CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP016761	Fictibacillus arsenicus strain G25-54 chromosome, complete genome	2 crisprs	csa3,DinG,WYL,DEDDh,cas3	0	0	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP016761_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016761_1

444014-444120

Orphan

Consensus_repeat	Method
AAGTTCGTCAACAAAACCAACAGTCTCAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP016761_1

>merge|NZ_CP016761|1|444014-444120|CRISPRCasFinder
AAGTTCGTCAACAAAACCAACAGTCTCAAGCTGGTCAATCTTACGGAACTGAATTTGCTAGCGAAACTAATGCTCAAGAAGTTCGTCAGCAAAACCAACAGTCTCAA

>NZ_CP016761|1|1|444014-444120|CRISPRCasFinder
AAGTTCGTCAACAAAACCAACAGTCTCAA	GCTGGTCAATCTTACGGAACTGAATTTGCTAGCGAAACTAATGCTCAAG
AAGTTCGTCAGCAAAACCAACAGTCTCAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016761.1\|WP_066286185.1\|439717_439873_-\|small,-acid-soluble-spore-protein-K	unknown	unknown	gnl\|CDD\|285399
NZ_CP016761.1\|WP_066286187.1\|439975_440242_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379438
NZ_CP016761.1\|WP_083207621.1\|441603_442728_+\|A/G-specific-adenine-glycosylase	unknown	unknown	gnl\|CDD\|224115
NZ_CP016761.1\|WP_066294531.1\|454238_455309_-\|aromatic-acid-exporter-family-protein	unknown	unknown	gnl\|CDD\|226614
NZ_CP016761.1\|WP_066286183.1\|438970_439276_+\|YfhH-family-protein	unknown	unknown	gnl\|CDD\|378063
NZ_CP016761.1\|WP_172827322.1\|452991_453864_-\|NERD-domain-containing-protein	unknown	unknown	gnl\|CDD\|377990
NZ_CP016761.1\|WP_066286222.1\|455520_456807_-\|glutamate-1-semialdehyde-2,1-aminomutase	unknown	unknown	gnl\|CDD\|183493
NZ_CP016761.1\|WP_066286215.1\|449311_450913_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173858
NZ_CP016761.1\|WP_066286214.1\|448277_449252_+\|dipeptide-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|236898
NZ_CP016761.1\|WP_066286216.1\|451014_452019_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NZ_CP016761.1\|WP_066286211.1\|445339_447082_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP016761.1\|WP_066286203.1\|442724_443480_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187602
NZ_CP016761.1\|WP_066286205.1\|443591_443816_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016761.1\|WP_066286195.1\|441296_441611_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016761.1\|WP_066286213.1\|447295_448303_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223521
NZ_CP016761.1\|WP_066286209.1\|444748_445276_+\|DUF402-domain-containing-protein	unknown	unknown	gnl\|CDD\|184219
NZ_CP016761.1\|WP_066286218.1\|452032_452947_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224094
NZ_CP016761.1\|WP_066286190.1\|440256_441258_-\|metal-dependent-hydrolase	unknown	unknown	gnl\|CDD\|224899
NZ_CP016761.1\|WP_066286178.1\|438228_438900_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|187643
NZ_CP016761.1\|WP_077364736.1\|439510_439678_-\|YpzG-family-protein	unknown	unknown	gnl\|CDD\|372924

Protein	Function_ID	Function_description	E-value
NZ_CP016761.1\|WP_066286185.1\|439717_439873_-\|small,-acid-soluble-spore-protein-K	gnl\|CDD\|285399	pfam08176, SspK, Small acid-soluble spore protein K family. This family consists of the small acid-soluble spore proteins (SASP) belonging to the K type (sspK). The sspK are unique to the spores of Bacillus subtilis and are expressed only in the forespore compartment of sporulating cells of this organism. The sspK gene is monocistronic and transcription is primarily by the RNA polymerase with the forespore-specific sigma factor, sigma-G. Mutation deleting sspK results in loss of SspK from the spore but had no discernible effect on sporulation, spore properties or spore germination.	4.98094e-12
NZ_CP016761.1\|WP_066286187.1\|439975_440242_+\|hypothetical-protein	gnl\|CDD\|379438	pfam14043, WVELL, WVELL protein. This family includes the B. subtilis YfjH protein, which is functionally uncharacterized. This is not a homolog of E. coli YfjH, a synonym for IscX, which belongs to pfam04384. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length and contain a highly conserved WVELL motif.	1.54581e-34
NZ_CP016761.1\|WP_083207621.1\|441603_442728_+\|A/G-specific-adenine-glycosylase	gnl\|CDD\|224115	COG1194, MutY, A/G-specific DNA glycosylase [DNA replication, recombination, and repair].	2.08346e-143
NZ_CP016761.1\|WP_066294531.1\|454238_455309_-\|aromatic-acid-exporter-family-protein	gnl\|CDD\|226614	COG4129, COG4129, Predicted membrane protein [Function unknown].	5.67657e-67
NZ_CP016761.1\|WP_066286183.1\|438970_439276_+\|YfhH-family-protein	gnl\|CDD\|378063	pfam08838, DUF1811, Protein of unknown function (DUF1811). This is a bacterial family of uncharacterized proteins. Some of the proteins are annotated as being transcriptional regulators. The structure of one of the proteins in this family has revealed a beta-barrel like structure with helix-turn-helix like motif.	2.34375e-46
NZ_CP016761.1\|WP_172827322.1\|452991_453864_-\|NERD-domain-containing-protein	gnl\|CDD\|377990	pfam08378, NERD, Nuclease-related domain. The nuclease-related domain (NERD) is found in a range of bacterial as well as archaeal and plant proteins. It has distant similarity to endonucleases (hence its name) and its predicted secondary structure is helix - sheet - sheet - sheet - sheet - weak sheet/long loop - helix - sheet - sheet. The majority of NERD-containing proteins are single-domain, but in several cases proteins containing NERD have additional domains which in 75% of cases are involved in DNA processing.	4.65217e-15
NZ_CP016761.1\|WP_066286215.1\|449311_450913_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173858	cd08493, PBP2_DppA_like, The substrate-binding component of an ABC-type dipeptide import system contains the type 2 periplasmic binding fold. This family represents the substrate-binding domain of an ATP-binding cassette (ABC)-type dipeptide import system. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP016761.1\|WP_066286214.1\|448277_449252_+\|dipeptide-ABC-transporter-ATP-binding-protein	gnl\|CDD\|236898	PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional.	2.74564e-161
NZ_CP016761.1\|WP_066286216.1\|451014_452019_+\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	2.9665e-134
NZ_CP016761.1\|WP_066286211.1\|445339_447082_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	0
NZ_CP016761.1\|WP_066286203.1\|442724_443480_+\|SDR-family-oxidoreductase	gnl\|CDD\|187602	cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR. This subgroup resembles the SDR family, but does not have a perfect match to the NAD-binding motif or the catalytic tetrad characteristic of the SDRs. It includes the SDRs, Q9HYA2 from Pseudomonas aeruginosa PAO1 and APE0912 from Aeropyrum pernix K1. BKR catalyzes the NADPH-dependent reduction of ACP in the first reductive step of de novo fatty acid synthesis (FAS). FAS consists of four elongation steps, which are repeated to extend the fatty acid chain through the addition of two-carbo units from malonyl acyl-carrier protein (ACP): condensation, reduction, dehydration, and a final reduction. Type II FAS, typical of plants and many bacteria, maintains these activities on discrete polypeptides, while type I FAS utilizes one or two multifunctional polypeptides. BKR resembles enoyl reductase, which catalyzes the second reduction step in FAS. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	1.20162e-70
NZ_CP016761.1\|WP_066286222.1\|455520_456807_-\|glutamate-1-semialdehyde-2,1-aminomutase	gnl\|CDD\|183493	PRK12389, PRK12389, glutamate-1-semialdehyde aminotransferase; Provisional.	0
NZ_CP016761.1\|WP_077364736.1\|439510_439678_-\|YpzG-family-protein	gnl\|CDD\|372924	pfam14139, YpzG, YpzG-like protein. The YpzG-like protein family includes the B. subtilis YpzG protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 50 amino acids in length. There is a conserved QVNG sequence motif.	4.12328e-13
NZ_CP016761.1\|WP_066286213.1\|447295_448303_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223521	COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	0
NZ_CP016761.1\|WP_066286209.1\|444748_445276_+\|DUF402-domain-containing-protein	gnl\|CDD\|184219	PRK13662, PRK13662, hypothetical protein; Provisional.	1.43341e-116
NZ_CP016761.1\|WP_066286218.1\|452032_452947_+\|ABC-transporter-permease	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	2.93817e-114
NZ_CP016761.1\|WP_066286190.1\|440256_441258_-\|metal-dependent-hydrolase	gnl\|CDD\|224899	COG1988, COG1988, Predicted membrane-bound metal-dependent hydrolases [General function prediction only].	3.56079e-36
NZ_CP016761.1\|WP_066286178.1\|438228_438900_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|187643	cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine reductase (KDSR) and related proteins, classical (c) SDR. These proteins include members identified as KDSR, ribitol type dehydrogenase, and others. The group shows strong conservation of the active site tetrad and glycine rich NAD-binding motif of the classical SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	3.0969e-62

>NZ_CP016761.1|WP_066286205.1|443591_443816_-|hypothetical-protein
MYVGRDMTELSMTSKNEWKDEELAYFHHSLQQMAPYLNEEGTSIHREIIKEIEARGGLKRGEADWTHGTEVKYD
>NZ_CP016761.1|WP_066286203.1|442724_443480_+|SDR-family-oxidoreductase
MNLELEGKAVLVTGGSKGIGQAIAYAFLDEGAKVGIVGRTLSDLETAQKEGIEIFQGDVTDEHDRKRMMKDFLEKFGTIDVLVNNAGGSNGSTVMETSLEQFEEAMHLNFLSAVDLSKQAAEVMSENADGGAIINISSIFGRESGGKPTYNASKAAMISFTKSFGDEMISKGVRVNGVAPGSILHETGNWKKRLEQDPEKINAFVEEHISAGRFGTVEEVANVAVFLASKRASWVVGSTLNVDGGQSYSNF
>NZ_CP016761.1|WP_083207621.1|441603_442728_+|A/G-specific-adenine-glycosylase
MSKLNTTSNSIFSLDASYVKQFQEQLLTWYGENKRTLPWRENQDPYRVWVSEIMLQQTRVDTVIPYFKRFTSLFPTLQDLAYADEEKVLKAWEGLGYYSRVRNLQTAVKEVCESYGGKVPDTAKEIAGLKGVGPYTAGAILSIAYGIPEPAVDGNVMRVLSRILLVEEDISKPKTRILFEKAVRELISHEDPSSFNQAMMELGALICTPKSPACLLCPMRELCKGFEQGKQHELPVKLGKTKVRKAKMAAGILAGEDGRFLIHKRPSEGLLANMWEFPNTEYVVENKNAEKDALKGYLDENIGVEVVLEEKAGYIEHVFSHLKWEINIWQGKMLNGSVELPQDWKWVTADELDQYPFPVSHQKIIRLIKEAIIV
>NZ_CP016761.1|WP_066286195.1|441296_441611_+|hypothetical-protein
MLTVFMEYKVNPETLQSYEYEMASVIEELKKLGASDIQWYRAADQPSLYVEYFKVNDKEAYESIKEKRTSSEHPVFSKLFPFISGGAEKIHCWAFEKMNVKEDL
>NZ_CP016761.1|WP_066286190.1|440256_441258_-|metal-dependent-hydrolase
MDTGTHIVMGLGLGGLAMLDPAIANDPATSQAILAGTLIGSQAPDFDTILKLKNNAVYIRNHRGLTHSLPALVIWPLLLFGIISLFVPQADSGKLLLWTAIAVFLHVFVDIFNAYGTQALYPVSRKWVALGVISIFDPFIFFLHIAGLLLWYVGVHPGYTFLAVYVILVFYYIWRILARQRVNKIVLEKIPEAEEIYASPTIRWGQYHLAIKSKHEFFVAGLKNGKVTIWDTFDRLPVPQTKIIDAAKLDKNISAFLSFSPVHRWEVEKNDHGHMVQFIDLRYRSKGHYPFVAMVQLDENLNIITSYTGWVYSEDRLKKKMDFSPMDLLNNNE
>NZ_CP016761.1|WP_066286187.1|439975_440242_+|hypothetical-protein
MEERFDRLAKQLQKVNPGLSYQESREWVEGLWEDFESTRAKAGREYEGQDVTEKMVTQLINSYGHKLHEYFSSNPKFQRFIKKDGPIN
>NZ_CP016761.1|WP_066286185.1|439717_439873_-|small,-acid-soluble-spore-protein-K
MRNKSKNFPNRISFSGEPRAKEEFSSKRPDGSTRDHPQERMFLSNQHRDDQ
>NZ_CP016761.1|WP_077364736.1|439510_439678_-|YpzG-family-protein
MNKKDYFSSTRFNGKYSDPFHSPRANSKHAYNQVNGETQQALNNYVLEIQTRKRS
>NZ_CP016761.1|WP_066286183.1|438970_439276_+|YfhH-family-protein
MEKRFSEMTESEIRAEIASLRAKAQKAEQMGMVSEYAVHERKIAMAKCYLMDPATIESGKEYGIQGDPGSTFSVLYLNGIFAWGYKNKQSNLEALPISVLE
>NZ_CP016761.1|WP_066286178.1|438228_438900_-|SDR-family-NAD(P)-dependent-oxidoreductase
MNKTVIITGGGSGLGLALAKQYSNEFNVCLIGRTESKLQEAVRTLSQNNNRVSYQVCDAANYEQVQTVLHAIFEKESVHLLINNAGTGVFEPLNALTKEDIELMVNTNVYGTIYPSQAVFPFFKKQGFGKVMNIISTAGLRGKVNESVYCATKFAVRGFTESLVKEWEGTGIFPTAVYMGGMDTPFWDETDHIKDRSRLKSPETVAKMIFDQDDNRSEIFIDR
>NZ_CP016761.1|WP_066286209.1|444748_445276_+|DUF402-domain-containing-protein
MSFPATGSIINIQSYKHNGYLHRNWEDTVILKGTPSQVICGNDRILVTESDGRQWRTREPAICYFNSKQWFNVIGMIREDGIYYYCNLGSPFMWDKEALKYIDYDLDIKVFPDGTYILLDEDEYELHRRMMRYPSQLDTIIQKNLQELIMMVTQKKGPFEPGFVEQWYERYLEFR
>NZ_CP016761.1|WP_066286211.1|445339_447082_+|ABC-transporter-ATP-binding-protein
MDSIKRYLAFVKPYKWQIFWTILIGLAKFGIPLMTPLILKYVVDDIIQSTLPFDEKMNKLYWLMGGAAIIFVVLRPPIEYWRQYYAQWVGSKILYDIRDKMFDHIQRLSLRFYSNNKSGEIISRVIHDVEQTKTFVITGLMNVWLDMATIIIAVAIMFSMDFWLTIVALSMLPVYAFSVKFFYARLRQLTKDRSQALAEVQGHLHERVQGMSVIRSFALEDHEQVQFDKRNSKFLNKAMDHTKWNAKTFSVVNTVTDIAPLLVIGFAAYQAISGNITIGALVAFVAYMDRLYNPLRRLVNSSTTLTQSIASMDRMFEFLDESYDIQDSPGAKSLNNVKGALDFENVSFTYNEEEADVLHNVSLSVVPGETIALVGMSGGGKSSLISLIPRFYDVTEGSIKLDGTDIRDFQVRSLRDKIGMVLQDNILFSESVRANILMGNPEASDEEMIAAAKAANAHDFIMNLPQGYDTKIGERGVKLSGGQKQRVAISRVFLKNPPILILDEATSALDLESEHLIQEALEKLAKDRTTFIVAHRLSTITHADRIIVIDHGKIAEIGKHKELMEKQGPYYDLFTVQQLS
>NZ_CP016761.1|WP_066286213.1|447295_448303_+|ABC-transporter-ATP-binding-protein
MGNPVLEVKNLKTSFLTEDGAIPAVDGVDFHINPGEVLGIVGESGCGKSVTSLSVMGLVPTPPGKIEGEILFKGENLASAPEKRMRQIRGNEIGMIFQEPMTSLNPVITIGDQLIESLRIHRKWSKKEAWGKAIEMLKLVGLPRAEELVKEYPHQLSGGMRQRVMIAMAMICDPKLLIADEPTTALDVTIQAQILDLMKRLNKETDTAIMMITHDLGVVAEMCERVVVMYAGKVVEEGDVKTIFQNPQHPYTVGLIKSVPDMREKVGRLYSIPGNVPKPGSIKSGCSFAPRCEHAGTRCITETPHLKTQEGSHQVRCWLYEEKGVNLHESDTAIS
>NZ_CP016761.1|WP_066286214.1|448277_449252_+|dipeptide-ABC-transporter-ATP-binding-protein
MSQTQPLVKVENLKMHFPIKGGVLGKQVGEVKAVDGISFFIKKGETLGLVGESGCGKSTTGRMLLRLLEPTEGKIYFEGEDITKLSTNAMRKKRREMQMVFQDPFASLNPRHTVEKILEEPLIVHGVKDKAERKRRVKELLEVVGLSSWHAKRYPHQFSGGQRQRIGIARALAVNPKLIIADEPVSALDVSIQSQVLNLMQDLQKEFDLTYLFIAHDLGVVRHISDRVGVMYLGHIVELADSEKLYDNPKHPYTQALLSAVPIPDVEHQKDRVILQGDVPSPSNPPAGCPFHTRCPAAMEHCASVKPVLKEVAEGHYAACHLYE
>NZ_CP016761.1|WP_066286215.1|449311_450913_+|ABC-transporter-substrate-binding-protein
MKKSLLTLFALMLALSLALAGCSSGSDSSKGGDDEKVDPNNVMIYGRGGDSVALDPAVVTDGESFIVTEQIYEPLVNYGKDNTDIVAGLAKKWDISEDGLTYTFTLEEGVKFHDGEKFNADAVVKNFERWAKSKDEEKFYYYKSMFGGFEGDEGHVIESVKADGDYKVVFKLKRPQAPFLKNIAMSPFAIASPKSLDGDKLSKEPVGTGPFKFKSWKPNDTIVLEKNADYWVKDLPKLDGVTFKVIKDNSSRLNALTKGEIDLMDGLNPSDMKSVSDNGKLQLFERPSMNVGYLGFNVEKAPFDKKEVRQAISHLIDKQAIIDNFFEGTAEPAKNPMPPSINGYNDSIQDRAYDEAKAKELLAAAGLPDGFKMDLWAMPVARPYMPNGQKVAEAIQANLAKVGIEANIVTFEWGTYLEKTRNGEAPVFMLGWTGDNGDADNFLYTLLDKDNIGSNNYSRYKNDEVHKLLLEAQSNPDEDARADLYKKAQEIIHEDAPWVPLVHSKPQLAGASKIKGFVPHPTGSQSFAETSFE
>NZ_CP016761.1|WP_066286216.1|451014_452019_+|ABC-transporter-permease
MFAYTIRRLATLVPVLLGMTFIVFMMIRAIPGNPAQLILGQQATQDAIEALTKRLGLDQPWYTQFFAYIKGLFAGDLGVSLKTNVPISEEIWPYLAATMELALVAMIIAIVVGVNAGIISAWFQNSWFDYSAMVLALVGVSMPIFWLGLMEQYVFSIQLDWLPTTGRDNIRVPVDPITHLYLIDTLLQGRMDQFVEVIRHLILPGVALATIPMAIIARMTRSSMLEVMRSDYIRTARAKGMKMFWVVYKHSLKNAMIPVVTVIGLQTGLLLGGAILTETIFGWPGIGTYIYDAISFRDYPVIQSGILVVATIFVLINLLVDLLYAAIDPRIKFK
>NZ_CP016761.1|WP_066286218.1|452032_452947_+|ABC-transporter-permease
MSEQLARSTPPVVPQHTPAPVEDKAISPWKDAWRSFKKNKIALVGLSIVSFFILIAIFADLLAPYNYRDVNLSDKHISPSAEHWFGTDEFGRDILSRVIHGARISLWVGFFSVAGSVIVGSLLGIVAGYYGKWVDGIISRIFDILLAFPSILLAIAVVSVLGPSLKNALIAIAIINVPTFGRLLRSRVLSVKEEEYITAARAIGMSDTRILVHHILPNSLAPIIVQGTLAIATAIIEAAALGFLGMGAQPPTPEWGKMLADSKDFIIQAPWTVLFPGLAIMLTVLGFNLMGDGLRDALDPRMKS
>NZ_CP016761.1|WP_172827322.1|452991_453864_-|NERD-domain-containing-protein
MRNHSFGFKGEQSLDYFYRYLPKNDIYFLHGIRILQDDYFFQMDTLLITPNFLTILEIKYLAGHLYFEDRFSQLIRTYENKREAFPNPIEQVKRQSYHLSQILKMYKFDFIPIESLVVMTHPSAIIEASPTYKEAFEKVIKSHGLQQKFHDLSYKHTKSIFNQKQIKKLSKLLTKFSIPYDTDVCELFNINKNELLSGVLCPNCTYSVMKYKWGTWSCLMCQESSKTAHIEALQDYAYLISDKITNRECKQFLHLDSSDQTNHLLRSLNLPISGSTKSRVYHIDKLLQDK
>NZ_CP016761.1|WP_066294531.1|454238_455309_-|aromatic-acid-exporter-family-protein
MKLGARMIKTGLAISLSIYLAMMFQLDQPVYAAIAATFAIQPSIYRSYQTILEQIQGNLVGAIFAIIFVILLGNNPFVIGFVVVLVIAANLKMKIEKTIPLSIVTVIVIMESHTENFIGFAVDRFLLIMLGVLSAFLVNLVFMPPKYETKLYYKISGHTDEIIKWIRMVTRHASEHNAIKEDLTHLKENRFKMDQYYLLYKEERTYFRTNKYSKTRKLVLYRQMIQTTNKALELLKSLHRHENELYNMPEPLQELIQLKLDGLTNFHEQMLLKYTDKIRAQHTLDMDDEISKKSLMKCIMSYYKSPENEEWIQLFPVFALIIDYSDQLEHLNTLVESFKNYHQDDSEVQLDQRFED
>NZ_CP016761.1|WP_066286222.1|455520_456807_-|glutamate-1-semialdehyde-2,1-aminomutase
MNHSRSEALYDEALLHIVGGVNSPSRSFKAVGGGAPVFMERAEGAYFWDEDGNRYIDYLAAYGPIITGHAHPHITKAIVKAAENGVLYGTPTALEVKFAKMLKEAMPAMDKVRFVNSGTEAVMTTIRVARAYTGRDKIIKFAGCYHGHSDLVLVAAGSGPSTLGTPDSAGVPKSIAQEVITVPFNDVDAYRAAMDKWGDQVAAVLVEPIVGNFGIVEPKEGFLQAVNDITHEHGALVIYDEVITAFRFMYGGAQDLLDVKPDMTALGKIIGGGLPIGAYGGKKEIMEKVAPLGPAYQAGTMAGNPASISAGIACLEVLQQEGVYEEMDRLGAILEKGLLEQAAKHNVSVSINRLKGALTLYFTDEKIVNYEQAEATDGEIFGRYFKQMLNEGINLAPSKYEAMFLTTAHTEDDVMATIEAAGKAFSRL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP016761_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016761_2

2645782-2645859

Orphan

Consensus_repeat	Method
CATACCCATTGGCTGCATTCCCAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP016761_2

>merge|NZ_CP016761|2|2645782-2645859|CRISPRCasFinder
CATACCCATTGGCTGCATTCCCATTTGACCCATTTGTGACATATCACCGCCTGGCATACCCATTTGCTGCATTCCCAT

>NZ_CP016761|2|2|2645782-2645859|CRISPRCasFinder
CATACCCATTGGCTGCATTCCCAT	TTGACCCATTTGTGACATATCACCGCCTGG
CATACCCATTTGCTGCATTCCCAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016761.1\|WP_066291343.1\|2655416_2655707_-\|50S-ribosomal-protein-L27	unknown	unknown	gnl\|CDD\|235464
NZ_CP016761.1\|WP_066291340.1\|2654719_2655256_-\|Spo0B-domain-containing-protein	unknown	unknown	gnl\|CDD\|379668
NZ_CP016761.1\|WP_066291345.1\|2655699_2656053_-\|ribosomal-processing-cysteine-protease-Prp	unknown	unknown	gnl\|CDD\|184740
NZ_CP016761.1\|WP_066291316.1\|2641936_2642938_-\|Holliday-junction-branch-migration-DNA-helicase-RuvB	unknown	unknown	gnl\|CDD\|234619
NZ_CP016761.1\|WP_083207807.1\|2648951_2650535_-\|L-aspartate-oxidase	unknown	unknown	gnl\|CDD\|236147
NZ_CP016761.1\|WP_066291320.1\|2643671_2644259_-\|YhcN/YlaJ-family-sporulation-lipoprotein	unknown	unknown	gnl\|CDD\|378211
NZ_CP016761.1\|WP_066291332.1\|2650630_2651782_+\|IscS-subfamily-cysteine-desulfurase	unknown	unknown	gnl\|CDD\|179511
NZ_CP016761.1\|WP_066291330.1\|2648158_2648998_-\|carboxylating-nicotinate-nucleotide-diphosphorylase	unknown	unknown	gnl\|CDD\|181221
NZ_CP016761.1\|WP_066291314.1\|2641748_2641940_-\|DUF2905-domain-containing-protein	unknown	unknown	gnl\|CDD\|378570
NZ_CP016761.1\|WP_066291338.1\|2653414_2654701_-\|GTPase-ObgE	unknown	unknown	gnl\|CDD\|237046
NZ_CP016761.1\|WP_066291306.1\|2637980_2638640_-\|DUF421-domain-containing-protein	unknown	unknown	gnl\|CDD\|225205
NZ_CP016761.1\|WP_066291335.1\|2652358_2652805_-\|ACT-domain-containing-protein	unknown	unknown	gnl\|CDD\|179848
NZ_CP016761.1\|WP_172827404.1\|2651772_2652309_+\|transcription-repressor-NadR	unknown	unknown	gnl\|CDD\|224740
NZ_CP016761.1\|WP_066291318.1\|2642952_2643546_-\|Holliday-junction-branch-migration-protein-RuvA	unknown	unknown	gnl\|CDD\|234645
NZ_CP016761.1\|WP_066291309.1\|2639542_2640685_-\|tRNA-guanosine(34)-transglycosylase-Tgt	unknown	unknown	gnl\|CDD\|234642
NZ_CP016761.1\|WP_066291312.1\|2640701_2641730_-\|tRNA-preQ1(34)-S-adenosylmethionine-ribosyltransferase-isomerase-QueA	unknown	unknown	gnl\|CDD\|234666
NZ_CP016761.1\|WP_066291322.1\|2644331_2645318_-\|phosphotransferase	unknown	unknown	gnl\|CDD\|131952
NZ_CP016761.1\|WP_066291327.1\|2647061_2648162_-\|quinolinate-synthase-NadA	unknown	unknown	gnl\|CDD\|236489
NZ_CP016761.1\|WP_066291308.1\|2639249_2639519_-\|preprotein-translocase-subunit-YajC	unknown	unknown	gnl\|CDD\|235518
NZ_CP016761.1\|WP_066294857.1\|2638830_2639214_+\|TIGR04086-family-membrane-protein	unknown	unknown	gnl\|CDD\|274969

Protein	Function_ID	Function_description	E-value
NZ_CP016761.1\|WP_066291343.1\|2655416_2655707_-\|50S-ribosomal-protein-L27	gnl\|CDD\|235464	PRK05435, rpmA, 50S ribosomal protein L27; Validated.	1.44577e-50
NZ_CP016761.1\|WP_066291340.1\|2654719_2655256_-\|Spo0B-domain-containing-protein	gnl\|CDD\|379668	pfam14689, SPOB_a, Sensor_kinase_SpoOB-type, alpha-helical domain. Sporulation initiation phospho-transferase B or SpoOB is part of a phospho-relay that initiates sporulation in Bacillus subtilis. Spo0B is a two-domain protein consisting of an N-terminal alpha-helical hairpin domain and a C-terminal alpha/beta domain. Two subunits of Spo0B dimerize by a parallel association of helical hairpins to form a novel four-helix bundle from which the active histidine - involved in the auto-phosphorylation - protrudes. In the phospho-relay, the signal-receptor histidine kinases are dephosphorylated by a common response regulator, Spo0F. Spo0B then takes phosphorylated Spo0F as substrate thereby mediating the transfer of a phosphoryl group to Spo0A, the ultimate transcription factor. The exact function of this alpha-helical domain is not known; it does not always occur just as the N-terminal domain of SPOB_ab, pfam14682. SCOP describes this domain as a histidine kinase-like fold lacking the kinase ATP-binding site.	8.45516e-15
NZ_CP016761.1\|WP_066291345.1\|2655699_2656053_-\|ribosomal-processing-cysteine-protease-Prp	gnl\|CDD\|184740	PRK14553, PRK14553, ribosomal-processing cysteine protease Prp.	8.48901e-41
NZ_CP016761.1\|WP_066291316.1\|2641936_2642938_-\|Holliday-junction-branch-migration-DNA-helicase-RuvB	gnl\|CDD\|234619	PRK00080, ruvB, Holliday junction branch migration DNA helicase RuvB.	0
NZ_CP016761.1\|WP_083207807.1\|2648951_2650535_-\|L-aspartate-oxidase	gnl\|CDD\|236147	PRK08071, PRK08071, L-aspartate oxidase; Provisional.	0
NZ_CP016761.1\|WP_066291320.1\|2643671_2644259_-\|YhcN/YlaJ-family-sporulation-lipoprotein	gnl\|CDD\|378211	pfam09580, Spore_YhcN_YlaJ, Sporulation lipoprotein YhcN/YlaJ (Spore_YhcN_YlaJ). This entry contains YhcN and YlaJ, which are predicted lipoproteins that have been detected as spore proteins but not vegetative proteins in Bacillus subtilis. Both appear to be expressed under control of the RNA polymerase sigma-G factor. The YlaJ-like members of this family have a low-complexity, strongly acidic, 40-residue C-terminal domain.	2.64477e-16
NZ_CP016761.1\|WP_066291332.1\|2650630_2651782_+\|IscS-subfamily-cysteine-desulfurase	gnl\|CDD\|179511	PRK02948, PRK02948, IscS subfamily cysteine desulfurase.	1.2767e-144
NZ_CP016761.1\|WP_066291330.1\|2648158_2648998_-\|carboxylating-nicotinate-nucleotide-diphosphorylase	gnl\|CDD\|181221	PRK08072, PRK08072, carboxylating nicotinate-nucleotide diphosphorylase.	2.13323e-153
NZ_CP016761.1\|WP_066291314.1\|2641748_2641940_-\|DUF2905-domain-containing-protein	gnl\|CDD\|378570	pfam11146, DUF2905, Protein of unknown function (DUF2905). This is a family of bacterial proteins conserved of unknown function.	1.26087e-09
NZ_CP016761.1\|WP_066291338.1\|2653414_2654701_-\|GTPase-ObgE	gnl\|CDD\|237046	PRK12297, obgE, GTPase CgtA; Reviewed.	0
NZ_CP016761.1\|WP_066291306.1\|2637980_2638640_-\|DUF421-domain-containing-protein	gnl\|CDD\|225205	COG2323, COG2323, Predicted membrane protein [Function unknown].	4.71736e-68
NZ_CP016761.1\|WP_066291335.1\|2652358_2652805_-\|ACT-domain-containing-protein	gnl\|CDD\|179848	PRK04435, PRK04435, ACT domain-containing protein.	5.83964e-80
NZ_CP016761.1\|WP_172827404.1\|2651772_2652309_+\|transcription-repressor-NadR	gnl\|CDD\|224740	COG1827, COG1827, Predicted small molecule binding protein (contains 3H domain) [General function prediction only].	3.16101e-56
NZ_CP016761.1\|WP_066291318.1\|2642952_2643546_-\|Holliday-junction-branch-migration-protein-RuvA	gnl\|CDD\|234645	PRK00116, ruvA, Holliday junction branch migration protein RuvA.	3.7308e-84
NZ_CP016761.1\|WP_066291309.1\|2639542_2640685_-\|tRNA-guanosine(34)-transglycosylase-Tgt	gnl\|CDD\|234642	PRK00112, tgt, queuine tRNA-ribosyltransferase; Provisional.	0
NZ_CP016761.1\|WP_066291312.1\|2640701_2641730_-\|tRNA-preQ1(34)-S-adenosylmethionine-ribosyltransferase-isomerase-QueA	gnl\|CDD\|234666	PRK00147, queA, S-adenosylmethionine:tRNA ribosyltransferase-isomerase; Provisional.	0
NZ_CP016761.1\|WP_066291322.1\|2644331_2645318_-\|phosphotransferase	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	2.19985e-08
NZ_CP016761.1\|WP_066291327.1\|2647061_2648162_-\|quinolinate-synthase-NadA	gnl\|CDD\|236489	PRK09375, PRK09375, quinolinate synthase NadA.	3.72799e-153
NZ_CP016761.1\|WP_066291308.1\|2639249_2639519_-\|preprotein-translocase-subunit-YajC	gnl\|CDD\|235518	PRK05585, yajC, preprotein translocase subunit YajC; Validated.	4.93779e-35
NZ_CP016761.1\|WP_066294857.1\|2638830_2639214_+\|TIGR04086-family-membrane-protein	gnl\|CDD\|274969	TIGR04086, hypothetical_protein, putative membrane protein, TIGR04086 family. Members of this family of strongly hydrophobic putative transmembrane protein average about 125 amino acids in length and occur mostly, but not exclusively, in the Firmicutes. Members are quite diverse in sequence. The function is unknown.	8.57895e-20

>NZ_CP016761.1|WP_066291322.1|2644331_2645318_-|phosphotransferase
MNRDNRDGFHGDRLFLKKMKEVGFDIVDFGFFRENVIWIKTLEGKYVLKGFRREETCRKQLKISKLYKGQKPRIMGTYTVFPNDKRYIEFGEYVWAIMPFYKGEGLHFGNQKDVIAGMNAISRFHSFSKNLPSDVYNSLSSYSLYKKWSERYEAFKYYAKKARWSKEMQPLIPDILMWGKWCLEHFDHSAVDSLEQKAYKRREITHGDVAPHNFVLNKEKSKEAYLIDFDLFAAVPQAYDWLQYANRILPFWYWSYSKMEEMGNQDYLKWFSKKWFVICLVFPTDLYREWNRALKSGDQDMIEGVEKFTLRDFSHRKKFVDRIIDRIN
>NZ_CP016761.1|WP_066291320.1|2643671_2644259_-|YhcN/YlaJ-family-sporulation-lipoprotein
MKTIAKTLAFTILAGGLVGCNGVNESQDRNDNDVRPIGYYTNEGDNRGDLDRGSGFISDMADRDTKDHTSTYHEDYDGALAERIANKVNDIRGVDDAHVILEDNNVIVGVDTKENKKEELTKKVRETAAKMAPDRDVKVVSDQEIVDRIENVDNDLRDGRAYTEVETDVRGIMGDIVDAGSNLGNAIKRPFENNR
>NZ_CP016761.1|WP_066291318.1|2642952_2643546_-|Holliday-junction-branch-migration-protein-RuvA
MIESITGNVDYITAEYIVINNNGIGYKIICPNPFIYKMNEQKSVYTYHYVREDVLALYGFINRKERDLFLKLLNVSGIGPKGALAIVAFGQPEQVVNAIEHEDEKFLTKFPGVGKKTARQMILDLKGKLSIFADADITEGLFAEVETNGDELDEAIEALTVLGYGRKEIQKVLPELKKEKMSANEYVKAALKKLMNA
>NZ_CP016761.1|WP_066291316.1|2641936_2642938_-|Holliday-junction-branch-migration-DNA-helicase-RuvB
MEERIVSSEERRDEAVMELSLRPEALDEYIGQTSVKDNLKVFIKAARLRNEPLDHVLLYGPPGLGKTTLASIIANEMEVNLRTTSGPAIERPGDLAAILTSLEPGDVLFIDEIHRLSRAIEEILYSAMEDFCLDIVIGKGEVARSVRLDLPPFTLIGATTRAGSLSAPLRDRFGVMARLEYYKPDELSEIVRRTGDVFGIKVDDLSAEEIARRSRGTPRIANRLLRRVRDFVQVEGKDMISLPICQKALELLQVDRLGLDHIDHKLLLGIIHTYKGGPVGLETISATIGEESMTIEDVYEPYLLQIGFLQRTPRGRMVTGQAYQYFGLEASTE
>NZ_CP016761.1|WP_066291314.1|2641748_2641940_-|DUF2905-domain-containing-protein
MNRLFIIAGIVLIIIGLIGTFIGKLPGDLMWKKGNTTVYFPIMTSIIISVVLSLIFMIIGRFK
>NZ_CP016761.1|WP_066291312.1|2640701_2641730_-|tRNA-preQ1(34)-S-adenosylmethionine-ribosyltransferase-isomerase-QueA
MKVNDFDFHLPEELIAQTPLENRTSSRLMVLDKENKSIEHEHFYDLKNHLKKGDCLVLNDTRVLPARLFGQKTDTGAKVEILLLKEEGQDTWETLVKPAKRVKPGTEITFGDGRLKAVCVGESDHGGRHLKFIYSGIFYELLDDLGQMPLPPYIKEQLEEKDRYQTVYAVHQGSAAAPTAGLHFTEELIEEIKASGVHVTFITLHVGLGTFRPVSVDDILEHDMHAEFYQITKGTAELLNHVRETGGRIITVGTTSTRTLETVANKFDGKFEEDAGWTDIFIYPGYEFKAIDGLITNFHLPKSTLIMLVSAFASKEFVMEAYNEAVEEKYRFFSFGDAMLIL
>NZ_CP016761.1|WP_066291309.1|2639542_2640685_-|tRNA-guanosine(34)-transglycosylase-Tgt
MKPAVTYELIKTCKQSGARLGKVHTPHGSFETPIFMPVGTLATVKTMSPEELKELGAEIILSNTYHLWLRPGHDIVKEAGGLHTFMNWDRPILTDSGGFQVFSLSDLREIKEEGVHFRNHLSGEKLFLSPEGAMEIQNALGSDIMMAFDECPPYPAEFEYMKASVERTSRWAERCLKGHARPQDQALFGIVQGGEYEELRKQSARDLVSLDFPGYAVGGLSVGEPKDVMNRVLDFTTPHLPENKPRYLMGVGSPDSLIDGAIRGIDMFDCVLPTRIARNGTCMTSEGRLVVRNAKYARDFRPIDENCDCHVCRTYSRAYIRHLVKANETFGFRLTSYHNLYFLVNLMKQVRQAIMEDRLLDFRNEFFEKYGFNKPNARNF
>NZ_CP016761.1|WP_066291308.1|2639249_2639519_-|preprotein-translocase-subunit-YajC
MDAIKSLLPIIFMFAIFYFLLIRPQQKRQKAVKDMQSNLKKGDKVVTIGGLHGTLESIDDTIAVIRSNDGAKLTFDRNAIREVKEEAAL
>NZ_CP016761.1|WP_066294857.1|2638830_2639214_+|TIGR04086-family-membrane-protein
MKHMFSSMGRGLAAILLMIMVCSLVLSLLLRFTGLTESSLKWVTIGLSFLSLFIGGFISGKKGQSKGWLLGGGTSLLFSFLVFLIQYLGYQSTFNSSQYMYHALFLLLAMIGGIMGVNLSSHKQSYK
>NZ_CP016761.1|WP_066291306.1|2637980_2638640_-|DUF421-domain-containing-protein
MELYTIIFRTLFIYFMIVVVFRMMGKREIGKLSVIDFVVSIMIAELAVISIEDPKIPMINSLISIFVLLGIQLILAIISMKSRKMRELVDGKPSVIIKEGKVDEQEMRKQRYNFDDLLTQLRENNIRSLNEVEFGVLETTGKLSVIKKNEDTERSPLQMILPLVLDGKVLEDNLEKVDKTAFWLRQELKKAGFKDIKGISFCTLNEDGSLYVDEKNEKK
>NZ_CP016761.1|WP_066291327.1|2647061_2648162_-|quinolinate-synthase-NadA
MTILGSFIKTAASIPDHYSSMTPSEMELRIREIKAQLNDKLFLPAHHYQKDEVVQFADVTGDSLQLAKISAENRDADYIVFCGVHFMAETADMLSHPNQTVILPDLKAGCSMADMADIHQTERAWIELTKLFGNTILPLTYVNSTAEIKAFCGKNGGATVTSSNAKSMVKWAFQQKKRLLFLPDQHLGRNTAFDLGINLQDMAVWDPIQNKLIFEGSDLEEIKVILWKGHCSVHEKFTVEQIAEFRQNHSEFQIIVHPECTHEVVRASDYNGSTHYIIETIKNASPGTKWAVGTEMNLVNRLAAQFTDKEIVSLNPNLCPCLTMNRIDLAHLLWSLENIIEGNPQNIISVDEKTKKYAKIALNRMM
>NZ_CP016761.1|WP_066291330.1|2648158_2648998_-|carboxylating-nicotinate-nucleotide-diphosphorylase
MNHLLLKKQLQEFLIEDIGTGDLSAALFEDETEISASIIAKENGIFAGSQVLTFGYELIDSNIKSKLYIKDGEYIERGMILAEIRGRRKSILTGERVLLNLMQRLSGIATVTSQAVSLANGRTRICDTRKTTPGLRMLEKYAVRCGGGYNHRFGLYDTVMLKDNHLAGFTSIQEAIDTAREKLGHTIKIEVETETEKQVLEAVSAGADIIMFDNCTPEEITQRLKHVPQGIVTEASGGITLESIDVYSRTGVQYISLGFLTHSNKALDISLNVKGAVKA
>NZ_CP016761.1|WP_083207807.1|2648951_2650535_-|L-aspartate-oxidase
MDIVEAEVLIIGGGIAGLMTAEYLSLHKNVIVITKSDIKHSNSYLAQGGISAVIDKNDTWQEHYMDTLQAGHFHNEPEMTEFLVKEGSNVIDSLSCWGVPFDRNLSGQFMLGKEGGHHRNRIVHAGGDQTGKKVMEALIRRVSDKVRIETGKYAVELLAANGICYGVYCKDDDGSLTLYKSTHTILAGGGYAGIYSATSNAYGSDGSAICMAYSAGAELADLEFVQFHPTLLKSEKISGLITEAVRGEGGVLVNSNGSPIMDGVHPLKDLAPRDIVSRRIFDEIHNQRVSVFLNIKGISDFENKFPGVTKLCENAGISLDAGLIPVAPGAHFTMGGIKTDLFGRTSLRGLYAIGECANTGVHGANRLASNSLLEGAVFAKQTAQYILSEKHERTFPFSLSLLQESLPAGNCLNYTLLEINDIQEIMDKHAGICRDEEGLKKAKDKLQLRNFNPSLLDQPMALIKRLNMQTMAWLTVTSCLNRKESRGSHYRRDFPFALKEWEQKKIIRSVLRDESLIAKKTAAGIFN
>NZ_CP016761.1|WP_066291332.1|2650630_2651782_+|IscS-subfamily-cysteine-desulfurase
MIYLDYAATTPMSQNAIEAYIHTSRNYFANTESLHDRGLDAKELLEHARTAFAKVVGKNSNGIYFTGGGSDGNFLAVTSLAFGSKQNGRHIITSNVEHPSVDYALKFLETQGFEVTRVPVDSSGKICIERIKGNLRPDTILATIQHVNSETGITQDLKCMSDYFKRNDILFHSDCVQSFSKIDKDYFNSINIDSFTVSAHKIYGPKGTGAVYISPAIHISPLLSGVTHERGFRPGTVDLPSIVSFVTAVEESTNNQSSHYVQVAEMRKLFISLILNNKEIILEGSLEGSPYILPFRVRGMEGQIVMQELSRRKIAVSTGSACKNGLQSPSRTLLALGRTVSEAHGLVRVSLSHLTTTDDIYTLCKALDEITNQFSSVREVALK
>NZ_CP016761.1|WP_172827404.1|2651772_2652309_+|transcription-repressor-NadR
MKMNKAEKLKGDDRRTQLMSWLKESSEPLSGSALAGKTNVSRQVIVQDMSLLKASGEPIMATAQGYIYMKPDKGHSFTCVVAAIHSPEETIEELYTIVDHGVTVEDVTVDHPVYGDIKASLKLSNRNDVEDLMNRLKETKAPLLSELTDGIHMHTLSADSTEKLDKACFALRKKGYLL
>NZ_CP016761.1|WP_066291335.1|2652358_2652805_-|ACT-domain-containing-protein
MKNDKQYYMVREDVLSESMQKALEAKSLLDRGKVKTVAEAAEKVGLSRSAFYKYRDGIFPFHTMVKEKIITLSLHLEDRSGALSSLLTVVASQGCNVLTINQTIPLQGRAHITLTIETNMLQGDIKDLLATLNRMETVERVEVVGTGA
>NZ_CP016761.1|WP_066291338.1|2653414_2654701_-|GTPase-ObgE
MFVDQVKIYLKAGDGGNGMVAFRREKYVPDGGPAGGDGGKGANVIFEVEEGLRTLMDFRYNRHFKAPRGEHGMSKGMHGKKANDMIVKVPPGTVVTDANTGETIADLVHHKQQAIIAKGGRGGRGNTRFATPANPAPEIAENGEPGEEREVTLELKVLADVGLVGFPSVGKSTFLSIVSAAKPKIAAYHFTTITPNLGVVPVEDGRSFVMADLPGLIEGAHEGVGLGHQFLRHIERTRVILHVIDMSGMEGRDPYEDFVKINEELNQYNMRLMERPQIVIANKMDIPGAEENLEAFKEKAGDDVKVFPISAITRQGIREVLFTTADILEVTPEFPLIHDDGVEQQRVLYKHEKEDAGFYITRDPAGIFVINGPKIEKLFKMTDFSREEATKRFARQMRTLGVDQALRDRGAEHGDVVRILKYEFEFID
>NZ_CP016761.1|WP_066291340.1|2654719_2655256_-|Spo0B-domain-containing-protein
MSKKWTTVDLLRHARHDWLNQLQLIKANLSLDRTERAKEIMNEVIELSREESRISNLKTPNLSEYLLTYNWLKHPVKLYGKVKGESGDFSLFEDELLHTTDELCDVLNNSISGYEEYSLTVTFEPEDHRVSYTFVGNLSDQENTLEKMKNIFSTHKSMALIESYIQENKCYFEFQLTS
>NZ_CP016761.1|WP_066291343.1|2655416_2655707_-|50S-ribosomal-protein-L27
MLKLNLQYFASKKGVGSTKNGRDSQSKRLGAKRADGQFVSGGSILYRQRGTKIYPGTNVGKGGDDTLFAKVDGIVRFERYGRDRKKVSVYPIAQEA
>NZ_CP016761.1|WP_066291345.1|2655699_2656053_-|ribosomal-processing-cysteine-protease-Prp
MISVSIFRNSNQNILSFSMDGHADFAPHGQDLVCAAATAVSFGTINAIEKLCGYEPEVTTHEDGGFLKCKVPNNLDDSTYQKTQLLLEGMIVSLASIEEGYSEYIKLTEHEGGATNA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

220341 : 228855

Synechococcus_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066285739.1\|220341_221634_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	2.2e-18	32.2
WP_066285741.1\|221959_222682_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3FUQ7	Synechococcus_phage	5.0e-44	41.9
WP_066285742.1\|222669_222924_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_066285745.1\|222920_223604_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_066285747.1\|223587_225819_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.0e-164	40.9
WP_066294490.1\|225794_227213_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.3e-48	32.4
WP_066285749.1\|227227_228268_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3FC27	Synechococcus_phage	5.2e-66	41.4
WP_066285755.1\|228264_228855_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	3.1e-31	38.9

DBSCAN-SWA_2

2881633 : 2940794

Staphylococcus_phage(44.44%)

integrase,holin,tRNA,coat

attL 2874132:2874148|attR 2941609:2941625

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2874132:2874148	attL	NA	NA	NA	NA
WP_066291843.1\|2881633_2884054_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	74.5
WP_066291847.1\|2884692_2885892_-	MFS transporter	A0A2H4PQR6	Staphylococcus_phage	3.6e-95	45.6
WP_083207958.1\|2886004_2887021_+	TIGR01212 family radical SAM protein	A0A2H4PQV5	Staphylococcus_phage	1.9e-52	68.8
WP_066291855.1\|2887017_2887593_+	methyltransferase domain-containing protein	A0A2H4PQV0	Staphylococcus_phage	8.1e-45	48.7
WP_066291857.1\|2887909_2888980_-	tetraprenyl-beta-curcumene synthase family protein	NA	NA	NA	NA
WP_066291859.1\|2889008_2889809_-	alpha/beta hydrolase	O11456	Ectromelia_virus	3.6e-11	26.1
WP_066291862.1\|2890130_2890649_+	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_066291865.1\|2890638_2891010_-	VOC family protein	NA	NA	NA	NA
WP_066291868.1\|2891150_2891372_+\|coat	spore coat associated protein CotJA	NA	NA	NA	NA
WP_066291870.1\|2891377_2891641_+\|coat	spore coat protein CotJB	NA	NA	NA	NA
WP_066291873.1\|2891665_2892235_+	manganese catalase family protein	NA	NA	NA	NA
WP_066291876.1\|2892356_2892893_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_066291879.1\|2892981_2893284_+	hypothetical protein	NA	NA	NA	NA
WP_066291881.1\|2893565_2894771_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	4.2e-160	74.5
WP_066294891.1\|2895323_2896907_+	phosphoenolpyruvate carboxykinase (ATP)	A0A2H4PQN1	Staphylococcus_phage	1.7e-185	59.4
WP_066291883.1\|2897040_2898327_+	MFS transporter	NA	NA	NA	NA
WP_066291884.1\|2898280_2898895_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_066291886.1\|2898907_2899705_-	S9 family peptidase	A0A2H4PQM6	Staphylococcus_phage	2.9e-32	38.0
WP_066291887.1\|2899811_2900816_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_066291890.1\|2900834_2901626_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.1e-39	41.7
WP_083207959.1\|2901702_2902398_+	ABC transporter permease	NA	NA	NA	NA
WP_156774353.1\|2902405_2902879_-	nucleoside triphosphatase YtkD	A0A2H4PQM4	Staphylococcus_phage	9.6e-20	40.0
WP_066291895.1\|2903006_2903549_-	hypothetical protein	NA	NA	NA	NA
WP_066291899.1\|2903808_2904072_-\|holin	holin	A0A0U4JE55	Bacillus_phage	3.0e-15	46.8
WP_066291901.1\|2904292_2904505_+	hypothetical protein	NA	NA	NA	NA
WP_066291904.1\|2904858_2905047_-	antirepressor AbbA	NA	NA	NA	NA
WP_066291911.1\|2905137_2905323_-	hypothetical protein	NA	NA	NA	NA
WP_066291913.1\|2905574_2905763_-	Fur-regulated basic protein FbpA	NA	NA	NA	NA
WP_156774282.1\|2905872_2906037_-	hypothetical protein	NA	NA	NA	NA
WP_066291915.1\|2906200_2906776_+	DNA-3-methyladenine glycosylase	NA	NA	NA	NA
WP_066291918.1\|2906772_2907456_-	hypothetical protein	NA	NA	NA	NA
WP_066291920.1\|2907605_2908841_-	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_066291922.1\|2909346_2909541_+	hypothetical protein	NA	NA	NA	NA
WP_066291928.1\|2909576_2910302_-	hypothetical protein	NA	NA	NA	NA
WP_156774283.1\|2910376_2910535_-	hypothetical protein	NA	NA	NA	NA
WP_066291931.1\|2910661_2911363_+	TrkA C-terminal domain-containing protein	NA	NA	NA	NA
WP_066291933.1\|2911395_2914047_-	EAL domain-containing protein	NA	NA	NA	NA
WP_156774284.1\|2914250_2914478_-	hypothetical protein	NA	NA	NA	NA
WP_066291937.1\|2914697_2915342_-	exonuclease domain-containing protein	G3MBN3	Bacillus_virus	3.7e-14	32.4
WP_066291940.1\|2915864_2916527_+	hypothetical protein	NA	NA	NA	NA
WP_083207823.1\|2916652_2916829_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_066291942.1\|2916872_2918276_-	PTS transporter subunit EIIC	A0A2I7SAJ6	Vibrio_phage	1.7e-08	43.2
WP_066291944.1\|2918297_2919197_-	N-acetylmuramic acid 6-phosphate etherase	NA	NA	NA	NA
WP_066291947.1\|2919246_2920293_-	DUF871 domain-containing protein	NA	NA	NA	NA
WP_066291949.1\|2920310_2921687_-	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_066291952.1\|2921738_2922458_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_066291961.1\|2922467_2923187_-	glucosamine-6-phosphate deaminase	NA	NA	NA	NA
WP_066291964.1\|2923183_2924371_-	N-acetylglucosamine-6-phosphate deacetylase	NA	NA	NA	NA
WP_066291966.1\|2924490_2925753_-	DUF1343 domain-containing protein	NA	NA	NA	NA
WP_066294895.1\|2925771_2927832_-	beta-N-acetylhexosaminidase	NA	NA	NA	NA
WP_066291967.1\|2928575_2932229_-	Eco57I restriction-modification methylase domain-containing protein	A0A1B1IUC6	uncultured_Mediterranean_phage	7.5e-11	24.3
WP_066291968.1\|2932639_2935204_-	DEAD/DEAH box helicase family protein	NA	NA	NA	NA
WP_066291979.1\|2935343_2937077_+	AAA family ATPase	E5E3R2	Burkholderia_phage	1.9e-12	27.0
WP_083207960.1\|2937353_2938445_-\|integrase	site-specific integrase	A0A2H4JCB7	uncultured_Caudovirales_phage	2.1e-62	37.9
WP_066291982.1\|2938730_2939699_-\|integrase	site-specific integrase	A0A2R2ZHE2	Clostridioides_phage	1.6e-08	28.2
WP_066291985.1\|2939717_2940794_-\|integrase	tyrosine-type recombinase/integrase	A0A142F1N9	Bacillus_phage	1.6e-14	22.7
2941609:2941625	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP016761

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection