_025589745.1\|1181296_1181638_+	DUF2590 family protein	A0A2I7RNH9	Vibrio_phage	4.0e-44	80.9
WP_063517301.1\|1181637_1182825_+	hypothetical protein	A0A2I7RNJ7	Vibrio_phage	2.9e-190	81.0
WP_063517302.1\|1182811_1183414_+	hemolysin	A0A2I7RNJ4	Vibrio_phage	1.7e-98	82.5
WP_063517304.1\|1186492_1187029_+	hypothetical protein	A0A2I7RNK5	Vibrio_phage	2.1e-63	70.6
WP_063517305.1\|1187038_1187728_+	hypothetical protein	A0A2I7RNK1	Vibrio_phage	1.0e-102	73.7
WP_063517306.1\|1187718_1188390_+	hypothetical protein	A0A2I7RNK2	Vibrio_phage	4.5e-95	73.6
WP_063517307.1\|1188486_1189578_-	acyltransferase	A0A2H4JA46	uncultured_Caudovirales_phage	2.2e-11	24.7
WP_063517308.1\|1189748_1189946_+	hypothetical protein	A0A2I7RNJ8	Vibrio_phage	3.9e-15	68.8
WP_005456217.1\|1190868_1191033_-	pleiotropic regulatory protein RsmS	NA	NA	NA	NA
1190754:1190778	attR	NA	NA	NA	NA
WP_005456195.1\|1191032_1191578_-	prepilin peptidase	NA	NA	NA	NA
WP_005456200.1\|1191574_1192360_-	TSUP family transporter	NA	NA	NA	NA
WP_063517309.1\|1192374_1194450_-	ATP-dependent DNA helicase DinG	A0A127AW80	Bacillus_phage	1.2e-45	25.6
WP_021449333.1\|1194964_1195990_+	porin	NA	NA	NA	NA
WP_025605441.1\|1196066_1196744_+	DUF2057 domain-containing protein	NA	NA	NA	NA
WP_063517310.1\|1196856_1197555_-	pseudouridine synthase	NA	NA	NA	NA
WP_005456197.1\|1197866_1200092_+	NADP-dependent isocitrate dehydrogenase	NA	NA	NA	NA
WP_011105762.1\|1200222_1200462_-	cold shock domain-containing protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	1.4e-14	56.7
WP_005456259.1\|1201140_1201461_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	1.1e-14	46.9
WP_005495889.1\|1201508_1203779_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.7e-167	43.3
WP_063517311.1\|1203912_1204953_+	serine hydrolase	NA	NA	NA	NA
WP_001040192.1\|1205021_1205240_-	translation initiation factor IF-1	NA	NA	NA	NA
WP_025577953.1\|1205321_1206023_-	arginyltransferase	NA	NA	NA	NA
WP_063517312.1\|1206019_1206730_-\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_020904016.1\|1206766_1207246_+	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
WP_063517313.1\|1207407_1208688_+	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_063517314.1\|1208745_1208994_-	YciN family protein	NA	NA	NA	NA
WP_063517315.1\|1209459_1212090_+	type I DNA topoisomerase	A0A2K9L1Q2	Tupanvirus	9.6e-85	33.9
WP_025532764.1\|1212686_1213904_+	glucose-1-phosphate adenylyltransferase	A0A1D7XFC1	Escherichia_phage	2.9e-07	28.2
WP_079771421.1\|1213893_1215351_+	glycogen synthase GlgA	NA	NA	NA	NA
WP_005495870.1\|1215473_1216277_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_021485379.1\|1216318_1216639_-	hypothetical protein	NA	NA	NA	NA
WP_020840339.1\|1216638_1217331_-	TVP38/TMEM64 family protein	NA	NA	NA	NA
WP_005457243.1\|1217542_1218133_-	TfoX/Sxy family DNA transformation protein	NA	NA	NA	NA
WP_005457245.1\|1218605_1219610_-	HTH-type transcriptional repressor PurR	NA	NA	NA	NA
WP_063517317.1\|1220047_1220695_-	molecular chaperone TorD	NA	NA	NA	NA
WP_005457237.1\|1220960_1221674_+	two-component system response regulator TorR	W8CYM9	Bacillus_phage	1.3e-23	31.6
WP_005457224.1\|1221743_1222529_-	envelope biogenesis factor ElyC	NA	NA	NA	NA
WP_029803718.1\|1222643_1223435_+\|tRNA	tRNA uridine 5-oxyacetic acid(34) methyltransferase CmoM	NA	NA	NA	NA
WP_005483103.1\|1223437_1224775_+	chromosome partition protein MukF	NA	NA	NA	NA
WP_011105765.1\|1224734_1225481_+	chromosome partition protein MukE	NA	NA	NA	NA
WP_025543151.1\|1225483_1229947_+	chromosome partition protein MukB	NA	NA	NA	NA
WP_005457235.1\|1230115_1230268_-	hypothetical protein	NA	NA	NA	NA
WP_005457241.1\|1230470_1231439_-	alpha-L-glutamate ligase-like protein	NA	NA	NA	NA
WP_005495851.1\|1231442_1232948_-	inactive transglutaminase family protein	NA	NA	NA	NA
WP_005457212.1\|1232959_1233706_-\|protease	ATP-dependent zinc protease	NA	NA	NA	NA
WP_011105768.1\|1233653_1233815_+	hypothetical protein	NA	NA	NA	NA
WP_005483112.1\|1233927_1234899_-\|tRNA	tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB	NA	NA	NA	NA

DBSCAN-SWA_3

1367367 : 1377181

Mycobacterium_phage(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_063517345.1\|1367367_1370454_+	hypothetical protein	A0A218M9A2	Mycobacterium_phage	3.8e-88	49.9
WP_023585423.1\|1370528_1371155_+	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_005495763.1\|1371161_1372511_+	replication-associated recombination protein A	G3MBE0	Bacillus_virus	1.1e-84	42.1
WP_005495761.1\|1372602_1373910_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.2e-90	42.8
WP_029816223.1\|1374112_1375012_+	DUF3380 domain-containing protein	K4RM41	Pseudomonas_phage	1.3e-36	43.5
WP_063517347.1\|1375564_1375831_+	DksA/TraR family C4-type zinc finger protein	A0A1S6UBD1	Serratia_phage	6.2e-16	46.6
WP_063517348.1\|1375900_1377181_-	adenosylmethionine--8-amino-7-oxononanoate transaminase	A0A1V0SKB7	Klosneuvirus	4.3e-22	26.7

DBSCAN-SWA_4

1816982 : 1828520

Vibrio_phage(91.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_063517466.1\|1816982_1818713_+	response regulator	A0A1V0SGX0	Hokovirus	2.7e-43	31.3
WP_063517467.1\|1818880_1819249_-	antirepressor	Q9MCC3	Vibrio_phage	1.1e-58	96.7
WP_063517468.1\|1819407_1820019_+	hypothetical protein	A0A1W6UG66	Vibrio_phage	6.0e-107	98.0
WP_012842282.1\|1820015_1820231_+	hypothetical protein	A0A1W6UGD1	Vibrio_phage	2.6e-33	98.6
WP_079771461.1\|1820154_1821363_+	phage replication protein	Q783T8	Vibrio_phage	1.7e-241	98.0
WP_017822035.1\|1821366_1821720_+	DUF1293 domain-containing protein	A0A1W6UG87	Vibrio_phage	2.2e-61	100.0
WP_063517470.1\|1821731_1821977_+	single-stranded DNA-binding protein	A0A1W6UH23	Vibrio_phage	3.4e-37	98.8
WP_017447548.1\|1821987_1822221_+	membrane protein	A0A1W6UG80	Vibrio_phage	1.7e-30	98.7
WP_063517471.1\|1822354_1823830_+	methyl-accepting chemotaxis protein	A0A1W6UG63	Vibrio_phage	1.4e-218	99.2
WP_015975177.1\|1823831_1824146_+	DUF2523 domain-containing protein	O88125	Vibrio_phage	8.0e-47	100.0
WP_063517472.1\|1824142_1825285_+	assembly protein	O88128	Vibrio_phage	2.5e-215	99.5
WP_063517473.1\|1825705_1826524_+	toll/interleukin-1 receptor domain-containing protein	NA	NA	NA	NA
WP_063517474.1\|1826704_1827535_+	hypothetical protein	NA	NA	NA	NA
WP_063517475.1\|1827568_1828120_+	hypothetical protein	NA	NA	NA	NA
WP_063517476.1\|1828154_1828520_-	phage protein	Q9MCC4	Vibrio_phage	6.6e-61	93.4

DBSCAN-SWA_5

2137489 : 2204703

Vibrio_phage(54.84%)

integrase,capsid,transposase

attL 2134579:2134599|attR 2207899:2207919

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2134579:2134599	attL	NA	NA	NA	NA
WP_060658550.1\|2137489_2138452_+\|integrase	integron integrase	A0A0K2CP59	Brevibacillus_phage	8.5e-15	25.4
WP_025441687.1\|2138502_2138976_-	DUF2947 domain-containing protein	NA	NA	NA	NA
WP_025533804.1\|2138989_2139577_-	HD domain-containing protein	NA	NA	NA	NA
WP_025548004.1\|2139578_2140163_-	ribosomal protein S5-alanine N-acetyltransferase	NA	NA	NA	NA
WP_025623183.1\|2140199_2141744_-	transcriptional regulator TyrR	NA	NA	NA	NA
WP_063517601.1\|2141844_2142885_-	TIGR01620 family protein	NA	NA	NA	NA
WP_063517602.1\|2142881_2144258_-	YcjX family protein	NA	NA	NA	NA
WP_005458825.1\|2144469_2144655_-	hypothetical protein	NA	NA	NA	NA
WP_063517603.1\|2144829_2146347_-	fumarate hydratase	NA	NA	NA	NA
WP_011105977.1\|2146350_2146440_+	hypothetical protein	NA	NA	NA	NA
WP_063517605.1\|2146618_2147983_+	aminodeoxychorismate synthase component I	S4VT78	Pandoravirus	3.6e-43	33.5
WP_025501223.1\|2148121_2149822_-	response regulator	A0A1V0SGX0	Hokovirus	6.7e-47	32.2
WP_015296942.1\|2149829_2150369_-	guanylate cyclase-related protein	NA	NA	NA	NA
WP_005458814.1\|2150653_2151253_+	CoA pyrophosphatase	NA	NA	NA	NA
WP_005458812.1\|2151607_2152861_+	serine transporter	NA	NA	NA	NA
WP_021823429.1\|2152959_2154321_+	L-serine ammonia-lyase	NA	NA	NA	NA
WP_025635704.1\|2154624_2156340_+	EAL domain-containing protein	NA	NA	NA	NA
WP_079400447.1\|2156411_2156990_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_079771546.1\|2157072_2157486_-	6-carboxytetrahydropterin synthase QueD	S4U060	uncultured_phage	4.6e-10	38.6
WP_154020284.1\|2157744_2157906_-	hypothetical protein	NA	NA	NA	NA
WP_063517607.1\|2158376_2158985_+	Rha family transcriptional regulator	A0A0P0HSR5	Acinetobacter_phage	2.9e-24	46.0
WP_154020285.1\|2159033_2159597_-	hypothetical protein	NA	NA	NA	NA
WP_114139936.1\|2159650_2160773_+\|transposase	IS3-like element ISVpa4 family transposase	Q6H9S3	Enterobacteria_phage	1.9e-26	31.8
WP_020840871.1\|2161168_2161648_+	SocA family protein	A8ATC0	Listeria_phage	7.5e-12	38.9
WP_020840872.1\|2161644_2162025_+	hypothetical protein	NA	NA	NA	NA
WP_063517608.1\|2162080_2170435_-	PLxRFG domain-containing protein	M4M9L8	Vibrio_phage	0.0e+00	35.0
WP_154020286.1\|2170499_2170802_+	hypothetical protein	NA	NA	NA	NA
WP_050581389.1\|2170846_2171455_+	Rha family transcriptional regulator	A0A0P0ZFJ1	Escherichia_phage	1.8e-23	56.4
WP_025562151.1\|2171780_2172722_+	DMT family transporter	NA	NA	NA	NA
WP_025507220.1\|2172746_2173256_-	hypothetical protein	NA	NA	NA	NA
WP_154020292.1\|2173322_2173739_-\|transposase	IS200/IS605 family transposase	I4AZM1	Saccharomonospora_phage	5.3e-38	55.8
WP_063517610.1\|2173796_2174975_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	O80301	Enterobacteria_phage	1.6e-119	64.9
WP_063517611.1\|2175121_2176831_-	hypothetical protein	NA	NA	NA	NA
WP_020840878.1\|2177084_2177591_-	hypothetical protein	M4MCN4	Vibrio_phage	1.3e-14	41.3
WP_063517612.1\|2177612_2178290_-	hypothetical protein	M4M9K5	Vibrio_phage	1.5e-29	39.0
WP_020840880.1\|2178282_2178699_-	hypothetical protein	NA	NA	NA	NA
WP_021453944.1\|2178717_2181213_-	fibronectin type III family protein	M4M9M2	Vibrio_phage	1.7e-30	36.0
WP_063517613.1\|2181213_2182824_-	hypothetical protein	M4MHD1	Vibrio_phage	1.1e-131	46.0
WP_020840883.1\|2182823_2183048_-	hypothetical protein	NA	NA	NA	NA
WP_063517614.1\|2183169_2184030_-	DUF4376 domain-containing protein	A0A2I7RB39	Vibrio_phage	1.2e-28	43.7
WP_154020287.1\|2184026_2186372_-	hypothetical protein	M4M9Z4	Vibrio_phage	3.9e-114	35.9
WP_114139936.1\|2186477_2187601_-\|transposase	IS3-like element ISVpa4 family transposase	Q6H9S3	Enterobacteria_phage	1.9e-26	31.8
WP_063517616.1\|2188718_2189627_-	cation transporter	NA	NA	NA	NA
WP_114139936.1\|2189902_2191026_-\|transposase	IS3-like element ISVpa4 family transposase	Q6H9S3	Enterobacteria_phage	1.9e-26	31.8
WP_063517617.1\|2191018_2193139_-	hypothetical protein	M4M9Z4	Vibrio_phage	4.6e-37	48.8
WP_029810711.1\|2193158_2193830_-	hypothetical protein	M4M9I0	Vibrio_phage	7.0e-40	38.9
WP_063517618.1\|2193838_2194417_-	hypothetical protein	A0A1B1ITE9	uncultured_Mediterranean_phage	1.2e-08	28.3
WP_043854126.1\|2194416_2194881_-	hypothetical protein	M4MB04	Vibrio_phage	2.3e-18	36.8
WP_021485001.1\|2194994_2195441_-	hypothetical protein	NA	NA	NA	NA
WP_063517619.1\|2195500_2196724_-\|capsid	N4-gp56 family major capsid protein	M4M9G4	Vibrio_phage	1.5e-168	74.4
WP_127891399.1\|2196738_2197851_-	hypothetical protein	M4M9I4	Vibrio_phage	2.2e-46	40.1
WP_063517620.1\|2198058_2198544_-	hypothetical protein	M4MH86	Vibrio_phage	1.7e-35	46.0
WP_021454730.1\|2198570_2198888_-	phage family protein	G4WAN4	Salmonella_phage	2.2e-12	39.0
WP_063517621.1\|2198892_2199405_-	hypothetical protein	NA	NA	NA	NA
WP_063517622.1\|2199424_2201530_-	hypothetical protein	M4MB09	Vibrio_phage	1.4e-259	70.1
WP_063517843.1\|2201541_2203272_-	hypothetical protein	M4MCI5	Vibrio_phage	3.7e-186	55.7
WP_021453543.1\|2203324_2204242_-	hypothetical protein	M4M9G7	Vibrio_phage	7.4e-08	21.1
WP_063517623.1\|2204280_2204703_-	hypothetical protein	M4M9H1	Vibrio_phage	3.7e-39	60.3
2207899:2207919	attR	NA	NA	NA	NA

DBSCAN-SWA_6

2212914 : 2227331

Vibrio_phage(45.45%)

integrase,tRNA

attL 2215104:2215118|attR 2225356:2225370

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020840924.1\|2212914_2213724_-	hypothetical protein	A0A2R2ZGJ9	Clostridioides_phage	2.7e-22	38.0
WP_021454738.1\|2213961_2214111_-	hypothetical protein	NA	NA	NA	NA
WP_063517629.1\|2214118_2214424_-	DUF4406 domain-containing protein	A0A0U2SAZ1	Escherichia_phage	3.3e-13	46.2
WP_021453894.1\|2214420_2214822_-	hypothetical protein	NA	NA	NA	NA
WP_025562246.1\|2214884_2215250_-	hypothetical protein	NA	NA	NA	NA
2215104:2215118	attL	NA	NA	NA	NA
WP_133296389.1\|2215246_2215756_-	hypothetical protein	M4PMR5	Vibrio_phage	4.7e-20	35.1
WP_031856842.1\|2215676_2216636_-	hypothetical protein	A0A1C9LVZ5	Vibrio_phage	3.3e-11	34.7
WP_020840932.1\|2216710_2217025_-	hypothetical protein	NA	NA	NA	NA
WP_086586418.1\|2217313_2217952_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_063517845.1\|2218296_2218704_+	hypothetical protein	R9TMP0	Vibrio_phage	1.0e-22	47.8
WP_021484985.1\|2218717_2219542_+	DUF2303 family protein	R9TRN9	Vibrio_phage	3.7e-59	42.6
WP_020840936.1\|2219607_2220732_+	hypothetical protein	NA	NA	NA	NA
WP_051395178.1\|2220728_2221355_+	hypothetical protein	A0A2I7RS54	Vibrio_phage	4.1e-58	60.0
WP_020840938.1\|2221339_2221549_+	hypothetical protein	NA	NA	NA	NA
WP_063517630.1\|2221833_2222442_+	Rha family transcriptional regulator	A0A0P0HSR5	Acinetobacter_phage	5.2e-26	48.4
WP_063517631.1\|2222461_2223625_-\|integrase	site-specific integrase	B6ET93	Enterobacteria_phage	2.1e-44	30.2
WP_063517632.1\|2224116_2225742_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.1e-19	26.2
2225356:2225370	attR	NA	NA	NA	NA
WP_005458036.1\|2225930_2227331_+\|tRNA	asparagine--tRNA ligase	A0A2K9V902	Bandra_megavirus	2.5e-84	37.8

DBSCAN-SWA_7

2921220 : 2938616

uncultured_Mediterranean_phage(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005455546.1\|2921220_2923803_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.0e-78	37.9
WP_025636075.1\|2923945_2924413_-	recombination regulator RecX	NA	NA	NA	NA
WP_005478550.1\|2924536_2925580_-	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	8.1e-112	60.7
WP_063517761.1\|2925780_2926263_-	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	6.4e-27	48.1
WP_063517762.1\|2926347_2928909_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	8.9e-35	24.0
WP_024699751.1\|2930057_2930981_-	peptidoglycan DD-metalloendopeptidase family protein	D7RWE0	Brochothrix_phage	4.1e-06	35.2
WP_005455562.1\|2930995_2931622_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.3e-35	52.1
WP_063517763.1\|2931621_2932398_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	5.6e-65	52.0
WP_005455570.1\|2932397_2933441_-\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
WP_005380896.1\|2933487_2933964_-	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_005478544.1\|2933981_2934686_-	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	A0A2H4UTB4	Bodo_saltans_virus	5.9e-05	23.6
WP_005455577.1\|2934687_2934969_-	cell division protein FtsB	NA	NA	NA	NA
WP_005455579.1\|2935595_2936897_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	4.2e-134	59.2
WP_005455581.1\|2936975_2938616_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	4.2e-155	52.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP011408

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP011408_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011408_1

17150-17221

Orphan

Consensus_repeat	Method
TATGTATTACATATGTAATACAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP011408_1

>merge|NZ_CP011408|1|17150-17221|CRISPRCasFinder
TATGTATTACATATGTAATACATTGACATTGTTCTATTGTGTATTATAGTGTGTATTACATATGTAATACAT

>NZ_CP011408|1|1|17150-17221|CRISPRCasFinder
TATGTATTACATATGTAATACAT	TGACATTGTTCTATTGTGTATTATAG
TGTGTATTACATATGTAATACAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011408.1\|WP_063518481.1\|27236_27587_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011408.1\|WP_154020303.1\|23349_23859_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011408.1\|WP_063518460.1\|22138_22537_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011408.1\|WP_079771671.1\|8346_8499_+\|Hok/Gef-family-protein	unknown	unknown	gnl\|CDD\|182063
NZ_CP011408.1\|WP_063518455.1\|17234_18002_+\|ParA-family-protein	unknown	unknown	gnl\|CDD\|224113
NZ_CP011408.1\|WP_063518459.1\|21394_22126_-\|P-type-DNA-transfer-protein-VirB5	unknown	unknown	gnl\|CDD\|369643
NZ_CP011408.1\|WP_063518463.1\|24178_27247_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376240
NZ_CP011408.1\|WP_079771672.1\|9078_9489_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|368098
NZ_CP011408.1\|WP_154020301.1\|8695_8872_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011408.1\|WP_063518456.1\|18022_18319_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011408.1\|WP_063518453.1\|16478_16778_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|226194
NZ_CP011408.1\|WP_063518449.1\|10438_11119_+\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|290455
NZ_CP011408.1\|WP_063518454.1\|16770_17013_-\|type-II-toxin-antitoxin-system-ParD-family-antitoxin	unknown	unknown	gnl\|CDD\|274227
NZ_CP011408.1\|WP_063518452.1\|13718_14927_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|350407
NZ_CP011408.1\|WP_063518457.1\|20045_20345_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011408.1\|WP_063518461.1\|22657_23350_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011408.1\|WP_154020302.1\|16134_16296_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011408.1\|WP_063518448.1\|7509_7758_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011408.1\|WP_063518450.1\|11122_11365_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011408.1\|WP_063518458.1\|20374_21391_-\|type-IV-secretion-system-protein	unknown	unknown	gnl\|CDD\|377390

Protein	Function_ID	Function_description	E-value
NZ_CP011408.1\|WP_063518453.1\|16478_16778_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|226194	COG3668, ParE, Plasmid stabilization system protein [General function prediction only].	3.74561e-20
NZ_CP011408.1\|WP_079771671.1\|8346_8499_+\|Hok/Gef-family-protein	gnl\|CDD\|182063	PRK09759, PRK09759, type I toxin-antitoxin system toxin HokA.	2.76724e-13
NZ_CP011408.1\|WP_063518449.1\|10438_11119_+\|IS5-family-transposase	gnl\|CDD\|290455	pfam13737, DDE_Tnp_1_5, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis.	3.02231e-54
NZ_CP011408.1\|WP_063518454.1\|16770_17013_-\|type-II-toxin-antitoxin-system-ParD-family-antitoxin	gnl\|CDD\|274227	TIGR02606, Antitoxin_ParD, putative addiction module antidote protein, CC2985 family. This bacterial protein family has a very similar seed alignment to that of pfam03693 but is a more stringent model with higher cutoff scores. Proteins that score above the trusted cutoff to this model almost invariably are found adjacent to a ParE family protein (pfam05016), where ParE is the killing partner of an addiction module for plasmid stabilization. Members of this family, therefore, are putative addiction module antidote proteins. Some are encoded on plasmids or in prophage regions, but others appear chromosomal. A genome may contain several identical copies, such as the four in Magnetococcus sp. MC-1. This family is named for one member, CC2985 of Caulobacter crescentus CB15. [Cellular processes, Other, Mobile and extrachromosomal element functions, Plasmid functions].	3.07386e-23
NZ_CP011408.1\|WP_063518452.1\|13718_14927_-\|hypothetical-protein	gnl\|CDD\|350407	cd14559, PTP_YopH-like, YopH and related bacterial protein tyrosine phosphatases. Yersinia outer protein H (YopH) belongs to the family of classical tyrosine-specific protein tyrosine phosphatases (PTPs). PTPs (EC 3.1.3.48) catalyze the dephosphorylation of phosphotyrosine peptides. YopH is an essential virulence determinant of the pathogenic bacterium by dephosphorylating several focal adhesion proteins including p130Cas in human epithelial cells, resulting in the disruption of focal adhesions and cell detachment from the extracellular matrix. It contains an N-terminal domain that contains signals required for TTSS-mediated delivery of YopH into host cells and a C-terminal catalytic PTP domain.	3.44827e-76
NZ_CP011408.1\|WP_063518463.1\|24178_27247_-\|hypothetical-protein	gnl\|CDD\|376240	pfam18821, LPD7, Large polyvalent protein-associated domain 7. This domain contains conserved aspartate and phenylalanine residues. It is widely present in polyvalent proteins and gene neighbourhoods of conjugative elements. This domain is also known as PTox1.	3.64067e-15
NZ_CP011408.1\|WP_063518459.1\|21394_22126_-\|P-type-DNA-transfer-protein-VirB5	gnl\|CDD\|369643	pfam07996, T4SS, Type IV secretion system proteins. Members of this family are components of the type IV secretion system. They mediate intracellular transfer of macromolecules via a mechanism ancestrally related to that of bacterial conjugation machineries.	1.405e-52
NZ_CP011408.1\|WP_079771672.1\|9078_9489_+\|hypothetical-protein	gnl\|CDD\|368098	pfam04754, Transposase_31, Putative transposase, YhgA-like. This family of putative transposases includes the YhgA sequence from Escherichia coli and several prokaryotic homologs.	9.93178e-27
NZ_CP011408.1\|WP_063518458.1\|20374_21391_-\|type-IV-secretion-system-protein	gnl\|CDD\|377390	pfam04610, TrbL, TrbL/VirB6 plasmid conjugal transfer protein.	2.31714e-25
NZ_CP011408.1\|WP_063518455.1\|17234_18002_+\|ParA-family-protein	gnl\|CDD\|224113	COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].	7.98085e-54

>NZ_CP011408.1|WP_063518454.1|16770_17013_-|type-II-toxin-antitoxin-system-ParD-family-antitoxin
MSRTTSVTIGSQLDEFVGQLIATGRYGSTSEVVRSALRLLERQEKQTKALKMAIEAGEQSGQCSLSLHDIATKVKQIHNV
>NZ_CP011408.1|WP_063518453.1|16478_16778_-|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MYKLSNLAAKDFEHIFEYTLLNFGIEQADAYTDSMHDVLLTLAEQPLMGCECPEIAEGLRRHDHYKHAIFYRPQPHSVYIIRILHQQMEPLRHFHPDIY
>NZ_CP011408.1|WP_154020302.1|16134_16296_+|hypothetical-protein
MIGTSTINMRAALQAAQDYLSQDLNASVELLCQIYNALQLVDWNDSPEQHFQD
>NZ_CP011408.1|WP_063518452.1|13718_14927_-|hypothetical-protein
MKSIELFRAHVLHHSSSAEKLGQQELASKIIGIKRKENEAKILFILSKKNISTRQMKELQKRMQKHDKYIKKETRIHNTKRNIIVPQKPSAPNTEDIAPALPPRTYKNKTYMDSFRLDAIGEKQQLLNKLSRLQTQLNPCFCPERYQQGGNINRFHDIQANKSTIVCSELNANYIKIGTYRSIACQYPLESQLEKHLHMLFDNRTPVLAVLASDEEISERKNKMPDYFRQSGSYGAMNVQSKLSECIELSNGIYVDIYQMKLTQRDSGRKGITIPVIHIRNWPDKQTLSMDNVNEVSSLIAKNMRDKVAMYVKSASSAVGDVNKLLPVVHCRAGVGRTGLIIGSLAMNEKANVHLSLEDVIAEMRLSRNGLMVQTSDQLDELVKIAQRQGRALLSNVDYSAC
>NZ_CP011408.1|WP_063518450.1|11122_11365_+|hypothetical-protein
MLNCRQFGFLTELRNKASVDAKESTLTVNGYTYRVSKVVYGNTPLALTVVQPNMMVKVDENIQKSEDGHAVVSLEPTITG
>NZ_CP011408.1|WP_063518449.1|10438_11119_+|IS5-family-transposase
MPKPRYKTTNWKQYNKALINRDSLTFWIDEEAIRQWKQSKQDKRGRPRQFSDLAITTALMVKRVFSMPLRALQGFIDSVFSLANVPIVCPHYSCISRRAKQVEVSFKPKTRGAIQHLAIDATGLKVYGEGEWKVKKHGTDGKRRVWRKLHLAVGCQRLYGSNNNWKKRYGYHKRSLSETAMFRVKQLLCGRLSLRNYNAQVGETYAMIKALNKLTGLGMPETQCVV
>NZ_CP011408.1|WP_079771672.1|9078_9489_+|hypothetical-protein
MIANLVQDPIVNSLKNRKRKSLPTVLLQCSFIYQRPHSPKNRNQPGERPYVSDVLYSMRTTLGTSYVYTFVEHQFRSDQMLAFRMLRYAIAAMRQHINSRHYQLLLVIPILFYHSIPFYSLNWFYLFQEPHIAQTL
>NZ_CP011408.1|WP_154020301.1|8695_8872_+|hypothetical-protein
MKNLGGVKRSAQTNALSITHTIEIFDLMGTCLARECLLSPWEHAPVKQVTSSQETQPN
>NZ_CP011408.1|WP_079771671.1|8346_8499_+|Hok/Gef-family-protein
MPKQKTALLSLIVICLTLLGFTWMVRDSLCELQVRNGNSVFLATLAYESR
>NZ_CP011408.1|WP_063518448.1|7509_7758_-|hypothetical-protein
MKKYLLIPVLMLSFNAFAEVTKEEVSAMRQEVKGMTKEEVTAKHIELFEAVKADPSEKNCHAFDVFELGARKENYNHRSSSK
>NZ_CP011408.1|WP_063518455.1|17234_18002_+|ParA-family-protein
MKTKVISAANQKGGVGKTTTLVNLGAELARKRKVLVIDLDPQGNCTKTLTGERHFQFEETVAAMFDKPKVVSIVDLIRPAFFDGEPIPNLDVVPADFQLSRIIETSLTKINRERILEKQLVKLGYMYDFILLDTPPNLSLTTLNAIQASDLILIPVDSGAFSLDGISPLLEAVSEIKDDEANYLILRNEVDVRNTVINEFIEEELEVAKEKVLPVIIRRSEHISQANAVSAPVRFYKAGSLVNNDYRKLAALIID
>NZ_CP011408.1|WP_063518456.1|18022_18319_+|hypothetical-protein
MAKLKARGAITVISSTDKRNDKSQAITTVKKKITTSYKVPPLTLRMSLKDKESIAKWVDDLQELSERNVSAAKLFRALVLYRNNIDDEELIKIIDKMN
>NZ_CP011408.1|WP_063518457.1|20045_20345_+|hypothetical-protein
MKKYLLIPVLMLSFNAFAEVTKDDVNAMRQEVKGMNKEEVTAKHIELFEAVKAEPNEKNCHSFEVFDLGARKEKKITIIDPQVNKRVLDAKRSCLGYNW
>NZ_CP011408.1|WP_063518458.1|20374_21391_-|type-IV-secretion-system-protein
MDISIFQYISFSFENLLQAFVVTGSQNIMDGIKPIVYTCVTIYIMAQAYGQIMGTTDDLAIDVFKTCIIVLCLSNLTLNTGHYTDYIVGGIEAISEGLAGAMSGNGGGSDIYKTLDDMLQGGINQFNYCWDKVGLAPSTWMWFGAGFAAILAIGAVTSVAALVILGTKFILSMLLVVGPIFIIMACFPPTRRFLDNWMGKVFENILVQVFGVALILMMMQIMNAYIDENNLTTGGDANPTAIIVQIAVISVILVYVYLQIPNLAGSLAGGFASAMLAIKKPKTNPLNPNHEPVSSRQTWAQQQQNQISGGGAKTGTQPKNDLSQDLRDRIAEHNLKNK
>NZ_CP011408.1|WP_063518459.1|21394_22126_-|P-type-DNA-transfer-protein-VirB5
MKKSLIAAAIAFGCITQTQAGIPVSVVLDATAQINQVQNFAQMLKEYATLLDQLDQMKRQFEQMEREYSSVTGSRNLGDILNDPEFKHYLPDNWQDVYQGIRNNGYEGLSGSAKALRDASKVFDACEYITDPTEKRVCNAQAVKPAQDQAFANDAYKKSQNRVNQIESLMREINRTNDPKAIAELSARIQAEQAMIQNEQTKLSLYQASAEAEERLLEQQKLETTKKLIKSTNYGRPVQPVEF
>NZ_CP011408.1|WP_063518460.1|22138_22537_-|hypothetical-protein
MSNEPLPRDLKETYLLETLGEVILLNKELKELRDESMMRIGITQNIIDEQLTASREVLAQYTQAANAHFATKKEELRDIAEHELKKALLGAHKQLLISNPPKMGMSSILPCVLLSGAVSALVSITCVFLLLI
>NZ_CP011408.1|WP_063518461.1|22657_23350_-|hypothetical-protein
MKICVINFSGNVGKSVVSQHLLKPRLENSEIIAVESINSDGTNDEKIKGKRFSDIMDKVMEHDNAIVDVGASNVEEFIQQMNKATGSHEEFDYFVVPTICKNKQITDTVATIEALEEMGIEKERIRVLFNLINEDILLRKDFAAIFENDDLAVVNHNCVIQENELFNRLHEVENFTSIADLVNDQTDYRALIQQTDDKSERLIYSRRLGLRRLATGVERMLDNTYKQLFK
>NZ_CP011408.1|WP_154020303.1|23349_23859_-|hypothetical-protein
MKLSIEKLDAGLQEIIETQGRSSKAKIIRGLFERITEAMEEGITLDMLVDYLRQNEILITKNSLRNTLYRIRKERCNKPNSKPIKTITKENHVSPTLPISSSNSEETTETQINPYDLMMEKYKQCHNQVDKYIALGGKREDIEEQNISTQRGMVMTLRNQLRQKYKGIY
>NZ_CP011408.1|WP_063518463.1|24178_27247_-|hypothetical-protein
MLIRVSGGKGGIKEYLEEGIKNGRDYSRNELDERLILSGDLELVNDIIKTMEGDAQRYLHITLSFKEDHIDEATLNAVTQDFKAFAMKAYQDDEYAFYAEAHLPKIKTYLDKATGESVERKPHIHVVIPQKNLLTGKRLEPFGLVEKNEHYIDAFQEATNEKYQLASPKHHVRSTFTNESTIISRHKADLFPAQQRNVKSKALEVLLSDDITTTTAFAQKLEASGFDVKIRNQGKDNEYLNIKSPEQKRGVNLKDNVFQPQFVALPKAEKMKLLDNQYNPYRENGDSPYRATKTHHNDLQHWNTTRAYELKFINFGNRAKYKALTPEQKQQFLTDKRTEYGQSRISATSFDDINQSIRAASQHLLNAQRNRGQLKSGVRNVTHRRAIRAAFANLERHSGDQSPPIIQRNTSERLNQCLYALETRVLPDVKHIKQNIDALALLHRLSTTHGVDVDKYAVTKGKDGGDRIQCGNRHLNVSDFLTKEMHLSWKDAKQYLEDRYLAQQGIDPRQAVKEKPELNLIQAAWRTQLQSEREQRQTYLAHYRLEKTAIYSDKTLSKEERNIALSIAQMNKVIHDLQFKRENREAREQLVYHAQKTNKEDHPMREEIGIVVSHKEAPYKHNKKNELSYVVEIENHGRIREVWGKDLKRAMEENQVQQGDKIKLTQSGQKNVTVTARQEQADGSIKHEPLNTKRNEWHVSIATDAEIKQHAEMRQTAPESTTTPSVKSQSNQSSNDKTLSPNTTQFYDQNLEASRLLIQYPKLKELGVNVESIIKTENGDKIQYDEKSLTVTQLMKETHNLKPKEIISELKPLYDIQVKDNERIIKFKNNYINNDRKSLSELENETRKKSKKQQGMEQTLSPSHEPEKERKVLTPEPNKFGEQITHETNKQGHVTYYQGDEKLVTDRGNNILIEQQSNKAVEIGLRLAIEKYGHHLDIKGTKEYQSQIIDIAVTNKLNISFKNKALNEQLIARKAQFEKGDNLITKAENAYKAQSKQAEKGQQQAKEQPANQQQRPTKGWER
>NZ_CP011408.1|WP_063518481.1|27236_27587_-|hypothetical-protein
MAHDIKNQRIIFRVTENEKKAFLKKVEDAQTTASDLLRERVLKDEYFIVAREPKASIDKQKLLYLYNKTSNNMNQLAHQANSYNQAGTLTDQQFKQILVNLITIRNLLKSGIEYVD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP011408_1	1.1\|17173\|26\|NZ_CP011408\|CRISPRCasFinder	17173-17198	26	NZ_CP011408	Vibrio parahaemolyticus strain FORC_014 plasmid pFORC14, complete sequence	17173-17198	0	1.0

1. spacer 1.1|17173|26|NZ_CP011408|CRISPRCasFinder matches to NZ_CP011408 (Vibrio parahaemolyticus strain FORC_014 plasmid pFORC14, complete sequence) position: , mismatch: 0, identity: 1.0

tgacattgttctattgtgtattatag	CRISPR spacer
tgacattgttctattgtgtattatag	Protospacer
**************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP011407

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP011406

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP011408

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection