CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP011789	Pseudomonas putida strain PC2, complete genome	1 crisprs	WYL,cas3,DEDDh,DinG,csa3,PD-DExK	0	0	8	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP011789_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011789_1

4084844-4084926

Orphan

Consensus_repeat	Method
GACTCGGCGGTTTTGGTCTGTTTCGGCTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP011789_1

>merge|NZ_CP011789|1|4084844-4084926|CRISPRCasFinder
GACTCGGCGGTTTTGGTCTGTTTCGGCTCTTCTCCGATTCGGACCACTTGAGCCGACTCGGCTGTTTTGGTCTGTTTCGGCTC

>NZ_CP011789|1|1|4084844-4084926|CRISPRCasFinder
GACTCGGCGGTTTTGGTCTGTTTCGGCTC	TTCTCCGATTCGGACCACTTGAGCC
GACTCGGCTGTTTTGGTCTGTTTCGGCTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011789.1\|WP_063546801.1\|4081000_4081318_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011789.1\|WP_063545400.1\|4089354_4090029_+\|polysaccharide-lyase-family-7-protein	unknown	unknown	gnl\|CDD\|378049
NZ_CP011789.1\|WP_063545396.1\|4085361_4085586_-\|Cro/Cl-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|370262
NZ_CP011789.1\|WP_063545388.1\|4078295_4078667_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|289056
NZ_CP011789.1\|WP_081255275.1\|4086602_4087679_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377262
NZ_CP011789.1\|WP_063545392.1\|4081562_4082861_-\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271182
NZ_CP011789.1\|WP_063545398.1\|4087678_4088644_+\|RelA/SpoT-domain-containing-protein	unknown	unknown	gnl\|CDD\|143389
NZ_CP011789.1\|WP_063545395.1\|4083581_4084394_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|236153
NZ_CP011789.1\|WP_063545390.1\|4079428_4079641_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011789.1\|WP_063545394.1\|4083282_4083579_-\|DUF1364-domain-containing-protein	unknown	unknown	gnl\|CDD\|377777
NZ_CP011789.1\|WP_063545402.1\|4091029_4091413_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197715
NZ_CP011789.1\|WP_063545403.1\|4091433_4091700_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011789.1\|WP_063545393.1\|4082857_4083286_-\|VRR-NUC-domain-containing-protein	unknown	unknown	gnl\|CDD\|370112
NZ_CP011789.1\|WP_155738221.1\|4079807_4080230_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011789.1\|WP_063545397.1\|4085690_4086578_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|119397
NZ_CP011789.1\|WP_063545404.1\|4091696_4092155_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011789.1\|WP_063545401.1\|4090174_4091026_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|272946
NZ_CP011789.1\|WP_063545391.1\|4080600_4080990_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|368957
NZ_CP011789.1\|WP_155738251.1\|4088658_4088964_-\|DUF1654-domain-containing-protein	unknown	unknown	gnl\|CDD\|311699
NZ_CP011789.1\|WP_063545389.1\|4078695_4079316_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP011789.1\|WP_063545400.1\|4089354_4090029_+\|polysaccharide-lyase-family-7-protein	gnl\|CDD\|378049	pfam08787, Alginate_lyase2, Alginate lyase. Alginate lyases are enzymes that degrade the linear polysaccharide alignate. They cleave the glycosidic linkage of alignate through a beta-elimination reaction. This family forms an all beta fold and is different to all alpha fold of pfam05426.	1.92086e-44
NZ_CP011789.1\|WP_063545396.1\|4085361_4085586_-\|Cro/Cl-family-transcriptional-regulator	gnl\|CDD\|370262	pfam09048, Cro, Cro. Members of this family are involved in the repression of transcription by binding as a homodimer to palindromic DNA operator sites in phage lambda: they repress genes expressed in early phage development and are necessary for the late stage of lytic growth. These proteins have a secondary structure consisting of three alpha-helices and three beta-sheets, and dimerize through interactions between the two antiparallel beta-strands.	9.91399e-18
NZ_CP011789.1\|WP_063545388.1\|4078295_4078667_-\|hypothetical-protein	gnl\|CDD\|289056	pfam12252, SidE, Dot/Icm substrate protein. This family of proteins is found in bacteria. Proteins in this family are typically between 397 and 1543 amino acids in length. This family is the SidE protein in the Dot/Icm pathway of Legionella pneumophila bacteria. There is little literature describing the family.	0.00212377
NZ_CP011789.1\|WP_081255275.1\|4086602_4087679_+\|hypothetical-protein	gnl\|CDD\|377262	pfam04245, NA37, 37-kD nucleoid-associated bacterial protein.	5.12288e-07
NZ_CP011789.1\|WP_063545392.1\|4081562_4082861_-\|site-specific-integrase	gnl\|CDD\|271182	cd00801, INT_P4_C, Bacteriophage P4 integrase, C-terminal catalytic domain. P4-like integrases are found in temperate bacteriophages, integrative plasmids, pathogenicity and symbiosis islands, and other mobile genetic elements. The P4 integrase mediates integrative and excisive site-specific recombination between two sites, called attachment sites, located on the phage genome and the bacterial chromosome. The phage attachment site is often found adjacent to the integrase gene, while the host attachment sites are typically situated near tRNA genes. This family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	2.08836e-39
NZ_CP011789.1\|WP_063545398.1\|4087678_4088644_+\|RelA/SpoT-domain-containing-protein	gnl\|CDD\|143389	cd05399, NT_Rel-Spo_like, Nucleotidyltransferase (NT) domain of RelA- and SpoT-like ppGpp synthetases and hydrolases. This family includes the catalytic domains of Escherichia coli ppGpp synthetase (RelA), ppGpp synthetase/hydrolase (SpoT), and related proteins. RelA synthesizes (p)ppGpp in response to amino-acid starvation and in association with ribosomes. (p)ppGpp triggers the bacterial stringent response. SpoT catalyzes (p)ppGpp synthesis under carbon limitation in a ribosome-independent manner. It also catalyzes (p)ppGpp degradation. Gram-negative bacteria have two enzymes involved in (p)ppGpp metabolism while most Gram-positive organisms have a single Rel-Spo enzyme (Rel), which both synthesizes and degrades (p)ppGpp. The Arabidopsis thaliana Rel-Spo proteins, At-RSH1,-2, and-3 appear to regulate a rapid (p)ppGpp-mediated response to pathogens and other stresses. This catalytic domain is found in association with an N-terminal HD domain and a C-terminal metal dependent phosphohydrolase domain (TGS). Some Rel-Spo proteins also have a C-terminal regulatory ACT domain. This subgroup belongs to the Pol beta-like NT superfamily. In the majority of enzymes in this superfamily, two carboxylates, Dx[D/E], together with a third more distal carboxylate, coordinate two divalent metal cations involved in a two-metal ion mechanism of nucleotide addition.Two of the three catalytic carboxylates are found in Rel-Spo enzymes, with the second carboxylate of the DXD motif missing. Evidence supports a single-cation synthetase mechanism.	1.71496e-24
NZ_CP011789.1\|WP_063545395.1\|4083581_4084394_-\|AAA-family-ATPase	gnl\|CDD\|236153	PRK08116, PRK08116, hypothetical protein; Validated.	4.55095e-42
NZ_CP011789.1\|WP_063545394.1\|4083282_4083579_-\|DUF1364-domain-containing-protein	gnl\|CDD\|377777	pfam07102, DUF1364, Protein of unknown function (DUF1364). This family consists of several bacterial and phage proteins of around 95 residues in length. The function of this family is unknown.	4.83575e-49
NZ_CP011789.1\|WP_063545402.1\|4091029_4091413_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197715	smart00421, HTH_LUXR, helix_turn_helix, Lux Regulon. lux regulon (activates the bioluminescence operon.	3.11535e-11
NZ_CP011789.1\|WP_063545391.1\|4080600_4080990_-\|hypothetical-protein	gnl\|CDD\|368957	pfam06530, Phage_antitermQ, Phage antitermination protein Q. This family consists of several phage antitermination protein Q and related bacterial sequences. Antiterminator proteins control gene expression by recognising control signals near the promoter and preventing transcriptional termination which would otherwise occur at sites that may be a long way downstream.	1.02155e-07
NZ_CP011789.1\|WP_063545397.1\|4085690_4086578_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|119397	cd06529, S24_LexA-like, Peptidase S24 LexA-like proteins are involved in the SOS response leading to the repair of single-stranded DNA within the bacterial cell. This family includes: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC 3.4.21.88), the repressor of genes in the cellular SOS response to DNA damage; MucA and the related UmuD proteins, which are lesion-bypass DNA polymerases, induced in response to mitogenic DNA damage; RulA, a component of the rulAB locus that confers resistance to UV, and RuvA, which is a component of the RuvABC resolvasome that catalyzes the resolution of Holliday junctions that arise during genetic recombination and DNA repair. The LexA-like proteins contain two-domains: an N-terminal DNA binding domain and a C-terminal domain (CTD) that provides LexA dimerization as well as cleavage activity. They undergo autolysis, cleaving at an Ala-Gly or a Cys-Gly bond, separating the DNA-binding domain from the rest of the protein. In the presence of single-stranded DNA, the LexA, UmuD and MucA proteins interact with RecA, activating self cleavage, thus either derepressing transcription in the case of LexA or activating the lesion-bypass polymerase in the case of UmuD and MucA. The LexA proteins are serine proteases that carry out catalysis using a serine/lysine dyad instead of the prototypical serine/histidine/aspartic acid triad found in most serine proteases. LexA sequence homologs are found in almost all of the bacterial genomes sequenced to date, covering a large number of phyla, suggesting both, an ancient origin and a widespread distribution of lexA and the SOS response.	5.38249e-18
NZ_CP011789.1\|WP_063545401.1\|4090174_4091026_+\|hypothetical-protein	gnl\|CDD\|272946	TIGR00180, Probable_chromosome-partitioning_protein_ParB, ParB/RepB/Spo0J family partition protein. This model represents the most well-conserved core of a set of chromosomal and plasmid partition proteins related to ParB, including Spo0J, RepB, and SopB. Spo0J has been shown to bind a specific DNA sequence that, when introduced into a plasmid, can serve as partition site. Study of RepB, which has nicking-closing activity, suggests that it forms a transient protein-DNA covalent intermediate during the strand transfer reaction.	2.99103e-11
NZ_CP011789.1\|WP_063545393.1\|4082857_4083286_-\|VRR-NUC-domain-containing-protein	gnl\|CDD\|370112	pfam08774, VRR_NUC, VRR-NUC domain.	1.58651e-15
NZ_CP011789.1\|WP_155738251.1\|4088658_4088964_-\|DUF1654-domain-containing-protein	gnl\|CDD\|311699	pfam07867, DUF1654, Protein of unknown function (DUF1654). This family consists of proteins from the Pseudomonadaceae.	6.30514e-18

>NZ_CP011789.1|WP_063545395.1|4083581_4084394_-|AAA-family-ATPase
MRSESVITMSEVRNAAGFRVQPAHCEHHGDFEQRVTMLMGREIVGRCPECEKVAIAERQAKQQAEETRLKREAMTRKLGSALIPKRFAERTLANYRVEQEGQRKALAYCTRYVAAFEEIERTGRCLMLLGNVGTGKTHLGVGMANELMRNTSATAVYRTVGAILQSIRATYDRHSEQSEADILSSLIEPSLLVLDEVGASKEQPSEFELTTLFSIINGRYEQMRPTVVISNLDRHQLRHAMGERCYDRLREGGGVIVLFEWESHRGEKES
>NZ_CP011789.1|WP_063545394.1|4083282_4083579_-|DUF1364-domain-containing-protein
MRQSKLTKAARGRDCQVRIPGVCNGNPETTVLAHYRLAGTCGVGKKPHDLQGAWSCSACHDACDGRSRAIDREIARQYHAEGVMRTQSILLAESVVVA
>NZ_CP011789.1|WP_063545393.1|4082857_4083286_-|VRR-NUC-domain-containing-protein
MSATVLRPFKAKPARAKPVDREGQEQAALMQELQLRYPQAYKLIYHVPNGGHRHKLVAAKLKGQGVKAGVPDLVLPMARGGYFGLYIEFKAKPPFDAEVSPSQDAYIQALTAQGYLAIVCRGSIDAVEAIRAYLLQPATVAA
>NZ_CP011789.1|WP_063545392.1|4081562_4082861_-|site-specific-integrase
MSATREVKFSEAEVRRQAADVSVRDLRDPRHPGLYLRFWSNRERATWHLVRGKKWVPVARWPELNVATVLTELPALRQRLLREPATALVVSSMASVGQLLDWYGDRMARDRSLSVKRKAGARSAIAQHLKPRLDDLPLADVTADTLDKQLMWPAQADVSLSYLRQMFALLLTAFKQAKRLGLIESDPMGGMRFSDFTKAKILPKSARLRAVHLADVMQQLAEVFEETPAKAMLALMMLAHGTRIGETRKARWSEVSVTAGEWFIPAANAKTRTEHRLPLTNQICALLTRYRAIQQAEGYDGVYLFPSRRGGCLSESQASAVFTYLGRGEWTSHDLRKVSRSTWTDLGIDGHIGEMLLNHSLGKIASTYIHTQAMQQRRVALEKWHAWLDGIGFGAIHGLTEALSEIPQIQGQAAGDKASSTHPEFVTSEDSK
>NZ_CP011789.1|WP_063546801.1|4081000_4081318_-|hypothetical-protein
MKKSHGPAFKKALIELAHCPVCRGRAVTKSLFYELPCDHCNASGWVVAATGEALALGELVTQLSMRLMAATRQIEQLRKARTTGPATAYQDGNRLGAGGTNYTGD
>NZ_CP011789.1|WP_063545391.1|4080600_4080990_-|hypothetical-protein
MKKRTYVDKALGDTAYMLEQWGWWRMDGMGVPQYVCPLYALMKEHVPAEGGLKQYVITDDLALAVDAAVARLNKRNPQMGGFVWLYFGAKWPALRIAREHKMSEAKARELINTGVAWIDCALEQLREAA
>NZ_CP011789.1|WP_155738221.1|4079807_4080230_-|hypothetical-protein
MPKSSVAMTRSGHILGDAGNPVSKETLLQDSLLEADDPLGYTPDDDEPGLDRGPIVPVGINGAQAELMISEFDHTDSFEVYMTDKKSNQGGNGSADRKPAQGSGKDEVKRTNTERASKAELYSRHEKDAEVDKKTKPERS
>NZ_CP011789.1|WP_063545390.1|4079428_4079641_-|hypothetical-protein
MKSKYRCLVEDILSCEQKLREAKAIQCDAQEKLAHADGFVAYQEASLRENERKLAEIEVVLFGSEAQAPR
>NZ_CP011789.1|WP_063545389.1|4078695_4079316_-|hypothetical-protein
MSESTQAQLDALKAALLEQGVATVCSKATDSQGRPLIEVNLKTGEFKLGGAEYGIGEPSQLCIDPGQEVEPLRMGKVSFYGESARQIRAANAVLHSAGAGQLEVVKRANEPGEQYVVVDGQMFISQAAIDDQVSALRSWKTQITEQGKHVATGIYSGEDRSEPSVDLASALADWPSVATLQITDPADQIRQVICDELKPGGMLHRG
>NZ_CP011789.1|WP_063545388.1|4078295_4078667_-|hypothetical-protein
MDPTDLGPGTATWLGGTGTVLLGGFLWLRKFLSKDATDRAMDNADIGTVRRLNELLDSEREARKLAEARADQFAKERNDLAATVGRMEGKIEALTSQVASLTERVTLQSDEIARLRTKLGGTS
>NZ_CP011789.1|WP_063545396.1|4085361_4085586_-|Cro/Cl-family-transcriptional-regulator
MNRTLLPELVERIGQTAVAKGLDVSAPAIAKAMKAGRVIFVIQNDDGTLTGEEVRPFPSRPVLQRPASDEKNYA
>NZ_CP011789.1|WP_063545397.1|4085690_4086578_+|helix-turn-helix-domain-containing-protein
MTKKKDLSPELKAECEAAKRLFTQKKNALGLTQAKVAEAADISPAGVAMYLNGTNPLNAKFAVVLSRLLQEPVDRFSPRLAAELSQMQGAQVKSADGLRSTAAEKVLEMLRKHGGKSLDATAQDKIAKAVADSLSEASAPSTGAAQAAIMVMAGHGDISIPQYDIRAAMGHGQVPAEYSEVIRNVVIREEVLREKGVTYTAAQALAMITGWGQSMEGTINDKDPVIVDRGVNDYQGEGVYVLTWHGDLLIKRVQRMDGDHVWLISDNKNYEKQSARIEDVTIHAKVLLVWNARKI
>NZ_CP011789.1|WP_081255275.1|4086602_4087679_+|hypothetical-protein
MDKFIFEGLSIERMIAHTIFPRTKEGVLVPPQLSEELIDLDVDSKDLLQVRITDALGSNSHGIEINAEKTDASSFMQKSAEALRAEKARFIELSRVIAEDLADAQTNPKWPGGVLIVLSGRVGNNQHPFLAAIKAETDKGFNIVERNGSVSLTLIKKMLLSQTQRLYKIGVSVEISYTAPVASIYQPENYRFFLFDHLLTTTETKAAAAYFYNAFLGMNILKSSKFQTRKFYEETKTYISGLALEQPEKSELLEALRSELRSNKGTMSVPAFAEEHLPADSRQHYIDTMAAKGLPDTAMVKDLAYIKAKLRRPRRVDFSTGVKIQVPADLNFQDHVQTLRQEGGYTDVRIKGVVESRE
>NZ_CP011789.1|WP_063545398.1|4087678_4088644_+|RelA/SpoT-domain-containing-protein
MNIEQFKDYLLAAQPSLNLWGSFVEKNVKKISKTNSINLQILSSRVKEIDSAIGKLTRKSYNNPLKDMTDLVGVRAVCLLSPDVEKLCQAMMLPVWDIQKSRDTSKEYEDAPDKFGYQSHHFEIRPKCDIQIAGTTITPDICCELQIRTLMQHAYAEVVHDSIYKSSWKVPSRAVRFVSSSAALIETADHLFCETMNILESESKVRGELLEELTDIYDSKVGISKFKDQKFNMLVLDQLSGVIHQDTPDKIRHLLNERSFIQERVKSRLDSNAFWSQPVSILAYLLAVEHPSSLKELWPYAESEDSLELIYSDLGKKYHSH
>NZ_CP011789.1|WP_155738251.1|4088658_4088964_-|DUF1654-domain-containing-protein
MSAPGEALTGLEKLGLRISAMINSPLAQFGRKVLIHQLDTDSDQDWVRIMELLSETDGLDMTFCDDGSVILQWDAATDDDRVIEREVDLDLVRHEEEKAPF
>NZ_CP011789.1|WP_063545400.1|4089354_4090029_+|polysaccharide-lyase-family-7-protein
MAVNISKLTITTPVATSSTNHVALELSGAEAIAQFPEIVTALPDGSIRFTAPTKGASSKSTRRTRCEWSEATNWTLASAANHRNHQQMALTKVNFAQKVVISQMHVRGDDSPPVKVFWNKGNITMGFRTTYNQATPVNTTVLKGVPLGAKFTVAIDVTTHGLVTVSAQCNGVSGSSGTLQLDDTWDSRLFEFHGGVYNQVDYTDSTPAADGSICVISSLSLTHS
>NZ_CP011789.1|WP_063545401.1|4090174_4091026_+|hypothetical-protein
MAKSFKQMIKDGEVRRADAMKVQLEDLHEEPGFNLRTEGEALESSIDSLAEFIAAGGQIPPLEVRPRAEGGVWLVDGHRRRRALLKLDAAGRLPRTPNKENPAILEAWVPVIAFEGSDADRVARIITSQENEKLSPLELAEGYKRLRSFGWSVEQIAKKVAKTRQHVEQVLTVGNANTDVQNLVAAGHVSATTAAQVVREHGDGAGTVLDAELKKVQASGKTKVTAGSIKGPSIPKPRLEAVHTASRNLIASLDAIDEDNRSLTISTALVIELRKALESAQPR
>NZ_CP011789.1|WP_063545402.1|4091029_4091413_+|helix-turn-helix-transcriptional-regulator
MDTITSGSWMGHLGRGLAPRELECVLDVAQGMTSKQIARHFGISEGGVEKRIAAAMFKLDVPRRAALVAEAMRRNIISPMCFLLVALVATHAAIGDSDPMRRDRRVPERRIAQVRVLRKAESFDYHA
>NZ_CP011789.1|WP_063545403.1|4091433_4091700_+|hypothetical-protein
MHHSMQQRVDGLAALRARSLMATAEFYGLIGLPAPTARPLYQAVAKGKAWHIIEVATGKTKGFCFSHQAAMRFVDAMEAGAATKGVRQ
>NZ_CP011789.1|WP_063545404.1|4091696_4092155_+|hypothetical-protein
MSKRKPHNMRARLERTCRALVSANHTAVVNIDPSGQQVLINWKNLKQIRVRQVVDAVCDIPHRWTIYLSVLCRTEFGERYHKSVEVAPQGNYRADHLTEVIEATYTELRATANPNHLVASGWIAIPTDTTLDEAEAAKIFTSAGAWDQQTAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

42046 : 134014

Pseudomonas_phage(51.28%)

head,portal,tail,terminase,plate,capsid,tRNA,integrase,lysis

attL 38753:38771|attR 104082:104100

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
38753:38771	attL	NA	NA	NA	NA
WP_063541418.1\|42046_43501_-\|tRNA	tRNA 4-thiouridine(8) synthase ThiI	NA	NA	NA	NA
WP_063541420.1\|43993_45400_+	glutamate--ammonia ligase	NA	NA	NA	NA
WP_063541422.1\|45552_46095_+	chorismate mutase	NA	NA	NA	NA
WP_063541424.1\|46358_47444_+	nitrogen regulation protein NR(II)	Q8QKV7	Ectocarpus_siliculosus_virus	3.0e-08	24.3
WP_063541426.1\|47440_48877_+	nitrogen regulation protein NR(I)	NA	NA	NA	NA
WP_063541428.1\|49388_49826_-	hypothetical protein	NA	NA	NA	NA
WP_063541430.1\|49824_50280_+\|tRNA	tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL	NA	NA	NA	NA
WP_054895290.1\|50356_51745_-	GABA permease	NA	NA	NA	NA
WP_063541432.1\|52388_53162_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.9e-21	32.4
WP_054895292.1\|53174_53927_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_063541434.1\|53984_54680_+	ABC transporter permease	NA	NA	NA	NA
WP_063541436.1\|54676_55366_+	ABC transporter permease	NA	NA	NA	NA
WP_063541438.1\|55483_56701_+	methyltransferase	NA	NA	NA	NA
WP_054895538.1\|57178_57757_+	hypothetical protein	NA	NA	NA	NA
WP_043211003.1\|57766_57973_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_063541440.1\|57991_58372_+	hypothetical protein	NA	NA	NA	NA
WP_063541442.1\|58375_58648_+	hypothetical protein	NA	NA	NA	NA
WP_063546583.1\|59442_59793_+	hypothetical protein	NA	NA	NA	NA
WP_063546584.1\|59969_60659_+	NYN domain-containing protein	NA	NA	NA	NA
WP_063541444.1\|61357_61705_+	hypothetical protein	NA	NA	NA	NA
WP_063541446.1\|61736_62753_+	hypothetical protein	NA	NA	NA	NA
WP_063541448.1\|62749_63724_-	hypothetical protein	A0A0U4IBV2	Pseudomonas_phage	1.0e-108	61.5
WP_063541450.1\|63696_64401_-	hypothetical protein	A0A2I7RNK1	Vibrio_phage	4.0e-38	40.0
WP_063541452.1\|64397_64943_-	hypothetical protein	A0A0U4J942	Pseudomonas_phage	1.2e-50	61.9
WP_063541454.1\|64939_65863_-	hypothetical protein	NA	NA	NA	NA
WP_063541456.1\|65859_66570_-	hypothetical protein	A0A0U4JEJ6	Pseudomonas_phage	1.8e-57	46.2
WP_063541458.1\|66577_68956_-\|tail	phage tail protein	A0A0U4K5K2	Pseudomonas_phage	1.4e-127	41.9
WP_063541460.1\|68965_69490_-\|tail	phage tail protein	A0A0U4JVX3	Pseudomonas_phage	1.7e-78	79.3
WP_063541462.1\|69486_70659_-	hypothetical protein	A0A0U4JJ14	Pseudomonas_phage	5.5e-157	71.6
WP_063541464.1\|70655_70973_-	DUF2590 family protein	A0A0U4B0N5	Pseudomonas_phage	2.4e-35	78.4
WP_063541466.1\|70972_73258_-\|tail	phage tail tape measure protein	A0A0U4IJ81	Pseudomonas_phage	1.3e-141	42.5
WP_063541468.1\|73432_73720_-	hypothetical protein	A0A0U4B0P2	Pseudomonas_phage	1.5e-20	58.2
WP_063541470.1\|73716_74208_-\|lysis	lysis protein	A0A0U4JXC2	Pseudomonas_phage	5.0e-19	47.9
WP_063541472.1\|74195_74726_-	hypothetical protein	NA	NA	NA	NA
WP_063541474.1\|74722_74929_-	hypothetical protein	NA	NA	NA	NA
WP_063541476.1\|74925_75138_-	TraR/DksA family transcriptional regulator	A0A0U4IIN4	Pseudomonas_phage	1.1e-15	60.0
WP_063541478.1\|75137_75587_-	DUF2597 family protein	A0A0U3TH58	Pseudomonas_phage	2.9e-58	75.7
WP_063541480.1\|75593_76709_-	DUF2586 family protein	A0A0U4KLE6	Pseudomonas_phage	2.0e-132	64.2
WP_063541482.1\|76720_77362_-	virion morphogenesis protein	A0A0U4ISN1	Pseudomonas_phage	6.4e-59	59.5
WP_063541484.1\|77387_77843_-\|tail	phage tail protein	A0A0U4IBS7	Pseudomonas_phage	1.8e-47	65.1
WP_063541486.1\|77839_78301_-\|head	head completion/stabilization protein	A0A0U4J933	Pseudomonas_phage	1.8e-39	54.6
WP_063541488.1\|78397_79135_-\|terminase	terminase	A0A0U4JEJ1	Pseudomonas_phage	1.9e-78	64.6
WP_063541490.1\|79131_80151_-\|capsid	phage major capsid protein, P2 family	A0A0U4K5I9	Pseudomonas_phage	1.5e-166	85.5
WP_063546586.1\|80150_81125_-\|capsid	capsid scaffolding protein	A0A0U4JVV6	Pseudomonas_phage	3.8e-71	50.9
WP_081255322.1\|83164_84121_+\|portal	phage portal protein	A0A0U4B0L9	Pseudomonas_phage	2.3e-105	79.6
WP_081255173.1\|84182_84440_+	ogr/Delta-like zinc finger family protein	A5X9H0	Aeromonas_virus	1.1e-14	51.5
WP_063541496.1\|84482_84665_-	hypothetical protein	NA	NA	NA	NA
WP_063541498.1\|84753_85092_-	helix-turn-helix transcriptional regulator	A0A2H4JFL3	uncultured_Caudovirales_phage	1.8e-15	44.9
WP_063541500.1\|85176_85377_+	DNA-binding protein	A0A2H4JE67	uncultured_Caudovirales_phage	5.5e-09	49.2
WP_063541502.1\|85406_85886_+	hypothetical protein	A0A2H4JG61	uncultured_Caudovirales_phage	5.7e-36	51.0
WP_063541504.1\|85882_86122_+	hypothetical protein	NA	NA	NA	NA
WP_063541506.1\|86189_86423_+	hypothetical protein	NA	NA	NA	NA
WP_063546588.1\|86431_89119_+	DUF927 domain-containing protein	A0A2H4J936	uncultured_Caudovirales_phage	1.9e-269	52.1
WP_063541508.1\|89124_89388_+	hypothetical protein	NA	NA	NA	NA
WP_063541510.1\|89469_89745_+	hypothetical protein	NA	NA	NA	NA
WP_063546590.1\|89774_90155_+	DUF2528 family protein	NA	NA	NA	NA
WP_063541513.1\|91077_92250_+	hypothetical protein	V9IQN0	Stenotrophomonas_phage	1.2e-71	39.8
WP_063541515.1\|92555_93875_+	DUF4102 domain-containing protein	Q7M297	Enterobacteria_phage	2.1e-64	34.0
WP_063546592.1\|94804_95785_+\|integrase	integrase	NA	NA	NA	NA
WP_081255175.1\|95781_96057_+	hypothetical protein	NA	NA	NA	NA
WP_146226828.1\|96525_98082_-	hypothetical protein	NA	NA	NA	NA
WP_063541519.1\|99071_99368_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A2H4JBF4	uncultured_Caudovirales_phage	4.7e-33	75.5
WP_063541521.1\|99357_99597_-	type II toxin-antitoxin system RelB/DinJ family antitoxin	A0A2H4JBG1	uncultured_Caudovirales_phage	8.8e-30	83.5
WP_063541524.1\|99753_100455_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	4.6e-103	78.1
WP_063541526.1\|100464_100935_-	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	5.4e-55	67.3
WP_054891260.1\|100962_102246_-	arsenic transporter	A0A2H4J144	uncultured_Caudovirales_phage	1.4e-169	72.5
WP_063541527.1\|102264_102612_-	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	1.5e-33	63.1
WP_063541529.1\|102687_104985_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
104082:104100	attR	NA	NA	NA	NA
WP_063541531.1\|105124_105841_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.7e-31	35.7
WP_063541533.1\|105842_107213_+	HAMP domain-containing protein	NA	NA	NA	NA
WP_063541535.1\|107400_107754_+	hypothetical protein	NA	NA	NA	NA
WP_063541537.1\|107823_108285_-	hypothetical protein	NA	NA	NA	NA
WP_063541539.1\|108284_109199_-	hypothetical protein	NA	NA	NA	NA
WP_063541541.1\|109309_110233_-	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
WP_063541543.1\|110305_112084_-	SUMF1/EgtB/PvdO family nonheme iron enzyme	NA	NA	NA	NA
WP_063541545.1\|112076_113285_-	hypothetical protein	NA	NA	NA	NA
WP_054891238.1\|113284_113989_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	4.3e-16	33.3
WP_063541547.1\|113988_116979_-	protein kinase	A0A1V0SDC3	Indivirus	7.5e-17	27.4
WP_063541549.1\|116987_117707_-	serine/threonine-protein phosphatase	NA	NA	NA	NA
WP_155738176.1\|117703_118366_-	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_063541551.1\|118362_121869_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_063541553.1\|121865_123173_-	DotU family type VI secretion system protein	NA	NA	NA	NA
WP_054891233.1\|123179_124514_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_054891232.1\|124529_125027_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_063541555.1\|125075_126431_-	type VI secretion system-associated FHA domain protein TagH	NA	NA	NA	NA
WP_054891230.1\|126827_127865_+	type VI secretion system protein TssA	NA	NA	NA	NA
WP_054891229.1\|127922_128438_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_063541557.1\|128448_129942_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_054891227.1\|130046_130535_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_063541559.1\|130626_131142_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_054891225.1\|131138_133001_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_054891224.1\|132964_134014_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA

DBSCAN-SWA_2

959367 : 973821

Pseudomonas_phage(25.0%)

integrase,capsid,tail

attL 952467:952512|attR 965951:965996

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
952467:952512	attL	NA	NA	NA	NA
WP_063542388.1\|959367_960663_+\|integrase	site-specific integrase	A0A2D1GND4	Pseudomonas_phage	5.7e-115	51.3
WP_155738184.1\|960663_960897_+	DNA-binding protein	NA	NA	NA	NA
WP_155738239.1\|961011_962166_+\|capsid	phage major capsid protein	A0A0R6PDU5	Moraxella_phage	2.7e-31	32.7
WP_063542392.1\|962297_962495_+	hypothetical protein	NA	NA	NA	NA
WP_063542394.1\|962749_963112_+	hypothetical protein	A0A1B0VML3	Pseudomonas_phage	2.4e-23	46.5
WP_063542396.1\|963111_963711_+\|tail	tail assembly protein	A0A2H4J1H0	uncultured_Caudovirales_phage	1.4e-55	57.4
WP_155738185.1\|963799_964603_-	hypothetical protein	NA	NA	NA	NA
WP_081255190.1\|964647_965319_-	hypothetical protein	Q858R9	Enterobacteria_phage	6.3e-41	45.3
WP_063542400.1\|965545_965764_+	hypothetical protein	NA	NA	NA	NA
WP_063542402.1\|966042_969786_-	bifunctional diguanylate cyclase/phosphodiesterase	A0A127AWB9	Bacillus_phage	5.7e-14	37.5
965951:965996	attR	NA	NA	NA	NA
WP_063542404.1\|969917_971771_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	2.4e-37	33.2
WP_063542406.1\|971838_973821_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	1.7e-73	36.9

DBSCAN-SWA_3

1618875 : 1626636

Thermobifida_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_063543167.1\|1618875_1619730_-	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	2.0e-07	30.2
WP_054894383.1\|1619732_1620197_-	PTS IIA-like nitrogen regulatory protein PtsN	NA	NA	NA	NA
WP_054894382.1\|1620209_1620518_-	ribosome-associated translation inhibitor RaiA	A0A220NU75	Escherichia_phage	1.5e-05	35.2
WP_063543169.1\|1620596_1622090_-	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_054894380.1\|1622263_1622989_-	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.8e-23	26.5
WP_054894379.1\|1622989_1623514_-	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_054894378.1\|1623500_1624073_-	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_054894377.1\|1624081_1624606_-	HAD family hydrolase	A0A140XBD6	Dickeya_phage	9.0e-27	47.4
WP_054894376.1\|1624606_1625581_-	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	5.2e-36	32.9
WP_063543171.1\|1625826_1626636_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	4.5e-25	32.4

DBSCAN-SWA_4

2532878 : 2568714

Staphylococcus_phage(33.33%)

protease,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054895451.1\|2532878_2533415_-\|protease	ATP-dependent zinc protease	NA	NA	NA	NA
WP_054895452.1\|2533691_2534408_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_054895453.1\|2534404_2535295_+	methylisocitrate lyase	NA	NA	NA	NA
WP_063544145.1\|2535453_2536581_+	2-methylcitrate synthase	NA	NA	NA	NA
WP_063544147.1\|2536738_2539327_+	Fe/S-dependent 2-methylisocitrate dehydratase AcnD	NA	NA	NA	NA
WP_063544149.1\|2539472_2540666_+	2-methylaconitate cis-trans isomerase PrpF	NA	NA	NA	NA
WP_063544151.1\|2540771_2543381_-	bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase	NA	NA	NA	NA
WP_063544153.1\|2543788_2544256_+	DUF1289 domain-containing protein	NA	NA	NA	NA
WP_063544155.1\|2544324_2545077_+	hypothetical protein	NA	NA	NA	NA
WP_028634508.1\|2545088_2545445_-	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
WP_063544157.1\|2545498_2546578_-	patatin-like phospholipase family protein	NA	NA	NA	NA
WP_054894716.1\|2546745_2547054_+	PepSY domain-containing protein	NA	NA	NA	NA
WP_054894717.1\|2547053_2547368_+	PepSY domain-containing protein	NA	NA	NA	NA
WP_054894718.1\|2547368_2548040_+	response regulator transcription factor	NA	NA	NA	NA
WP_063544159.1\|2548036_2549356_+	sensor histidine kinase	NA	NA	NA	NA
WP_063544161.1\|2549594_2550752_+	HPP family protein	NA	NA	NA	NA
WP_054894721.1\|2550725_2551592_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_063544163.1\|2551676_2552969_-	protein kinase	NA	NA	NA	NA
WP_063544165.1\|2553129_2555019_+	propionyl-CoA synthetase	A0A2H4PQU7	Staphylococcus_phage	2.8e-54	29.2
WP_063546697.1\|2555049_2556126_-	cell division protein ZapE	NA	NA	NA	NA
WP_063544167.1\|2556233_2556476_-	hypothetical protein	NA	NA	NA	NA
WP_063544169.1\|2556940_2559328_-	hybrid sensor histidine kinase/response regulator	Q8QNA2	Ectocarpus_siliculosus_virus	2.6e-12	25.7
WP_054894727.1\|2559339_2559801_-	response regulator	NA	NA	NA	NA
WP_063544171.1\|2559824_2562068_-	GAF domain-containing protein	B5LWN8	Feldmannia_species_virus	4.9e-29	22.1
WP_063544173.1\|2562357_2562885_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_063544175.1\|2562918_2563452_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_054894731.1\|2563469_2564003_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_063544177.1\|2564006_2564510_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_054894733.1\|2564561_2565341_+	molecular chaperone	NA	NA	NA	NA
WP_063544179.1\|2565448_2567746_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_063544181.1\|2567742_2568714_+\|coat	spore coat U domain-containing protein	NA	NA	NA	NA

DBSCAN-SWA_5

2663313 : 2673862

uncultured_Caudovirales_phage(77.78%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_063544265.1\|2663313_2664594_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	7.2e-94	45.0
WP_063544267.1\|2664594_2665986_+	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_063544269.1\|2666105_2667065_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_063544270.1\|2667163_2668162_-	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	2.6e-152	79.0
WP_054892321.1\|2668170_2668506_-	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	1.8e-44	76.6
WP_063544271.1\|2668502_2668799_-	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	6.4e-30	66.7
WP_063544273.1\|2668798_2669158_-	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	8.0e-35	62.5
WP_054892318.1\|2669159_2669552_-	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	7.6e-55	80.6
WP_063544275.1\|2669638_2671018_-	uracil-xanthine permease	H9YQ34	environmental_Halophage	8.2e-27	50.7
WP_063544277.1\|2671202_2671874_-	Bax inhibitor-1/YccA family protein	A0A2H4JFM9	uncultured_Caudovirales_phage	1.7e-102	90.1
WP_063544279.1\|2672569_2673862_-	PAS domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	2.4e-12	59.5

DBSCAN-SWA_6

4045764 : 4136442

117

uncultured_Caudovirales_phage(43.84%)

protease,head,portal,tail,terminase,capsid,holin,integrase,lysis

attL 4133061:4133076|attR 4144130:4144145

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081255269.1\|4045764_4046238_+\|integrase	integrase	A0A2H4JDJ8	uncultured_Caudovirales_phage	2.4e-34	52.6
WP_063545353.1\|4046564_4046804_-	hypothetical protein	NA	NA	NA	NA
WP_063545354.1\|4047173_4047836_+	SOS response-associated peptidase	A0A2H4J991	uncultured_Caudovirales_phage	1.2e-95	71.9
WP_063545355.1\|4047829_4048036_-	hypothetical protein	NA	NA	NA	NA
WP_081255344.1\|4048053_4048263_-	hypothetical protein	NA	NA	NA	NA
WP_063545356.1\|4048434_4049448_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_081255270.1\|4049506_4050367_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_081255271.1\|4050545_4051073_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_063545358.1\|4051358_4051799_+	hypothetical protein	NA	NA	NA	NA
WP_063546799.1\|4051810_4052074_-	hypothetical protein	H2BDA1	Pseudomonas_phage	1.5e-22	67.9
WP_063545359.1\|4052091_4052454_-	hypothetical protein	J7HXL1	Pseudomonas_phage	5.8e-17	50.0
WP_063545360.1\|4052450_4053098_-	glycoside hydrolase family 19 protein	A0A2H4J3Y3	uncultured_Caudovirales_phage	1.4e-74	67.0
WP_063545361.1\|4053159_4053498_-	hypothetical protein	NA	NA	NA	NA
WP_063545362.1\|4053494_4054508_-	hypothetical protein	NA	NA	NA	NA
WP_063545363.1\|4055518_4059148_-	DUF1983 domain-containing protein	A0A0S2SYC5	Pseudomonas_phage	0.0e+00	54.9
WP_063545364.1\|4059204_4059825_-\|tail	tail assembly protein	A0A2H4J1H0	uncultured_Caudovirales_phage	1.6e-67	64.9
WP_155738219.1\|4059929_4060106_-	hypothetical protein	NA	NA	NA	NA
WP_063545365.1\|4060243_4060435_+	hypothetical protein	NA	NA	NA	NA
WP_155738220.1\|4060518_4061499_-	hypothetical protein	NA	NA	NA	NA
WP_063545366.1\|4061633_4062119_-	hypothetical protein	NA	NA	NA	NA
WP_063545367.1\|4062297_4062918_+	hypothetical protein	NA	NA	NA	NA
WP_063545368.1\|4063117_4063876_-	C40 family peptidase	A0A2H4J1J7	uncultured_Caudovirales_phage	3.3e-123	79.2
WP_063545369.1\|4063878_4064628_-\|tail	phage minor tail protein L	A0A0S2SY57	Pseudomonas_phage	1.0e-119	78.7
WP_063545370.1\|4064624_4064963_-\|tail	phage tail protein	Q6UAW6	Klebsiella_phage	6.6e-23	45.5
WP_063545371.1\|4064965_4068250_-\|tail	phage tail tape measure protein	A0A0A1IX77	Pseudomonas_phage	5.2e-72	35.7
WP_063545373.1\|4068530_4068875_-	hypothetical protein	NA	NA	NA	NA
WP_063545374.1\|4068915_4069416_-	hypothetical protein	A0A2D1GNF2	Pseudomonas_phage	3.8e-67	73.8
WP_063545375.1\|4069470_4069857_-	DUF3168 domain-containing protein	A0A2D1GNT4	Pseudomonas_phage	2.6e-55	85.9
WP_063545376.1\|4069849_4070350_-	HK97 gp10 family phage protein	A0A2D1GNN2	Pseudomonas_phage	2.3e-64	70.9
WP_063545377.1\|4070353_4070536_-	hypothetical protein	A0A2D1GNQ5	Pseudomonas_phage	5.2e-06	52.6
WP_063545378.1\|4070547_4070874_-\|head	phage head closure protein	A0A2D1GNG1	Pseudomonas_phage	3.3e-27	65.2
WP_063545379.1\|4070870_4071212_-\|head,tail	phage gp6-like head-tail connector protein	I7GYA0	Xanthomonas_virus	3.2e-09	37.9
WP_063545380.1\|4071214_4071748_-	hypothetical protein	NA	NA	NA	NA
WP_063545381.1\|4071796_4072978_-\|capsid	phage major capsid protein	H2BDB0	Pseudomonas_virus	1.6e-124	62.1
WP_063545382.1\|4072980_4073838_-\|protease	Clp protease ClpP	A0A1V0E8B8	Vibrio_phage	1.2e-97	64.3
WP_063545383.1\|4073854_4075153_-\|portal	phage portal protein	H2BDA8	Pseudomonas_virus	6.9e-185	71.2
WP_063545384.1\|4075303_4076983_-\|terminase	terminase large subunit	S4TSQ6	Salmonella_phage	3.6e-194	61.0
WP_063545385.1\|4076986_4077487_-	hypothetical protein	A0A2H4J8R0	uncultured_Caudovirales_phage	1.1e-10	35.3
WP_063545386.1\|4077640_4077979_-	HNH endonuclease	B5WZZ4	Pseudomonas_phage	5.8e-27	50.5
WP_063545387.1\|4077978_4078296_-	hypothetical protein	A0A059VJW1	Pseudomonas_phage	4.0e-14	54.7
WP_063545388.1\|4078295_4078667_-	hypothetical protein	A0A059VK40	Pseudomonas_phage	1.8e-42	74.8
WP_063545389.1\|4078695_4079316_-	hypothetical protein	NA	NA	NA	NA
WP_063545390.1\|4079428_4079641_-	hypothetical protein	A0A2H4JES7	uncultured_Caudovirales_phage	9.9e-25	85.7
WP_155738221.1\|4079807_4080230_-	hypothetical protein	NA	NA	NA	NA
WP_063545391.1\|4080600_4080990_-	hypothetical protein	A0A1W6JTD2	Pseudomonas_phage	1.0e-43	64.1
WP_063546801.1\|4081000_4081318_-	hypothetical protein	A0A2D1GNG3	Pseudomonas_phage	2.4e-30	62.9
WP_063545392.1\|4081562_4082861_-\|integrase	site-specific integrase	A0A2D1GND4	Pseudomonas_phage	3.8e-127	54.4
WP_063545393.1\|4082857_4083286_-	VRR-NUC domain-containing protein	A0A2D1GNH3	Pseudomonas_phage	1.4e-54	80.1
WP_063545394.1\|4083282_4083579_-	DUF1364 domain-containing protein	A0A220NQY2	Salmonella_phage	1.7e-30	66.3
WP_063545395.1\|4083581_4084394_-	AAA family ATPase	A0A2H4J3E5	uncultured_Caudovirales_phage	2.7e-94	64.9
WP_081255274.1\|4084383_4085241_-	replication protein	B5WZX9	Pseudomonas_phage	9.9e-39	37.8
WP_063545396.1\|4085361_4085586_-	Cro/Cl family transcriptional regulator	NA	NA	NA	NA
WP_063545397.1\|4085690_4086578_+	helix-turn-helix domain-containing protein	H2BD63	Pseudomonas_phage	2.2e-41	39.8
WP_081255275.1\|4086602_4087679_+	hypothetical protein	NA	NA	NA	NA
WP_063545398.1\|4087678_4088644_+	RelA/SpoT domain-containing protein	NA	NA	NA	NA
WP_155738251.1\|4088658_4088964_-	DUF1654 domain-containing protein	A0A127KNY9	Pseudomonas_phage	3.8e-17	59.2
WP_063545400.1\|4089354_4090029_+	polysaccharide lyase family 7 protein	NA	NA	NA	NA
WP_063545401.1\|4090174_4091026_+	hypothetical protein	A0A1B0YZX8	Pseudomonas_phage	4.5e-84	60.1
WP_063545402.1\|4091029_4091413_+	helix-turn-helix transcriptional regulator	A0A2H4JA92	uncultured_Caudovirales_phage	2.6e-23	60.0
WP_063545403.1\|4091433_4091700_+	hypothetical protein	NA	NA	NA	NA
WP_063545404.1\|4091696_4092155_+	hypothetical protein	A0A2H4J101	uncultured_Caudovirales_phage	7.6e-46	59.2
WP_063545405.1\|4092245_4093082_-	hypothetical protein	S5W9H2	Leptospira_phage	2.3e-08	36.3
WP_063546807.1\|4093188_4093575_+	hypothetical protein	A0A2H4J2C6	uncultured_Caudovirales_phage	5.0e-51	77.3
WP_081255277.1\|4093601_4094420_-	hypothetical protein	NA	NA	NA	NA
WP_081255278.1\|4094363_4094975_+	DUF3850 domain-containing protein	NA	NA	NA	NA
WP_081255280.1\|4095459_4095759_-	hypothetical protein	NA	NA	NA	NA
WP_063545407.1\|4096367_4096655_+	hypothetical protein	A0A2H4JA03	uncultured_Caudovirales_phage	1.9e-39	86.0
WP_063545408.1\|4096671_4096872_+	hypothetical protein	NA	NA	NA	NA
WP_063545409.1\|4096923_4097475_+	hypothetical protein	A0A0U2CID3	Pseudomonas_phage	4.1e-46	54.9
WP_063545410.1\|4097514_4097760_+	DUF4224 domain-containing protein	NA	NA	NA	NA
WP_063545411.1\|4097761_4098811_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4JDJ8	uncultured_Caudovirales_phage	2.9e-101	57.2
WP_063545412.1\|4099086_4099458_-	hypothetical protein	NA	NA	NA	NA
WP_063545413.1\|4099454_4099718_-	hypothetical protein	NA	NA	NA	NA
WP_063545414.1\|4099726_4101928_-	hypothetical protein	A0A2H4J3Z5	uncultured_Caudovirales_phage	9.9e-51	49.0
WP_063545415.1\|4101951_4103580_-\|terminase	phage terminase large subunit	A0A2H4JCA3	uncultured_Caudovirales_phage	4.2e-272	82.7
WP_063545416.1\|4103569_4103905_-	hypothetical protein	A0A2H4J7H0	uncultured_Caudovirales_phage	4.4e-43	81.5
WP_063545417.1\|4103906_4106474_-	hypothetical protein	A0A193GZ61	Enterobacter_phage	5.9e-196	44.4
WP_063545418.1\|4106535_4108464_-	hypothetical protein	A0A2H4J9W0	uncultured_Caudovirales_phage	3.3e-135	48.1
WP_063545419.1\|4108460_4110476_-	hypothetical protein	A0A2H4JE92	uncultured_Caudovirales_phage	8.9e-240	63.0
WP_063545420.1\|4110475_4110982_-	hypothetical protein	A0A2H4J679	uncultured_Caudovirales_phage	6.5e-22	62.2
WP_063545421.1\|4110971_4111427_-	GNAT family N-acetyltransferase	A0A2H4J9Z5	uncultured_Caudovirales_phage	3.3e-49	62.6
WP_063545422.1\|4111436_4113599_-	hypothetical protein	A0A2H4J6H2	uncultured_Caudovirales_phage	0.0e+00	73.3
WP_063546809.1\|4113598_4114189_-	hypothetical protein	A0A2H4JCY7	uncultured_Caudovirales_phage	1.0e-79	76.2
WP_063545423.1\|4114268_4114733_-	hypothetical protein	NA	NA	NA	NA
WP_081255282.1\|4114778_4115654_-	hypothetical protein	A0A2H4JC66	uncultured_Caudovirales_phage	1.8e-120	75.7
WP_063545425.1\|4115849_4116686_-	hypothetical protein	A0A2H4JEQ5	uncultured_Caudovirales_phage	6.8e-101	69.8
WP_155738222.1\|4116688_4116931_-	hypothetical protein	A0A2H4JC55	uncultured_Caudovirales_phage	1.5e-21	66.2
WP_063545427.1\|4116927_4118544_-\|tail	phage tail protein	A0A2H4J3N6	uncultured_Caudovirales_phage	1.6e-231	77.6
WP_063545428.1\|4118540_4118744_-	hypothetical protein	NA	NA	NA	NA
WP_063545429.1\|4118749_4119151_-	hypothetical protein	NA	NA	NA	NA
WP_063545430.1\|4119219_4119669_-\|lysis	lysis protein	NA	NA	NA	NA
WP_063545431.1\|4119665_4120178_-	glycoside hydrolase family protein	I6NW41	Burkholderia_virus	2.7e-52	60.3
WP_063545432.1\|4120174_4120420_-\|holin	holin	A0A0U1UNM6	Pseudomonas_phage	1.5e-13	53.8
WP_081255283.1\|4120691_4121030_-	hypothetical protein	A0A2H4JEE3	uncultured_Caudovirales_phage	8.7e-23	63.3
WP_063545433.1\|4121010_4121451_-	hypothetical protein	NA	NA	NA	NA
WP_063545434.1\|4121495_4121750_-	hypothetical protein	NA	NA	NA	NA
WP_063545435.1\|4121835_4122279_-	RusA family crossover junction endodeoxyribonuclease	J7I4J7	Pseudomonas_phage	6.4e-50	66.7
WP_063545436.1\|4122271_4122460_-	hypothetical protein	NA	NA	NA	NA
WP_063545437.1\|4122459_4122753_-	hypothetical protein	K4NZ29	Pseudomonas_phage	5.4e-05	56.5
WP_063546813.1\|4122745_4123312_-	hypothetical protein	A0A2H4J903	uncultured_Caudovirales_phage	9.1e-33	45.0
WP_155738223.1\|4123259_4124237_-	hypothetical protein	NA	NA	NA	NA
WP_063546815.1\|4124239_4124551_-	transcriptional regulator	H6WRX6	Salmonella_phage	5.2e-14	48.5
WP_063545439.1\|4124553_4124775_-	transcriptional regulator	A0A2D1GND2	Pseudomonas_phage	3.2e-18	61.8
WP_063545441.1\|4125485_4125959_+	hypothetical protein	NA	NA	NA	NA
WP_063545442.1\|4126614_4126869_+	hypothetical protein	NA	NA	NA	NA
WP_155738224.1\|4126865_4127021_+	hypothetical protein	NA	NA	NA	NA
WP_155738225.1\|4127021_4127411_+	DUF551 domain-containing protein	NA	NA	NA	NA
WP_063545444.1\|4127535_4128297_+	hypothetical protein	A0A2H4IZU8	uncultured_Caudovirales_phage	4.0e-92	67.3
WP_063545445.1\|4128283_4129930_+	Heme peroxidase	A0A2H4J6P1	uncultured_Caudovirales_phage	2.3e-153	64.7
WP_063545446.1\|4129944_4130145_+	hypothetical protein	A0A2H4J6K7	uncultured_Caudovirales_phage	8.2e-13	54.5
WP_063545447.1\|4130155_4130974_+	hypothetical protein	A0A2H4J7E6	uncultured_Caudovirales_phage	1.5e-68	54.5
WP_063545448.1\|4131040_4132843_+	DNA methyltransferase	A0A0U1T6D1	Pseudomonas_phage	1.5e-217	74.3
WP_063545449.1\|4132839_4133157_+	hypothetical protein	NA	NA	NA	NA
4133061:4133076	attL	NA	NA	NA	NA
WP_063545450.1\|4133308_4133938_+	hypothetical protein	K4NZ01	Pseudomonas_phage	1.4e-05	57.1
WP_063545452.1\|4135012_4135213_+	hypothetical protein	NA	NA	NA	NA
WP_063545453.1\|4135222_4135468_+	hypothetical protein	W6MVE5	Pseudomonas_phage	9.7e-24	65.0
WP_063545454.1\|4135464_4136442_-\|integrase	site-specific integrase	W6MYA3	Pseudomonas_phage	3.8e-119	66.8
4144130:4144145	attR	NA	NA	NA	NA

DBSCAN-SWA_7

4819819 : 4827766

Clostridioides_phage(16.67%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_063545853.1\|4819819_4820356_-	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	2.0e-21	44.4
WP_054890952.1\|4820491_4821133_-	peptidase P60	B6V2P9	Bacillus_phage	2.5e-18	33.9
WP_054890953.1\|4821258_4821963_-	DnaA regulatory inactivator Hda	NA	NA	NA	NA
WP_054890954.1\|4822285_4823221_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_081255349.1\|4823247_4824141_+	alpha/beta hydrolase	A0A0G2Y6Q1	Acanthamoeba_polyphaga_mimivirus	5.7e-21	31.7
WP_063545855.1\|4824298_4825591_+	MFS transporter	Q6JIH2	Burkholderia_virus	1.3e-63	35.4
WP_063545856.1\|4826267_4826978_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3HI61	Synechococcus_phage	5.1e-41	37.9
WP_063545857.1\|4827007_4827766_-	MBL fold metallo-hydrolase	A8ATK9	Listeria_phage	8.5e-18	27.7

DBSCAN-SWA_8

4862131 : 4913541

uncultured_Caudovirales_phage(40.74%)

plate,holin,tRNA,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054891002.1\|4862131_4863907_-\|tRNA	aspartate--tRNA ligase	A0A1V0SIS0	Klosneuvirus	2.5e-12	26.7
WP_063545878.1\|4864001_4864220_-	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_054891004.1\|4864312_4864630_-	ribbon-helix-helix domain-containing protein	NA	NA	NA	NA
WP_023381917.1\|4864809_4865283_-	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	2.4e-18	36.4
WP_054891005.1\|4865564_4866158_+	cold shock domain-containing protein	A0A1X9IGI9	Lactococcus_phage	2.3e-10	48.3
WP_054891006.1\|4866176_4866383_-	hypothetical protein	NA	NA	NA	NA
WP_063545879.1\|4866386_4866806_-	HIT domain-containing protein	NA	NA	NA	NA
WP_063545880.1\|4867555_4868857_+	OprD family porin	NA	NA	NA	NA
WP_063545881.1\|4869016_4870732_+\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_063545882.1\|4870752_4871706_+	hypothetical protein	NA	NA	NA	NA
WP_063545883.1\|4871736_4872801_-	DNA polymerase IV	NA	NA	NA	NA
WP_063545884.1\|4873750_4876393_+	bifunctional lysylphosphatidylglycerol flippase/synthetase MprF	NA	NA	NA	NA
WP_054891013.1\|4876392_4877685_+	virulence factor family protein	NA	NA	NA	NA
WP_054891014.1\|4877722_4879621_-	potassium transporter Kup	M1IBC2	Acanthocystis_turfacea_Chlorella_virus	1.2e-76	34.3
WP_063545885.1\|4879889_4881221_+	30S ribosomal protein S12 methylthiotransferase RimO	NA	NA	NA	NA
WP_063545886.1\|4881330_4881789_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_054891017.1\|4881900_4882611_+	RNA-binding protein	NA	NA	NA	NA
WP_054891018.1\|4882660_4883122_+	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	3.9e-34	48.0
WP_063545887.1\|4883129_4883825_+\|tRNA	tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO	NA	NA	NA	NA
WP_054891020.1\|4883891_4884671_-	ferredoxin--NADP reductase	NA	NA	NA	NA
WP_054891021.1\|4884792_4885719_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_054891022.1\|4885722_4886088_-	diacylglycerol kinase	NA	NA	NA	NA
WP_054891023.1\|4886160_4886811_-	response regulator transcription factor	NA	NA	NA	NA
WP_054891024.1\|4887067_4887778_-	DTW domain-containing protein	NA	NA	NA	NA
WP_063545888.1\|4888000_4888423_+	hypothetical protein	NA	NA	NA	NA
WP_054891026.1\|4888424_4888628_-	hypothetical protein	NA	NA	NA	NA
WP_063545889.1\|4888984_4890103_+	LOG family protein	NA	NA	NA	NA
WP_081255302.1\|4890166_4890634_-	recombination regulator RecX	NA	NA	NA	NA
WP_063545891.1\|4890653_4891721_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	9.8e-113	62.3
WP_063545892.1\|4891825_4892308_-	nicotinamide-nucleotide amidohydrolase family protein	B5TK85	Pseudomonas_phage	4.8e-59	78.0
WP_063546862.1\|4892367_4892865_-	lysozyme	B5TK84	Pseudomonas_phage	5.0e-35	59.3
WP_063545893.1\|4892861_4893410_-	glycoside hydrolase family 19 protein	B5TK83	Pseudomonas_phage	2.1e-71	70.2
WP_081255304.1\|4893480_4893771_-	hypothetical protein	NA	NA	NA	NA
WP_081255305.1\|4893760_4894033_-	Com family DNA-binding transcriptional regulator	B5TK59	Pseudomonas_phage	4.1e-07	65.8
WP_063545896.1\|4894063_4895098_-	phage late control D family protein	A0A2H4JBF6	uncultured_Caudovirales_phage	1.1e-132	69.9
WP_063545897.1\|4895138_4895345_-\|tail	phage tail protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	3.2e-20	70.1
WP_063545898.1\|4895319_4896165_-\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	1.1e-82	54.6
WP_155738231.1\|4896180_4898211_-	hypothetical protein	NA	NA	NA	NA
WP_063545900.1\|4898335_4898638_-\|tail	phage tail assembly protein	A0A2H4J873	uncultured_Caudovirales_phage	1.5e-21	57.0
WP_054891039.1\|4898649_4899159_-\|tail	phage major tail tube protein	A0A2H4JBU0	uncultured_Caudovirales_phage	3.6e-65	72.5
WP_063545901.1\|4899172_4900339_-\|tail	phage tail sheath family protein	A0A2H4J869	uncultured_Caudovirales_phage	7.8e-180	81.8
WP_063545902.1\|4900445_4901042_-	hypothetical protein	NA	NA	NA	NA
WP_081255306.1\|4901081_4902818_-	hypothetical protein	A0A077K818	Ralstonia_phage	5.9e-83	52.8
WP_063545903.1\|4902810_4903419_-\|tail	phage tail protein I	A0A2H4JDH5	uncultured_Caudovirales_phage	4.3e-73	63.5
WP_063545904.1\|4903420_4904302_-\|plate	baseplate assembly protein	A0A2H4JFK9	uncultured_Caudovirales_phage	6.7e-107	68.9
WP_063545905.1\|4904298_4904625_-\|plate	phage baseplate protein	A0A2H4JA09	uncultured_Caudovirales_phage	3.1e-33	64.2
WP_063545906.1\|4904712_4905273_-\|plate	phage baseplate assembly protein V	A0A2H4JG06	uncultured_Caudovirales_phage	2.1e-53	66.5
WP_063545907.1\|4905269_4905767_-	hypothetical protein	A0A2H4J881	uncultured_Caudovirales_phage	4.4e-15	32.5
WP_054891048.1\|4905778_4906102_-\|holin	pyocin R2, holin	B5TK61	Pseudomonas_phage	5.0e-44	86.4
WP_063545908.1\|4906642_4907377_-	helix-turn-helix transcriptional regulator	B5TK58	Pseudomonas_phage	8.3e-119	85.2
WP_063545909.1\|4907441_4907882_-	hypothetical protein	NA	NA	NA	NA
WP_063545910.1\|4908029_4910600_+	DNA mismatch repair protein MutS	A0A1V0SGG8	Hokovirus	2.0e-26	23.0
WP_054891051.1\|4910736_4911060_+	ferredoxin family protein	NA	NA	NA	NA
WP_054891052.1\|4911563_4912571_-	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	5.0e-34	35.8
WP_063545911.1\|4912680_4913541_-	peptidoglycan DD-metalloendopeptidase family protein	I3PV79	Clostridium_phage	5.5e-13	35.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage