CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP015079	Nocardioides dokdonensis FR1436 chromosome, complete genome	9 crisprs	DinG,cas3,WYL,DEDDh,cas4,csa3	3	6	0	0

Cas Category Instructions

Results visualization

1. NZ_CP015079

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP015079_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015079_1

976721-976806

Orphan

Consensus_repeat	Method
TTCCCCGGGTACCCGGGGAAACCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015079_1

>merge|NZ_CP015079|1|976721-976806|CRISPRCasFinder
TTCCCCGGGTACCCGGGGAAACCGAAGGCGTTGGGGTGTTGCAACACCCCAACGCGTACAGATTCCCCGGGTACCCGGGGAAACCG

>NZ_CP015079|1|1|976721-976806|CRISPRCasFinder
TTCCCCGGGTACCCGGGGAAACCG	AAGGCGTTGGGGTGTTGCAACACCCCAACGCGTACAGA
TTCCCCGGGTACCCGGGGAAACCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015079.1\|WP_169834659.1\|965415_968088_-\|ATP-dependent-chaperone-ClpB	unknown	unknown	gnl\|CDD\|274529
NZ_CP015079.1\|WP_068106965.1\|979458_980652_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015079.1\|WP_084527149.1\|975353_975851_-\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|240040
NZ_CP015079.1\|WP_068106944.1\|970237_971440_-\|DnaJ-domain-containing-protein	unknown	unknown	gnl\|CDD\|237665
NZ_CP015079.1\|WP_068114377.1\|980690_981503_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|181159
NZ_CP015079.1\|WP_068106948.1\|972224_974090_-\|molecular-chaperone-DnaK	unknown	unknown	gnl\|CDD\|234715
NZ_CP015079.1\|WP_068106940.1\|968238_969753_+\|response-regulator	unknown	unknown	gnl\|CDD\|223715
NZ_CP015079.1\|WP_068106952.1\|974792_975338_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015079.1\|WP_068106969.1\|985807_986782_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|366166
NZ_CP015079.1\|WP_068106963.1\|978110_978536_-\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|379275
NZ_CP015079.1\|WP_084528005.1\|971550_972159_-\|nucleotide-exchange-factor-GrpE	unknown	unknown	gnl\|CDD\|184546
NZ_CP015079.1\|WP_068114375.1\|978583_979462_+\|TIGR03619-family-F420-dependent-LLM-class-oxidoreductase	unknown	unknown	gnl\|CDD\|274680
NZ_CP015079.1\|WP_068106959.1\|976821_977433_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015079.1\|WP_068106967.1\|982873_984172_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340863
NZ_CP015079.1\|WP_068106942.1\|969797_970238_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133394
NZ_CP015079.1\|WP_068106956.1\|975861_976707_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381357
NZ_CP015079.1\|WP_068106950.1\|974251_974770_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|226489
NZ_CP015079.1\|WP_068114381.1\|984340_985693_-\|cytochrome-P450	unknown	unknown	gnl\|CDD\|225035
NZ_CP015079.1\|WP_068114379.1\|981526_982669_+\|sulfotransferase	unknown	unknown	gnl\|CDD\|379204
NZ_CP015079.1\|WP_068106961.1\|977480_978017_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP015079.1\|WP_169834659.1\|965415_968088_-\|ATP-dependent-chaperone-ClpB	gnl\|CDD\|274529	TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB. Members of this protein family are the bacterial ATP-dependent chaperone ClpB. This protein belongs to the AAA family, ATPases associated with various cellular activities (pfam00004). This molecular chaperone does not act as a protease, but rather serves to disaggregate misfolded and aggregated proteins. [Protein fate, Protein folding and stabilization].	0
NZ_CP015079.1\|WP_084527149.1\|975353_975851_-\|NUDIX-domain-containing-protein	gnl\|CDD\|240040	cd04684, Nudix_Hydrolase_25, Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function. In general, members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity. They also contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which forms a structural motif that functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	2.57889e-26
NZ_CP015079.1\|WP_068114379.1\|981526_982669_+\|sulfotransferase	gnl\|CDD\|379204	pfam13469, Sulfotransfer_3, Sulfotransferase family.	3.02218e-59
NZ_CP015079.1\|WP_068114377.1\|980690_981503_+\|SDR-family-oxidoreductase	gnl\|CDD\|181159	PRK07890, PRK07890, short chain dehydrogenase; Provisional.	4.13984e-121
NZ_CP015079.1\|WP_068106948.1\|972224_974090_-\|molecular-chaperone-DnaK	gnl\|CDD\|234715	PRK00290, dnaK, molecular chaperone DnaK; Provisional.	0
NZ_CP015079.1\|WP_068106940.1\|968238_969753_+\|response-regulator	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	8.24015e-36
NZ_CP015079.1\|WP_068106944.1\|970237_971440_-\|DnaJ-domain-containing-protein	gnl\|CDD\|237665	PRK14295, PRK14295, molecular chaperone DnaJ.	3.02342e-151
NZ_CP015079.1\|WP_068106969.1\|985807_986782_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|366166	pfam00561, Abhydrolase_1, alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.	4.3511e-10
NZ_CP015079.1\|WP_068106963.1\|978110_978536_-\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|379275	pfam13577, SnoaL_4, SnoaL-like domain. This family contains a large number of proteins that share the SnoaL fold.	1.22555e-26
NZ_CP015079.1\|WP_084528005.1\|971550_972159_-\|nucleotide-exchange-factor-GrpE	gnl\|CDD\|184546	PRK14163, PRK14163, heat shock protein GrpE; Provisional.	5.25394e-36
NZ_CP015079.1\|WP_068114375.1\|978583_979462_+\|TIGR03619-family-F420-dependent-LLM-class-oxidoreductase	gnl\|CDD\|274680	TIGR03619, F420_Rv2161c, probable F420-dependent oxidoreductase, Rv2161c family. Coenzyme F420 has a limited phylogenetic distribution, including methanogenic archaea, Mycobacterium tuberculosis and related species, Colwellia psychrerythraea 34H, Rhodopseudomonas palustris HaA2, and others. Partial phylogenetic profiling identifies protein subfamilies, within the larger family called luciferase-like monooxygenanases (pfam00296), that appear only in F420-positive genomes and are likely to be F420-dependent. This model describes a domain found in a distinctive subset of bacterial luciferase homologs, found only in F420-biosynthesizing members of the Actinobacteria. [Unknown function, Enzymes of unknown specificity].	3.41763e-60
NZ_CP015079.1\|WP_068106942.1\|969797_970238_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133394	cd04766, HTH_HspR, Helix-Turn-Helix DNA binding domain of the HspR transcription regulator. Helix-turn-helix (HTH) transcription regulator HspR, N-terminal domain. Heat shock protein regulators (HspR) have been shown to regulate expression of specific regulons in response to high temperature or high osmolarity in Streptomyces and Helicobacter, respectively. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	4.83679e-34
NZ_CP015079.1\|WP_068106956.1\|975861_976707_+\|aldo/keto-reductase	gnl\|CDD\|381357	cd19131, AKR_AKR5C2, Escherichia coli 2,5-diketo-D-gluconic acid reductase A (DkgA/YqhE) and similar proteins. Escherichia coli DkgA/YqhE is a founding member of aldo-keto reductase family 5 member C2 (AKR5C2). DkgA/YqhE (EC 1.1.1.274), also called 2,5-DKG reductase A, or 2,5-DKGR A, or 25DKGR-A, or AKR5C, catalyzes the reduction of 2,5-diketo-D-gluconic acid (25DKG) to 2-keto-L-gulonic acid (2KLG). It is also capable of stereoselective -keto ester reductions on ethyl acetoacetate and other 2-substituted derivatives.	9.32268e-131
NZ_CP015079.1\|WP_068106950.1\|974251_974770_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|226489	COG3981, COG3981, Predicted acetyltransferase [General function prediction only].	6.97153e-44
NZ_CP015079.1\|WP_068114381.1\|984340_985693_-\|cytochrome-P450	gnl\|CDD\|225035	COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism].	2.98562e-84
NZ_CP015079.1\|WP_068106967.1\|982873_984172_-\|MFS-transporter	gnl\|CDD\|340863	cd06173, MFS_MefA_like, Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.70918e-58

>NZ_CP015079.1|WP_068106956.1|975861_976707_+|aldo/keto-reductase
MSVPTITLNNQTQIPQLGFGVFQVPPEQTADTVTKALEVGYRHIDTAQMYGNEQEVGVALANADIARDDLYVTSKLNNGFHRPDDARRAFDDTMAKLGLDQIDLFLIHWPLPTLYDGDFVSTWQTLAEFVADGRARSIGVSNFQPAHLERLVQETGIVPAVNQIEVHPYFTNEDARAASIRHGIEVEAWSPIAQGAVLSDPTIGEIATAHGKSVSQVTLRWHIERGDIVFPKSMHEERMRENFDIFDFSLSVDEVATIAGLDRGAEGRRGPDPDTFDYVPG
>NZ_CP015079.1|WP_084527149.1|975353_975851_-|NUDIX-domain-containing-protein
MPITTQVIPRSRPRWGEDAHVHYTEYDTRLAAYAVITDAQGRVLLALWNEGSRRQWTMPGGGVEIEESVEQAVVREVREETGYDVRLGALLGVDTYVLPPHRRLNDSGRSLKAVRTIFRAEVTGGELTAEQDGSTDEARWFTLDEVRALERVSVVDISLRLAGLL
>NZ_CP015079.1|WP_068106952.1|974792_975338_-|hypothetical-protein
MAEGEQVGIPRLVSQRPTVWLSMAVTVLGVIAVVGWGVATQTGTNRVMAVLLAVVLPLAVTAVVWRRTWVDTGDGTLHHRIALLPTRSVSWARAAALDLERNRAGQLALRASGEGGTVRVTVLAIDMGGDRSADADLLRFLAGEIDRWAPERERLTARLRAQAAYVETGADLRRSPLAAHV
>NZ_CP015079.1|WP_068106950.1|974251_974770_+|GNAT-family-N-acetyltransferase
MSRLVLRPLRLDDEAVARLAHEELAGVFGFLIFAREGEPWAAYLDRIEGHRRGVGLDEGMVASTFLVAEVDGEVVGRASVRHELNAFLATWGGHIGYGVRPAYRRRGHATAMLRGCLEVCRDLGIEQALVTCDVDNVASAGVIEACGGVFEDVAPAGESVAAKKRYWVPTGL
>NZ_CP015079.1|WP_068106948.1|972224_974090_-|molecular-chaperone-DnaK
MARAVGIDLGTTNSVVSVLEGGEPTVIANAEGARTTPSVVAFAKNGEVLVGEVAKRQAVTNIDRTIRSVKRHMGTDWKQKIDDKDFTPQQISAFVLQKLKRDAEAYLGEPVTDAVITVPAYFSDAQRQATKEAGEIAGLNVSRIVNEPTAAALAYGLDKGDDQTILVFDLGGGTFDVSLLEIGEGVVEVKATSGDNHLGGDDWDARVVEWMVKKFKDNNGVDLAADKIAKQRLQEAAEKAKIELSSSSETTVHLPYITHGESGPLHFEERLTRSEFQKMTADLLDRTKTPFKAVLKDGGVAIDKIDHVVLVGGSTRMPAVTEVVKDLLGGKEPNKGVNPDEVVAVGAALQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTNLIERNTTIPTKRSEIFTTADDNQPSVEIKVAQGERQMWAQNQPLGNFELTGLPPAPRGVPKIEVTFDIDANGIVHVSAKDQGSGKEQSMTISGGSALGKDEIDRMVREAEEYAEEDAKRREAIETRNQADQLVYTTEKFLADNDEKLPEDVKTEVQADLDALKATLEKDDADADEINAGVTKLNESSQKMGAAMYAAAEAEQAAAGGTTGATGEGDDDIVDAEVVDEDGTDGAAEGEAK
>NZ_CP015079.1|WP_084528005.1|971550_972159_-|nucleotide-exchange-factor-GrpE
MTEDTEVEEGASGGEPSVGTDPEAPRSEVDAADDELTLARIALEERTLDLQRLQAEFVNYKRRVERDRELIKENATYAALAPITEVLDTIDRARDSADKTGAALDGGFKAVAEQLEHTVGKAGLIRYGAPGDAFDPRFHEALSHIGEDPEVSVTTCKVIAKAGYRIGDRVVRAAQVLVVDPADGPASADGGEPTGDADEDVS
>NZ_CP015079.1|WP_068106944.1|970237_971440_-|DnaJ-domain-containing-protein
MSDNDGFRADWAQKDFYAVLGVKKDASAEEIKKAYRRLARANHPDSNPGDTAKHDTFKKVAEAYDVIGDKPKRAKYDEMRRLYASGGAGGGFGGGFGGGQHGGQQGINLEDLLRDSGGAGGGVGDMFGDLFGGGAGGGRRRTTRPRPTQGNDVETSATISFTDAMDGVTISLRLSSESACETCAGSGGKPGTKPHICTTCEGAGFVVASMGGSFSVNETCPACGGRQLVYDEPCPTCRGTGRGSSARTIQARIPAGVKDGQRIRVRGKGAPGENGGPAGDLFVSVRVSPHRVFGRKDDNLTIDVPVSFDELALGAEVRIPTLGGSPVTLRLPAGTPNGRTFRVRGKGARKADGSHGDLLATVEVQVPAVLDAETRAAVEAYRAATAAKPLRANLFEQAGA
>NZ_CP015079.1|WP_068106942.1|969797_970238_-|MerR-family-transcriptional-regulator
MVGRSGNPFGDAHPDAAVFVISVAAELTGLHPQTLRTWERLGLITPGRTGGGGRRYSTRDIEKLREIAALSGAGIGIEGVRRILDLENQVLALSVRNEELVAELEATRAALRQAVAVRRGELAPNKLPVLRAPDASGSLVVWRRGR
>NZ_CP015079.1|WP_068106940.1|968238_969753_+|response-regulator
MTTWAGAPGASTTASTTASTTASTTTRTGARAAPRVVIVDDTDDLRELLRMVLTRGGYDVVGEAGHGRQGIEVVRETRPDLVLLDLSMPGMDGLEALPSIRRSVPDATVVVLSSFGAPQMSERALAIGAHGYVQKGASLESILTYVDTLTSRGPGPRARTAPPAPPSPGAATTISWWQALSAAPMGIVELADEPLFRIVFANPAAQRLLGGTSRTGTPLGFASAPLASLVAYHRLDDDATFEVELDGASVRATMRRTGSSLLVFLDSARDDVGMLRRAIATTAQEVRGPVAVICGIAEAHEWDDDDLGPEARSRLMTSVARQARVLDTMTADLVTAAQVQAGTLRAELRPVRVDALVASVVDDRHRGDADPPVEVRVDDGRAVRADPSRLRQMVGNLLTNALRYGRAPFLVHVRGDGDRVCIDVVDHGPGVDEAVRSHLFGEFTRAAGAVTTGTGLGLYVVRALAEAQDGSVSYEPGRYGGSVFTISLAAVPAPPPRDPAQMSH
>NZ_CP015079.1|WP_169834659.1|965415_968088_-|ATP-dependent-chaperone-ClpB
MRATISGSVPVPSHFFPSSTAAQRRPIVSQFGAEKFTTRSREAIETAQRLATTSGHSHTEPVHLLVALLGQEDGIARSLVTKAGIDVQQLVAGAGAALEALPRASGATVQQPAASSALTRLLAAALDLATSMKDEYVATEHLLIAMAGTASSAQNVLADAGLTEAGLREGLTAVRGNRRVTSQDAESTYESLEKYSLDLTAAAEEGRLDPVIGRDAEIRRVVQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQRVVAGDVPDSLKGRRVLSLDLAAMVAGAKYRGEFEERLKAVLEEIKDAGGQVITFIDELHTVVGAGAGGDSAMDAGNMLKPMLARGELHMIGATTLDEYRERIEKDPALERRFQQVFVGEPSVEDTIQILRGIQEKYEAHHGVRITDAALVAAATLSDRYISGRQLPDKAIDLIDEASSRLRMEIESSPEEIDQLRRHVDRLKMEEFALAKESDAASVERLAALRGELADSEEGLRGLEARWEAEKTSLEGEGELRRQLDTLRSEAERLQRDGDLGRASEILYGRIPDLEKQIEAAAAAESSQVGVEPLVGEEVGPEQIADVVEAWTGIPTGRMLQGETAKLLEMEQVIGQRLIGQHEAVGAVADAVRRSRAGIADPNRPTGSFLFLGPTGTGKTELARSLADFLFDDERAMVRIDMSEYSEKHSVSRLVGAPPGYVGYDEGGQLTEAVRRRPYSVVLLDEVEKAHPEVFDILLQVLDDGRLTDGQGRTVDFRNTLLVLTSNLGSQYLVDPDLDAETKRASVLAVVRSSFKPEFLNRLDEIVQFEALSRDALTHIVDLQLALLEKRLAGRRITIEVSEAARAWLADTGYDPAYGARPLRRLIQTAIGDPLARLLIGGEVTDGETVRVDLGDDGLVLTA
>NZ_CP015079.1|WP_068106959.1|976821_977433_-|hypothetical-protein
MRPTLLVIPLLLAAVSGCGGTNGGAGGDAGGDAGAGETPTAQGATPTGAPAPGAAFQARPVLAVQGERPDGVEAALVRRLERLDCLRRAPTTNGPAAEPMLACDLLGAGFLLGPTEVDGGVAGVEVVELQRGYAVQVGLDPAATDAMAGLTSGLVGSEGRFAVVVDGALVALPRVADGIGSTLQIGEAWTRAEAEDVAARLTS
>NZ_CP015079.1|WP_068106961.1|977480_978017_-|hypothetical-protein
MLTGLLALVGVGLAVGLVLGGGALAVTRVLGVDGGSATTATTDVASLYLPKPQKTDAPSGPLLTLSADPKKGSAPSEKPKKPKKTKKAEGEISLSAGQTQVAPMGQIDLTGVYPGGEGRVLQVEKFVGGNWQDFPVTAVVSNETFTTFVQTSSQGVNRFRVVDNDSGTSSNDVRVTVG
>NZ_CP015079.1|WP_068106963.1|978110_978536_-|nuclear-transport-factor-2-family-protein
MDLQQISDRLEIADVLVRYTRAIDTDDWDRLDTVFTPDAVIDYTESGGISGDVATVKPWLAEVLPAFFPKRMHTLGQLETVVDGDTATCSAYFHNPMPMDDGAGGEKIVEFGGIYHHELVRTAQGWRSRRLHEQIVWKRGV
>NZ_CP015079.1|WP_068114375.1|978583_979462_+|TIGR03619-family-F420-dependent-LLM-class-oxidoreductase
MRFTYAEAMTRTELYAPLAQAAEAAGYTSMTVADSLIYPEVSDSTYPYTDTGGREFLLGKDFVETMVMCAHLFAHTTTLRLTPFVLKLPVRPPVLVAKQASSLAALSGDRLSLGVGLSPWPEDFTAMGVPWARRGKRMDECLDIVRGLTSGEFFSYEGEFFTIESMQQRPAPGRPIPLLVGGHADAALRRAVRKGNGWMHAGGDGEELDRLLTRLAEIRTEEGDTRDDFEVHVISYDAYDLDGIKRLEDKGVTDCIVGFRVPYIEGPDTETLETKVAHLESYAEKIISKVGA
>NZ_CP015079.1|WP_068106965.1|979458_980652_+|hypothetical-protein
MNAPAQEPTEDPGWDLTAPLREAIAEAERLVATAPFIRTEQDRLEGYDYLAGRIRMAMQMAFDHDLDRPLFINATHQFSRQGLDNPDAVYFSAYLREGVEYVVRGRRGTSADLSFQVMGGAYTADSTATSLLAFDDRELDIAEDGSFELHYTAEPGAKTFIVREVFNDWDTEERGTITIERTDTLGKPARELTRELLARKYDIAARTLTGSIQTWFAFPHFFQYAEPVNTLTAPQQTPGGLASQRSSIGHYELAEGEAMLITVPRCDDCSYQAVQIGSDWYASTDYETHQTSLTKAQAVTDPDGLMRFVVSEHPPSGRDDAPYLANWLETTGHRTGSVMLRWQRLERDLGPEDGPTVQVVKLEDVPGLLPHLAPLTQEQYAERITARQRSVARRMIS
>NZ_CP015079.1|WP_068114377.1|980690_981503_+|SDR-family-oxidoreductase
MDAAYTPAPLLAGKVVVLSGVGPGLGRALGEEAARMGADLVLVSRTEKRLEKMAEVVRSHGRRALVVPTDVTDEAAQQRLVERALEEFGRVDCLINNAFAIPPMDPISTIGLEALRAANETNVFAPLRLSAAFADALAAAPGRPGGSIIMLNSCVQYSSQPEFAGYKLSKGALAHLASSLATELGPRGIRVNSVAPSYIYEDVNKAYFDWIASESGRTHGEVYAEKAAPTDLQRLASPVEIARATLFLATDLASAVSGQTLNVDCGEFHS
>NZ_CP015079.1|WP_068114379.1|981526_982669_+|sulfotransferase
MTRERADVGSYEDIVAAAERTTGMSDFGGDAHEEGLRVLVEDLNSPEAGLTGRGNYFQRSEVKSALVGRLLTQAQFNAQPQHADVPVERPIFVMGLPRTGTTALHRLLVSDPGHQGLEMWLTQFPQPRPPRGTWEADPIFAAMQEAFSAHHVEDPEYMGIHYMDATSVEECWRLLRQTGKSNSYESLANLPRYTDWLRGQDWTDAYARHRQNLQLIGMNDPEKRWVLKNPSHMTALDALMRVYPDALVVYTHRDPVSCIASSCSLSAATTAGHSDTYVGGVIGHTQLDLWSRAYHSFHDARPRYDQAQFVDVDFADLQGDPIGTVRGVYDAFGLSLSAEAEAVVREIDAEARSGHARPSHQYSLKDYGLSETQVRDAFAR
>NZ_CP015079.1|WP_068106967.1|982873_984172_-|MFS-transporter
MTWAERLRGLRIDLAPLQTSRDFRLLFVAGTVFYFGAMVTYVAIPFQVYRVTGSNFAVGAVGLVELVPLVVFALYGGALADHVDRKRLLVGTGVAQAVATAVLAANAFGAFGPDPHLWLVFVLAAVLASSSSMQRPSREALMPRTVRHDEIPAAQALTSLGMEIGVLVGPALGGLLIAFVGLGWCFVVDVVGLAVATLMYLAMTSYPHREETTAPSLAGIAQGMRYAMGRRDLLGTYLVDIAAMLLAMPVVLFPALAETVFEAPELLGLLYSAETVGALVATALSGWTGRVHHHGRAIVLAAAAYGVCIALAGLMPSFWLVAAFFALSGAADMVSGVFRGIVWSQTIPEGMRGRLAGIEMLSYSLGPLGGQVRAGITADLWSVRGSITSGGVACVVGVGATALWLRDFWSYDARTDEHAVAERAVRAARGEG
>NZ_CP015079.1|WP_068114381.1|984340_985693_-|cytochrome-P450
MSGASVGSADLPPVDLDGLPPGPRWPVLVQSAALMRFRHWFHPYLHRTYGDVFTVRLVPGGRPLVFFTRPEHTKEIFAADPAVFHAGKGNAILGPVMGEHSLLLQDGAEHQRARKLLMPAFNGAALREYRSLVTDLAADEAAHWPDGVTLRALDRMNVLTLEVILRVVFGVTDERRLAAMRPRVNATVDISPAVLLGWGYPALQRFGPWRRTVQNQAELDRLIYAEIRERRAAPDLAERSDVLSRLIRHGAGSTDESDRLTDTELRDQLVTLLLAGHETTATSLSWALYELGRDPALLRRSQEAADGTTPEDDAWLEAVMKESMRLHPVIPMVVRTLVRPATIGGLDLPRGTTVGPSIIVAHQRSEHHPDPDAFRPERFLGQHPPTNTWIPFGGGVRRCIGAGFAQMEGVAVLREVLRVHDVTTPVADGPKVRNITSVPRDGARIHVARR
>NZ_CP015079.1|WP_068106969.1|985807_986782_-|alpha/beta-fold-hydrolase
MTDTTTVTTASAAPDTTASPGHREVRFASGGEECVATHVPAAHDGLAGAAGRPVVVMAHGLAGTVDSGLLPFADGLAAAGLDVLAFDYRGFGLSGGRTRQRVSVADQLEDYRAAAQAAAGLPGVDGRRLVLWGVSLAGGHVLAVAAGRDDVAAVVSLTPLVDGAAAGRLALRHHSALTLGRSTVDGVRSRLLASRRGPVMVPVVAEPGQQGALTLAGCKDDYLALAGPSFRNEVDAAVALELGGHRPGKRAAEVTCPLLVQIEDFDRLAPPHAAAKAAVKGRAEVRHYPGDHFDVWPGKAHFDAVLAHQVHFLTRHLVPGTAAG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP015079_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015079_2

1002311-1002397

Orphan

Consensus_repeat	Method
GCTTCATCGGCCGGCCGATGGACCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015079_2

>merge|NZ_CP015079|2|1002311-1002397|CRISPRCasFinder
GCTTCATCGGCCGGCCGATGGACCTGACGGGTGGCCGATGAAGTTTCATCGTCCCGGCAGGAGCTTCATCGGCCGGCCGATGAACCT

>NZ_CP015079|2|2|1002311-1002397|CRISPRCasFinder
GCTTCATCGGCCGGCCGATGGACCT	GACGGGTGGCCGATGAAGTTTCATCGTCCCGGCAGGA
GCTTCATCGGCCGGCCGATGAACCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015079.1\|WP_157520458.1\|1015048_1015969_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015079.1\|WP_084527153.1\|1001385_1001766_-\|MmcQ/YjbR-family-DNA-binding-protein	unknown	unknown	gnl\|CDD\|377256
NZ_CP015079.1\|WP_068106984.1\|999414_1000509_+\|CoA-ester-lyase	unknown	unknown	gnl\|CDD\|225184
NZ_CP015079.1\|WP_068107007.1\|1016098_1016437_-\|TraR/DksA-C4-type-zinc-finger-protein	unknown	unknown	gnl\|CDD\|274340
NZ_CP015079.1\|WP_068114393.1\|1004997_1006149_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341028
NZ_CP015079.1\|WP_068106980.1\|997781_998147_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015079.1\|WP_084528008.1\|998521_999121_+\|DUF1992-domain-containing-protein	unknown	unknown	gnl\|CDD\|378159
NZ_CP015079.1\|WP_084527151.1\|994719_996243_+\|M20/M25/M40-family-metallo-hydrolase	unknown	unknown	gnl\|CDD\|236208
NZ_CP015079.1\|WP_068114395.1\|1016454_1017030_-\|dCTP-deaminase	unknown	unknown	gnl\|CDD\|234753
NZ_CP015079.1\|WP_068106996.1\|1006206_1006707_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237178
NZ_CP015079.1\|WP_068106993.1\|1003459_1004782_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015079.1\|WP_068107003.1\|1011302_1015016_+\|(Fe-S)-binding-protein	unknown	unknown	gnl\|CDD\|223325
NZ_CP015079.1\|WP_068106978.1\|994092_994713_+\|nitroreductase-family-protein	unknown	unknown	gnl\|CDD\|380311
NZ_CP015079.1\|WP_068107000.1\|1008679_1011175_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|238626
NZ_CP015079.1\|WP_068106992.1\|1002411_1003266_-\|patatin-like-phospholipase-family-protein	unknown	unknown	gnl\|CDD\|224666
NZ_CP015079.1\|WP_068106983.1\|998143_998497_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015079.1\|WP_068106986.1\|1000510_1001377_+\|CoA-ester-lyase	unknown	unknown	gnl\|CDD\|225184
NZ_CP015079.1\|WP_068106997.1\|1006753_1007557_+\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_CP015079.1\|WP_068114389.1\|996296_997721_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341047
NZ_CP015079.1\|WP_068106991.1\|1001849_1002281_+\|D-tyrosyl-tRNA(Tyr)-deacylase	unknown	unknown	gnl\|CDD\|235383

Protein	Function_ID	Function_description	E-value
NZ_CP015079.1\|WP_084527153.1\|1001385_1001766_-\|MmcQ/YjbR-family-DNA-binding-protein	gnl\|CDD\|377256	pfam04237, YjbR, YjbR. YjbR has a CyaY-like fold.	2.48215e-10
NZ_CP015079.1\|WP_068106984.1\|999414_1000509_+\|CoA-ester-lyase	gnl\|CDD\|225184	COG2301, CitE, Citrate lyase beta subunit [Carbohydrate transport and metabolism].	1.07047e-70
NZ_CP015079.1\|WP_068107007.1\|1016098_1016437_-\|TraR/DksA-C4-type-zinc-finger-protein	gnl\|CDD\|274340	TIGR02890, conserved_hypothetical_protein, regulatory protein, yteA family. Members of this predicted regulatory protein are found only in endospore-forming members of the Firmicutes group of bacteria, and in nearly every such species; Clostridium perfringens seems to be an exception. The member from Bacillus subtilis, the model system for the study of the sporulation program, has been designated both yteA and yzwB. Some (but not all) members of this family show a strong sequence match to Pfam family pfam01258 the C4-type zinc finger protein, DksA/TraR family, but only one of the four key Cys residues is conserved. All members of this protein family share an additional C-terminal domain. Smaller proteins from the proteobacteria with just the N-terminal domain, including DksA and DksA2 are RNA polymerase-binding regulatory proteins even if the Zn-binding site is not conserved. [Unknown function, General].	3.55595e-18
NZ_CP015079.1\|WP_068114393.1\|1004997_1006149_+\|MFS-transporter	gnl\|CDD\|341028	cd17475, MFS_MT3072_like, Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072 and similar transporters of the Major Facilitator Superfamily. This family includes the Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072. It belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	6.84218e-56
NZ_CP015079.1\|WP_068106986.1\|1000510_1001377_+\|CoA-ester-lyase	gnl\|CDD\|225184	COG2301, CitE, Citrate lyase beta subunit [Carbohydrate transport and metabolism].	2.99862e-84
NZ_CP015079.1\|WP_084528008.1\|998521_999121_+\|DUF1992-domain-containing-protein	gnl\|CDD\|378159	pfam09350, DUF1992, Domain of unknown function (DUF1992). This family of proteins are functionally uncharacterized.	2.00693e-18
NZ_CP015079.1\|WP_084527151.1\|994719_996243_+\|M20/M25/M40-family-metallo-hydrolase	gnl\|CDD\|236208	PRK08262, PRK08262, M20 family peptidase.	0
NZ_CP015079.1\|WP_068114395.1\|1016454_1017030_-\|dCTP-deaminase	gnl\|CDD\|234753	PRK00416, dcd, deoxycytidine triphosphate deaminase; Reviewed.	1.21284e-97
NZ_CP015079.1\|WP_068106996.1\|1006206_1006707_+\|hypothetical-protein	gnl\|CDD\|237178	PRK12705, PRK12705, hypothetical protein; Provisional.	0.000488451
NZ_CP015079.1\|WP_068106978.1\|994092_994713_+\|nitroreductase-family-protein	gnl\|CDD\|380311	cd02062, Nitro_FMN_reductase, nitroreductase family protein. Proteins of this family catalyze the reduction of flavin or nitrocompounds using NAD(P)H as electron donor in a obligatory two-electron transfer, utilizing FMN or FAD as cofactor. They are often found to be homodimers. Enzymes of this family are described as NAD(P)H:FMN oxidoreductases, oxygen-insensitive nitroreductase, flavin reductase P, dihydropteridine reductase, NADH oxidase or NADH dehydrogenase.	2.58917e-26
NZ_CP015079.1\|WP_068107000.1\|1008679_1011175_+\|hypothetical-protein	gnl\|CDD\|238626	cd01301, rDP_like, renal dipeptidase (rDP), best studied in mammals and also called membrane or microsomal dipeptidase, is a membrane-bound glycoprotein hydrolyzing dipeptides and is involved in hydrolytic metabolism of penem and carbapenem beta-lactam antibiotics. Although the biological function of the enzyme is still unknown, it has been suggested to play a role in the renal glutathione metabolism.	8.95335e-05
NZ_CP015079.1\|WP_068106992.1\|1002411_1003266_-\|patatin-like-phospholipase-family-protein	gnl\|CDD\|224666	COG1752, RssA, Predicted esterase of the alpha-beta hydrolase superfamily [General function prediction only].	9.40766e-19
NZ_CP015079.1\|WP_068106997.1\|1006753_1007557_+\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	6.44559e-58
NZ_CP015079.1\|WP_068107003.1\|1011302_1015016_+\|(Fe-S)-binding-protein	gnl\|CDD\|223325	COG0247, GlpC, Fe-S oxidoreductase [Energy production and conversion].	1.66585e-81
NZ_CP015079.1\|WP_068114389.1\|996296_997721_+\|MFS-transporter	gnl\|CDD\|341047	cd17504, MFS_MMR_MDR_like, Methylenomycin A resistance protein (also called MMR peptide)-like multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of putative multidrug resistance (MDR) transporters including Chlamydia trachomatis antiseptic resistance protein QacA_2, and Serratia sp. DD3 Bmr3. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.24631e-15
NZ_CP015079.1\|WP_068106991.1\|1001849_1002281_+\|D-tyrosyl-tRNA(Tyr)-deacylase	gnl\|CDD\|235383	PRK05273, PRK05273, D-tyrosyl-tRNA(Tyr) deacylase; Provisional.	7.96144e-80

>NZ_CP015079.1|WP_068106991.1|1001849_1002281_+|D-tyrosyl-tRNA(Tyr)-deacylase
MRAVLQRTLRASVTVDGEVVGATDGPGLLVYLGVTHDDGPADVAWTARKIWELRVLRDERSASDLGAPVLVVSQFTLYGDTRKGRRPTWQAAAPGPVSEPLYDAVCAELERLGAHVERGRFGADMAVESLNDGPITMLLDSPR
>NZ_CP015079.1|WP_084527153.1|1001385_1001766_-|MmcQ/YjbR-family-DNA-binding-protein
MFDDDDPVLARVRALALALPDAAMKVSHGRPAFFTTKVFAYYGGSVKVDGSYVQHEQSVMVLTDPDDHQALLEDPRVFVPAYLGPSGWLGVDLDLEHSDWDEVAELLDASYRRTAGARRVARLDAG
>NZ_CP015079.1|WP_068106986.1|1000510_1001377_+|CoA-ester-lyase
MSDVTPLRSVLYMPSSNERALEKAKSIPCDGLILDLEDAVAPDAKPAARSSAAAAVASGEYGRRTVTIRVNGIGTEWHDDDLVAAAQAGPAGVVVPKVNSAEEVRTLVAALEKAGAPDHTRLWAMVETPEAIFNVREIAAASDRLAVLVMGTNDLVKELYAEHVPGRAPLLTSLSLSLLAARAAGVQILDGVYNDVKDAEGFLAECAQGRQMGFDGKTLIHPGQVAPTNEQFAPSPEAVEDAQGLIRAWEDGQGSGVVTYKNKMVENLHVESARRTLSIHEAVQALEG
>NZ_CP015079.1|WP_068106984.1|999414_1000509_+|CoA-ester-lyase
MPSSHRSAKDFFRPLAVGAPTPPTEIPARPSRAIHFFDPSNAKMAAKIPQMVGSVDVLLGNLEDAVKADNKLAAREGLVKIAQETDFGPTQLWTRINALDSPWVLDDLTTLVPAIGHKLDVIMVPKVQGAEDIHYVDRLLAQLEAKAGLEKPILVHAILETARGVANVEEICGASPRMQGLSLGPADLAADRRMKTTRVGGGHPGYLVRQDPTGSGEDAINAERTTYQQDLWHYTISRMVDACALHGIYPYYGPFGDIADVVACEDQFRNAFLLGCVGTWSLHPKQIAIANRVFSPSVEDVTHARRVVAAMGDGTGAVMLDGKMEDDASLKQCLVMVDLAEELAAIDPELKKQYDAIELPGEKA
>NZ_CP015079.1|WP_084528008.1|998521_999121_+|DUF1992-domain-containing-protein
MSDPSDHSEQPRRADGAPPADASHTADEIERQKRSGESAAAARIGNQALWVDQQIRVAMAQGEFDDLPGSGRPIADLGTEHDPDWWVKRLVEREQITGVLPPSLQLRRDDAGLDDLLDALTVESEARREVEDFNARVIRARYTVVDGTPPLITMPRDVEATLGAWRERRTARVAAMRAQAQAQAAAARAPRRPWWRRHP
>NZ_CP015079.1|WP_068106983.1|998143_998497_+|hypothetical-protein
MRPPPGSVDRSPRGSPAPAGAAYAVPALLALVPSCLALAGAVALSARAWVDTDPWAGVGFVYAVIMAAPALTSLTLLVVAHRSRRHSPGTSQALAWTALAVIGLAGLAAVGRLGWAA
>NZ_CP015079.1|WP_068106980.1|997781_998147_+|hypothetical-protein
MDSQTGPTPTTYGAAPPTAHPAQVRTAYRIAAWIVLALSAPVLVGAVVLCVYAATDPGEYSSFGYLFALFLLVPMGVALSLLAAAHWLRHRSPVFSLVLACVAAAGMTWLALGALSMLVPM
>NZ_CP015079.1|WP_068114389.1|996296_997721_+|MFS-transporter
MATLVGFLVVVELASGILQGYYTPIFSDIAAHLGIQDADVNWFEAAQLLVSALCVPPLARLGDLVGHKKVLLISTAVTAVGSWGVAFAPSFETFLVAWALQGFYVVWLPLEVAIIYRRTAGTGRQGVLTRRSAAVLVGALELAVIIGALTSGTLVEATSMTVLLALPAVVVTVCFVVIWVGIDDTPGEATGGFDWPGLGLVTTALLLVMGGLIAVRLQGPGSLLPWLLIGAGLLVLVPFHRVEAARADPMIDVRLLATRGQWPVQLTAFLFGISVLGAQIPLSTFARTDPEVTGYGLGADAAFVSTLVGVYVVFLAIGALTLPLSARLLGPRGALVGGALLVALGYGLFLPFHDSTTQTLLNMAIAGLGSGALVAALPATAAAAAPADRTGFATGMTNATKTVGGAFASSVFAIALASTGSLDEPGAGQAPLSGYLTVWAICSVSAVAAALVLLMMPRPVEAGPEAAVDVVPVL
>NZ_CP015079.1|WP_084527151.1|994719_996243_+|M20/M25/M40-family-metallo-hydrolase
MAGGHAPSPATRPPPVNDPHRPAVSDARPASRPPETTAFRRAGHPARRSLPPVTLREGAEQHRAVGKLQALVRIPTVSHRDPAQVDTAAFDAFLEELERQFPLLHEHLHLTRVHTHGLLLHWRGSSDERPVVLMAHLDVVPVEGEWQHPPFSAAIADGCIWGRGTLDDKGCLVGICEAVETLLERGHTPAQDLWLSFGCDEEVFGLAAPLAVAELRQRGVRPWFVLDEGGAIASEAFPGVGAPIGVIGVTEKGTTSVELRAEGRGGHASTPARNGPTARIARAITALERAPLPASLPGPTIELFRRLAPHAPLPLRPLMARADRLRPVLTRALLAAGPETAAMARTTVAVTTLSGSPALNVIASTARAGVNLRLMVGDTVSDVLAHVRRTVGDGVEVDVLESGEASPVSPYSVVDGAGGYTEVDEAFALLEDTITEVFPDAVPAPYVMMAATDSRHFTAICERVYRFAPFRMTKAQRESIHSYDEHLGVEAFLDGVDWYRRLIERLP
>NZ_CP015079.1|WP_068106978.1|994092_994713_+|nitroreductase-family-protein
MEFQDVVRRRRMVRNYAERPVERAQVDRMLDNATRAPNAGFSQGWSFLVLDTPDDVRRFWRATSDDVDAPDRWLAGMMRAPVVIVPCSSRAAYLDRYAQPDKDGTRRRNGSPAGDPWTVPYWHMDAAMASLLILQTAVDEGLGACFFGLPPHREPEVRDEFAMPDDVDPIGVITVGHRAEDPGSTGSPASRRRRPTDDVVHRGGWG
>NZ_CP015079.1|WP_068106992.1|1002411_1003266_-|patatin-like-phospholipase-family-protein
MKALVLGGGGITGIAWETGLLAGLADAGTDLSTADRVIGTSAGSIVGSQITSDTPLDELYRRQLLEPGHPDGPTEAALARIGPLVLATYGVAVLRARGDAEAFGRLLGHRAQRASARGRTPSVPERYDQVRQRLTTTEWPAQDLVVTAVDADSGALAAFRAGAGVGLEDAVNASCAVPCVYPPIAIGGRTYIDGGLRSGANADLAEGCDPVIVLSPLDRSVGPLRSARQQLDELGVPHLVITPDDAARAAIGKNVLDPAARPGSARAGHAQAAAYAARVRELWG
>NZ_CP015079.1|WP_068106993.1|1003459_1004782_+|hypothetical-protein
MPPFTRITTIASAAVVTATLSLAPTLSASAEPRPDATAQATSAARTAAPVTLEKRTPFVFKGNGYGTSIEGGELPIDSSRLALSSMACTTIAGKKNRNFVEESELPGLGTVRGVYSKVVSKKKGGVTFQKSQHKVAEVVLADTPLGKLSIDGVVSTTKASWSKKAGYQASADTKIAGITFAPAGGLPAQTIPIPSPGQTIPIPGLATITLGRTIESPEPGKNRSRAYAVGVVIEVIPTGTTIKLARSMSKLEKGFKTGIFGGSAIPVKAHVLGELAQVGRVVRQTMPCLGTDGELDKSDAADVNLADQIVVQAASARQKGKQTKKKAVGTEVARIASVNLGGGALVLDAIESKVKVTRLKSGKLKRSASAKVGSITGGGGDPQSLEDLDGLEIPGVLKIETGLKKKVKDGIRMIGLRITLLDGTGAVVDLATSKLSIADR
>NZ_CP015079.1|WP_068114393.1|1004997_1006149_+|MFS-transporter
MLGASTLAQGAAAVTIHGPAFLIPTLRDAGLTLPQAGLVAAAPIIGVVLALVAWGLVTDRRGERFVLVTGLVLTALSGGVAMLAGSRGGPVALFVTLLVAGAAAASTGSASGRVVVGWFPSHRRGLAMGVRQMAQPVGVGVAAVSIAVTAERYGVAVALGVPVTAAVLAALVVVLVVQDPPRPSVRDGATVANPYRQDSYLARIHGVSVLLVVPQFLVWTFALVWLVSDRGWSAAAAGSLVALAQLAGALGRIAAGQLSDVVASRLRPLRWVAVAAGLTMGLLGWAAGQGAALAVPLVVIATVLTVADNGLAFTAVAERAGPHWSGRALGAQNTAQYLTASAVPPLAGLAVDRIGYAAAFALAGLFPLVAVALVPVREERPLS
>NZ_CP015079.1|WP_068106996.1|1006206_1006707_+|hypothetical-protein
MSTSMILLVLAVLVVLALVVVAVVLINQRNSRLRAARAEQAGQLRAQAAAHDGPIAASRDRADEAAGRAAEARREAQIAEREAAEAERLLAQDQARQEDQLRTADHLDPHGEAIPEHPAGATGPVTEAAPAPDDYSPTDPAVDPAMDPAVDPAVDPAIDPDGRHRA
>NZ_CP015079.1|WP_068106997.1|1006753_1007557_+|IclR-family-transcriptional-regulator
MQQQREDAGTPGASQVPAATRTLRVLRFLAGQPDPVPVDRIARACDLPRSTAYHLLAVMAEEGFVTHLPEEHLYGLGVAAFEVGSGYARQVPLQRIARHALATLVDRTGHNAHLAVLHGRDVLYVLEERAPGRPPLVTDVGVRLPAHLTASGRALLAGLSAAQVRATYPSGDALVERTDRGPRTPSALRELLVQTRQRGHATEDGEVSEGMASVAAAVRDHHDHPVAGVALTYPVAEVDPADVDALATQVRRTAAQLTRRLRGRATP
>NZ_CP015079.1|WP_068107000.1|1008679_1011175_+|hypothetical-protein
MRRTQPATRRLAWTALGAALVVGTAVVLPGVVADPGTSRTGPQARGGLQAVHEAASGQGTLPFTDADGHEVRLDVDPSTKNAVSRAGEIGAETRDPTTAAERTAAAAYVAAERARRDPRLRTTPAYPKRTQHPRTRYAMARGCYTLVPGGDPTYFQATGLGEYLLLGPDETLLASGGGTATTPSDSTVWTATLKRGRMYFSSQGLPLQIDGEREFLLTRAKGCATWPEAGVDVQGKPHAGVTPFQEVRGYVDAHTHHMAYEFLGGEVHCGKPWDRFGAEVALTDCDDHTLTGGYGALLETALSGEVGHDPVGWPTFKDWPAPASLTHEGTYYRWMERAWRGGQRLFTNLLVENNQLCQLYPLKRNSCDDMDSVRLQAQRTYEFQDYVDAQFGGPGKGFYRIVTSPFEARKVINQGKMAVILGIETSVPFGCTFKKLPGGDLAQCDAEKIDAQLDEMHDLGVRQMELVNKFDNALSGIAGDAGETGVAVNAANFLETGTFWDMRTCTPGDTENHDRNQTLAAPEISAEQQDALFGAIGQLFSTINLPALPLYPRTNHCNARGLTTLGEHTINGLVDRKMVFDPDHMSVKARIQAIDQIEELGYHGLLSSHSWSTPDSYPRIYELGGFITPYAGDSTGFVNKWRQHQGWADPRYYFGFGYGADINGLGAQGDPRGADVTNPVTYPFKGLNGVTVRQQRAGERVYDINIDGVAQYGLYPDWMEDLRRVADSQEGDGRAVLADMARGAEGYLQMWERAYGIAPDSCRNPGERLPVATVQRRLERGMSTTGVMKVVGQPYTRLGRSFGFCARQGAKKVEMTATFSRGGKLRGVRRG
>NZ_CP015079.1|WP_068107003.1|1011302_1015016_+|(Fe-S)-binding-protein
MQTFAIVVSLAFTAVAVVMTTRAVRAILATVRVGTPLSRTDEPVRRTVTLLKESLLHTRMLQWRWIGVMHWFIYAAFIVLSAAVATGFVQLFDPHFQLWIIGHFFLYEWISEGLGLLGTIGIVFLAVHRQLNHPRSQGRKSRFFGSTQWQAYFVEAFVLIESAAILFIRGAEYNLGLAEGQDISRFNFPISSFFGDALFATGADNVETLENTIIFIAMIKVVLAMTWLMVISSNLTMGVAWHRFTAWFNIWFKRESTGRDTDGATTALGAVKPLTNQGKRVSLDDIDDLDEDAALGVGAIEDFSWKGILDFTTCTECGRCQSQCPAWNTEKPLSPKLLITALRDHAYAKAPYLQAAEGDRAALLEGDTALATEVERPLVGETGDDWFYMPDSGVAVIDPEVLWNCTNCGACVQQCPVDIEHVDHIIDMRRHQVLVESNFPAELNGLFKGLENKGNPWNMSPSARMDWAKGLDFDVKVVGEDIESLDEVEWLFWVGCAGAYEDRAKKTTRAVAELLHMADVSFGVLGNGETCTGDPARRAGNEFVFQGLAMQNVETLTEHKVKKVVSTCAHCFNTLKNEYKEFGIELEVTHHTQLLNRLVREGKLTPVQDGAGAHKRSITYHDPCFIGRHNGVYSPPRELLQVLPGAEVVEMERNSERSFCCGAGGARMWMEENTGERINVNRTTEAIGTGADQIAVGCPFCRVMLSDGLTMKQSKGEAREEVEVLDVAQMLLASVKGEMATKAAPGSSAAAAPAAKAAAPAAKTADKDSGKESGKDEATKAEPEAGDATITEDTVVETQDAGPAAKASGGSSLFDSPDAAAADDKPAAATSGGSLFDTPDTAAADKPAAEEAKAAKPESSGGSLFDLGGDAPAAPAKADPKAETAPKAEPAEAKTETAPAAKAETTDLSGGGSLFDLGGDAPAAPAKADPKAEAAPKAEPAEPKAEAAPAAKAETTDLSGGGSLFDIPAAEPVAKAPAEPKAEAAPKAEAPAEPKVEAKTEAAPAAKSQSTDLSGGGSLFDIAAPEPSAPSTSSTPAAEPEPAVETEPEPEPEAKATPEPAPEPTPEPAATTATPAAASSGSAVTPKTDVDVNGLGSLFDIEAPEATTVERPAAAPAPEPEAAAPAPEPEAAAPVEEPEKATAPTSASTSDDVSPGAALSAAATQAAGTAEETPEPPEAEVVAEEPAVEEPATEAPAAEEPAAEEPAEPAPKPASSGAAHTPKTDADIEGTSSLFDL
>NZ_CP015079.1|WP_157520458.1|1015048_1015969_-|hypothetical-protein
MVARRQLLALETTDATDLARMRRRRELVEVHRGIYVEHTGPLTWQQRAWAAVLWAWPAALCGESALRAADGPGRADRETDVIHVVVDRDRRLEPPPGVVVHRRAGYADQVRWNLGPPRLRYEEAALDLALAAPDDLAAVAALADACGSRRTTAQRLLASLDARPWARRRDWTRRVLQDVADGTCSVLEHAYLEQVERAHGLPVGSRQVLARSAGRTMWQDVAYEELGLLVELDSRLFHSSVRQRDRDLDRDLDQAVDAHETLRLGWGQVVDRPCRTAARVGAVLQRRGWTGMVSPCEKCGGPDQPG
>NZ_CP015079.1|WP_068107007.1|1016098_1016437_-|TraR/DksA-C4-type-zinc-finger-protein
MPTTPTRARLEAERDEVLARTDRLRADLDAFRAASERDNADDEHDPEGATIAFERSQVATLLREGERRLADLDAALEREGRGTYGVCERCGRPIPPARLEVRPSARTCVGCA
>NZ_CP015079.1|WP_068114395.1|1016454_1017030_-|dCTP-deaminase
MLLSDRDIMAEIDAGRVALDPFDPAMLQPSSVDVRLDRFFRVFENHKYPHIDPAADQSDLTRMIEPEGDDAFILHPGEFVLGSTYEVVSLPDDIAARVEGKSSLGRLGLLTHATAGFVDPGFSGHVTLELANVATLPIKLYPGMKIGQFCFFRLSSPSEHPYGSAKYGSRYQGQRGPTPSRSFQSFHRTQI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP015079_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015079_3

1756113-1756199

Orphan

Consensus_repeat	Method
GCTTCATCGGCCGGCCGATGAACCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015079_3

>merge|NZ_CP015079|3|1756113-1756199|CRISPRCasFinder
GCTTCATCGGCCGGCCGATGAACCTGGCGGCGGGACGATGAAGCTTCATCGTCCATCCAGGAGCTTCATCGGCCGCCCGATGAACCT

>NZ_CP015079|3|3|1756113-1756199|CRISPRCasFinder
GCTTCATCGGCCGGCCGATGAACCT	GGCGGCGGGACGATGAAGCTTCATCGTCCATCCAGGA
GCTTCATCGGCCGCCCGATGAACCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015079.1\|WP_084528066.1\|1761011_1762106_+\|sulfotransferase-family-protein	unknown	unknown	gnl\|CDD\|226081
NZ_CP015079.1\|WP_084527346.1\|1756226_1757228_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224050
NZ_CP015079.1\|WP_157519975.1\|1754965_1756090_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP015079.1\|WP_068108121.1\|1753778_1754246_+\|DUF3180-domain-containing-protein	unknown	unknown	gnl\|CDD\|378650
NZ_CP015079.1\|WP_169834674.1\|1758816_1759758_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270324
NZ_CP015079.1\|WP_068108127.1\|1757934_1758744_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224095
NZ_CP015079.1\|WP_068108134.1\|1762113_1763028_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|133005
NZ_CP015079.1\|WP_068108130.1\|1759783_1760890_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|182223
NZ_CP015079.1\|WP_068108110.1\|1748547_1749099_+\|hypoxanthine-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|223707
NZ_CP015079.1\|WP_068114592.1\|1751333_1751954_+\|GTP-cyclohydrolase-I-FolE	unknown	unknown	gnl\|CDD\|236472
NZ_CP015079.1\|WP_068108112.1\|1749204_1751337_+\|ATP-dependent-zinc-metalloprotease-FtsH	unknown	unknown	gnl\|CDD\|273520
NZ_CP015079.1\|WP_068108116.1\|1751970_1752852_+\|dihydropteroate-synthase	unknown	unknown	gnl\|CDD\|238380
NZ_CP015079.1\|WP_068108108.1\|1748101_1748440_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|366102
NZ_CP015079.1\|WP_068108136.1\|1764304_1765222_+\|pantoate--beta-alanine-ligase	unknown	unknown	gnl\|CDD\|376824
NZ_CP015079.1\|WP_068108126.1\|1757231_1757930_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224095
NZ_CP015079.1\|WP_068108138.1\|1765227_1765647_+\|aspartate-1-decarboxylase	unknown	unknown	gnl\|CDD\|376751
NZ_CP015079.1\|WP_068108123.1\|1754255_1754897_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274008
NZ_CP015079.1\|WP_084527348.1\|1763357_1764308_+\|DUF2520-domain-containing-protein	unknown	unknown	gnl\|CDD\|227782
NZ_CP015079.1\|WP_068108118.1\|1752844_1753216_+\|dihydroneopterin-aldolase	unknown	unknown	gnl\|CDD\|376737
NZ_CP015079.1\|WP_068108119.1\|1753212_1753782_+\|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase	unknown	unknown	gnl\|CDD\|223872

Protein	Function_ID	Function_description	E-value
NZ_CP015079.1\|WP_084528066.1\|1761011_1762106_+\|sulfotransferase-family-protein	gnl\|CDD\|226081	COG3551, COG3551, Uncharacterized protein conserved in bacteria [Function unknown].	2.54582e-14
NZ_CP015079.1\|WP_084527346.1\|1756226_1757228_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224050	COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism].	1.2446e-139
NZ_CP015079.1\|WP_157519975.1\|1754965_1756090_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.76539e-06
NZ_CP015079.1\|WP_068108121.1\|1753778_1754246_+\|DUF3180-domain-containing-protein	gnl\|CDD\|378650	pfam11377, DUF3180, Protein of unknown function (DUF3180). Some members in this family of proteins are annotated as membrane proteins however this cannot be confirmed. Currently there is no known function.	3.72222e-19
NZ_CP015079.1\|WP_169834674.1\|1758816_1759758_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270324	cd13606, PBP2_ProX_like, Bacterial substrate-binding protein ProX of ABC-type osmoregulated transporter and its related proteins; the type 2 periplasmic-binding protein fold. This group includes periplasmic substrate-binding component of ABC transport systems from gram-negative and -positive bacteria that are involved in uptake of osmoprotectants (also termed compatible solutes) such as betaine, choline, proline betaine, carnitine, and L-proline. To counteract the efflux of water, many microorganisms accumulate the compatible solutes for a sustained adjustment to high osmolarity surroundings. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	2.7713e-67
NZ_CP015079.1\|WP_068108127.1\|1757934_1758744_+\|ABC-transporter-permease	gnl\|CDD\|224095	COG1174, OpuBB, ABC-type proline/glycine betaine transport systems, permease component [Amino acid transport and metabolism].	2.30861e-44
NZ_CP015079.1\|WP_068108134.1\|1762113_1763028_+\|hypothetical-protein	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	1.66644e-07
NZ_CP015079.1\|WP_068108130.1\|1759783_1760890_-\|glycosyltransferase	gnl\|CDD\|182223	PRK10073, PRK10073, putative glycosyl transferase; Provisional.	4.63042e-42
NZ_CP015079.1\|WP_068108110.1\|1748547_1749099_+\|hypoxanthine-phosphoribosyltransferase	gnl\|CDD\|223707	COG0634, Hpt, Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism].	1.86214e-86
NZ_CP015079.1\|WP_068114592.1\|1751333_1751954_+\|GTP-cyclohydrolase-I-FolE	gnl\|CDD\|236472	PRK09347, folE, GTP cyclohydrolase I; Provisional.	1.01926e-107
NZ_CP015079.1\|WP_068108112.1\|1749204_1751337_+\|ATP-dependent-zinc-metalloprotease-FtsH	gnl\|CDD\|273520	TIGR01241, ATP-dependent_zinc_metalloprotease_FtsH, ATP-dependent metalloprotease FtsH. HflB(FtsH) is a pleiotropic protein required for correct cell division in bacteria. It has ATP-dependent zinc metalloprotease activity. It was formerly designated cell division protein FtsH. [Cellular processes, Cell division, Protein fate, Degradation of proteins, peptides, and glycopeptides].	0
NZ_CP015079.1\|WP_068108116.1\|1751970_1752852_+\|dihydropteroate-synthase	gnl\|CDD\|238380	cd00739, DHPS, DHPS subgroup of Pterin binding enzymes. DHPS (dihydropteroate synthase), a functional homodimer, catalyzes the condensation of p-aminobenzoic acid (pABA) in the de novo biosynthesis of folate, which is an essential cofactor in both nucleic acid and protein biosynthesis. Prokaryotes (and some lower eukaryotes) must synthesize folate de novo, while higher eukaryotes are able to utilize dietary folate and therefore lack DHPS. Sulfonamide drugs, which are substrate analogs of pABA, target DHPS.	1.63433e-104
NZ_CP015079.1\|WP_068108108.1\|1748101_1748440_+\|hypothetical-protein	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	0.00658171
NZ_CP015079.1\|WP_068108136.1\|1764304_1765222_+\|pantoate--beta-alanine-ligase	gnl\|CDD\|376824	pfam02569, Pantoate_ligase, Pantoate-beta-alanine ligase. Pantoate-beta-alanine ligase, also know as pantothenate synthase, (EC:6.3.2.1) catalyzes the formation of pantothenate from pantoate and alanine.	2.9576e-141
NZ_CP015079.1\|WP_068108126.1\|1757231_1757930_+\|ABC-transporter-permease	gnl\|CDD\|224095	COG1174, OpuBB, ABC-type proline/glycine betaine transport systems, permease component [Amino acid transport and metabolism].	2.03624e-51
NZ_CP015079.1\|WP_068108138.1\|1765227_1765647_+\|aspartate-1-decarboxylase	gnl\|CDD\|376751	pfam02261, Asp_decarbox, Aspartate decarboxylase. Decarboxylation of aspartate is the major route of beta-alanine production in bacteria, and is catalyzed by the enzyme aspartate decarboxylase EC:4.1.1.11 which requires a pyruvoyl group for its activity. It is synthesized initially as a proenzyme which is then proteolytically cleaved to an alpha (C-terminal) and beta (N-terminal) subunit and a pyruvoyl group. This family contains both chains of aspartate decarboxylase.	2.50761e-77
NZ_CP015079.1\|WP_068108123.1\|1754255_1754897_+\|hypothetical-protein	gnl\|CDD\|274008	TIGR02168, Chromosome_partition_protein_Smc, chromosome segregation protein SMC, common bacterial type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].	9.13097e-06
NZ_CP015079.1\|WP_084527348.1\|1763357_1764308_+\|DUF2520-domain-containing-protein	gnl\|CDD\|227782	COG5495, COG5495, Uncharacterized conserved protein [Function unknown].	7.84817e-41
NZ_CP015079.1\|WP_068108118.1\|1752844_1753216_+\|dihydroneopterin-aldolase	gnl\|CDD\|376737	pfam02152, FolB, Dihydroneopterin aldolase. This enzyme EC:4.1.2.25 catalyzes the conversion of 7,8-dihydroneopterin to 6-hydroxymethyl-7,8-dihydropterin in the biosynthetic pathway of tetrahydrofolate.	4.2566e-43
NZ_CP015079.1\|WP_068108119.1\|1753212_1753782_+\|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase	gnl\|CDD\|223872	COG0801, FolK, 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase [Coenzyme metabolism].	2.61757e-51

>NZ_CP015079.1|WP_157519975.1|1754965_1756090_+|GNAT-family-N-acetyltransferase
MIPEENLPDENRFESDPGEIFDDLPLPDGWEVGTPDADDPAEVARLTHLLRAHERHGRGWAGAGVDDVLVEVSEHGLRTRENVVIRDPEGQIEAWGSVHDRAGGRMLYSHIVSRELGAPIARKCSDALFEWATAQARAVGEARGLPTQQIDTGAFEDDGRQAEWLTRAGFRKVRTWWQMNRPVTPEEVDLVPDNEEWEARGVRFRLVDREGQGLPDEADLRAVHDVLEQSFNDHFNNFEESYAEFLHRLREDPGHRWNHWWLAEMFDDVPEGLTAEEGRHPAVGALIGTFSENATGPDSSYVSYIGVIEAARGRGVAKGLLRTIISDAARRGRIGVGLEVDADSATNADGLYTSMGWRTKYVTQSWHRDVPVEG
>NZ_CP015079.1|WP_068108123.1|1754255_1754897_+|hypothetical-protein
MSSSVAGAPQASSVTSASRSSRRRQRSTRLSVATALLVLSALLVLGAVASGSALLVTVAALGAVVLGAAATRMTHAELLASRRDANRDRAEQAQAYRRLAEARADEHAARVAELTGRLGEREVALGDLQTELVKTQRTAAESARQVEVAHRRNVDLEKEGRLVSRSLESAEERAADAIVRVAELEAEIDVLRAELETVTVAWRSAEAGARRRA
>NZ_CP015079.1|WP_068108121.1|1753778_1754246_+|DUF3180-domain-containing-protein
MSEPEGRLTPTSPAALTAAVVLGLVLGWLARPVTTAWLGSAPVVTWVQPALLALVALVVGVTARHTHVSLQQRREPMEPHRAVNRLAFGRASAYAGALVGAGYAGYALSWLGLSAELAGQRMLWSGLAALAGVAVVACGLALERACRVPEDDPDA
>NZ_CP015079.1|WP_068108119.1|1753212_1753782_+|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase
MTETPNPHIINADTLTGEMRPIRRVVLALGSNLGERMSMLQGAVNAIADTPDVWVTGVSPVYETEPVDAPEGSRNYLNAVVLADTTLAANRLMDRALAIEDAFERERSEVLNAPRTLDVDLIVVGDRRSNEPHLRLPHPRAAERPFVLKPWFDLEPDASLPERGPIADLLAETGLDGITLREDLTLAVE
>NZ_CP015079.1|WP_068108118.1|1752844_1753216_+|dihydroneopterin-aldolase
MTDEISVLGVECFAHHGVLEHEKRDGQTFVLDLTLGLDTAPAAASDDLRDTVDYGSLVAAVKTAVERDPVDLIETVAQRIADVCLLHDRVEWARITVHKPHAPIRATFSDVTLTITRRREDST
>NZ_CP015079.1|WP_068108116.1|1751970_1752852_+|dihydropteroate-synthase
MIPAPAVPLGVPLGRPRVMGVVNVTPDSFSDGGRYAAPADAVAHGLALLDEGADLLDIGGESTRPGATRPLVAEELARVVPVIRELADAGAVVSVDTMRHEVAEAALEAGAVVVNDVSGGLADPAVLEVVAAAGATYVAMHWRAHSDRMRDFAVYDEAGGVVAAVCRELEERVEVIRAAGVADDRIVLDPGLGFAKTPAHSWALLRDLDPLLALGHPLLVGASRKSFLGSLLDSSRAGRGGPRPVGEREAAHLAVVLELARAGVWGVRVHDVRSARDALAVWAALTQEEGPHD
>NZ_CP015079.1|WP_068114592.1|1751333_1751954_+|GTP-cyclohydrolase-I-FolE
MTDPVTVAERDPGDIPDFDHARAEAAVRELLLAIGEDPDREGLLETPARVARAYAETTAGLRMRAEDVLTTTFDLGHGEMVLVRDIELWSMCEHHLVPFTGVAHVGYIPAESGKITGISKLARLVDVYAQRPQVQERLTTQIVESLMRILDARGAVVVIEAEHLCMTMRGVRKAGARTITSAVRGTMLTDQATRAEAMALIHGTTR
>NZ_CP015079.1|WP_068108112.1|1749204_1751337_+|ATP-dependent-zinc-metalloprotease-FtsH
MKRIVKGPWLWIVVAVVGVLLALQFLAPSSGGDEIPASEMTAHIEAGEVESITFVGGDQEIRATLDEGVREDGAEVFSYWVQGTQTRLYNEAQAQVDEGTIEELKTEISRPSALSSFLFSFLPLIIIFIVFLWLLNNMQGGGGRGVMQFAKSKAKLITKDMPKTTFNDVAGCVEAIEELGEIKEFLQEPAKFQAVGAKIPKGVLLYGPPGTGKTLLARAVAGEAGVPFYSISGSDFVEMFVGVGASRVRDLFEQAKENAPAIVFIDEIDAVGRHRGAGMGGGHDEREQTLNQLLVEMDGFDVRGGVILIAATNRPDVLDPALLRPGRFDRQIQVDAPDLAGRHQILQVHSRGKPMSPDINLLSVARRTPGFTGADLANVLNEAALLTARESEKLITDASLDEAIDRVIAGPQRRTRLMSEKEKLITAYHEGGHALVAAALPGNDPVHKITILPRGRALGYTMVLPDEDRYSQPRSQMLDQLAYMLGGRAAEELIFHDPTTGAGNDIEKATSLARAMVTQYGMTERLGAIKLGDSNSEPFLGRDMGHQRNYSEDVAAMVDDETKKLLQAAHQEAFDILEENRDVLDQLVLVLLDKETLDKQQIADVFVPLRRRSVRPAWTGSPDRQPSHIPAVEIPEEIRERARVNGAAETQRNDRGPGHDYGQGGGPDGPGAIITPPGADGDVHGGTPGAGGAPGGPSTPPGPPDDSWRP
>NZ_CP015079.1|WP_068108110.1|1748547_1749099_+|hypoxanthine-phosphoribosyltransferase
MDSAHVEHDLVNVLFTEAQIQARLKEMAAQIEQDYEGEELLIVGILRGAVMVMADLARSFTRHLEMDWMAVTSYGSGTKSSGVVRILKDLDTDISGRHVVIVDEIIDTGLTLSWLTSNLTSRNPASVEIATLLRKPEALQMPVDVKYVGWDIPNEFVVGYGLDYREKYRNLRDIGTLAPHVYS
>NZ_CP015079.1|WP_068108108.1|1748101_1748440_+|hypothetical-protein
MRPRNEWTRSADVADAINALLLQQGLGAPSQRAIAAQTRLSPGTLTYEYGSRADMLRLTGIQVGRDHARIWADRCYRARRSGETGLDALLPRDELDLEHERLWGAWRELAPR
>NZ_CP015079.1|WP_084527346.1|1756226_1757228_-|ATP-binding-cassette-domain-containing-protein
MDATGSAPANVMIRLSGVGKRYDDGTVAVQDLDLEVLEGEMVVLVGPSGCGKSTTLKMINRLIEPSTGTIEIDGRDVTTADPVELRRGIGYVIQQIGLFPHQKIITNVMTVPLLYGESKATARARATELLELVGLDPALHAERYPHQLSGGQRQRVGVARALAADPPVLLMDEPFGAVDPVVRVRLQEEFLRLQRDLGKTVVMVTHDIDEAVRMGHRVAVFAEGGRLAQYGTPAELLAHPADEFVADFVGSEKSLRRLSVVPLRREHLEPMDGVSAGQLGAAIDLDTSLEGALVHLLGSDKSMVGVREGVQFVGVLTPAGVHRALRASLAEQA
>NZ_CP015079.1|WP_068108126.1|1757231_1757930_+|ABC-transporter-permease
MTLLAQAADGPSCYGRLTNEWLCWDYVVDYRPEIVEATIEHVAITLASVAFALALSMPLALLARRVPRLESAVLGVSTGLYTVPSLALFPLLVPFTGLSPTTVVIGLGLYALTILVRAILEGLRAVPEEVRESARGLGYGDGRLLLRIELPLAVPVVMAGLRVATVSTVALTTVGSLVAYGGLGNLIADGVQSNFRAQLLTAAVLCVVLAVLLDVLIVLSQRLLTPWTRTAG
>NZ_CP015079.1|WP_068108127.1|1757934_1758744_+|ABC-transporter-permease
MNVLLDALAYLREADNWSGSGGMLQLLVQQLLITVTALLAAMLVGLPIALWLGHLGRGGFLAINISNVGRAVPTFALLAIFVSGDPWGWTAGAFPGTGTVGPFGRAGISTLVALALFALPPLITNAYVAVREVPADVRESARGMGMSGWQQFRRAELPLALPLVMSGVRLALVQVWATATIAALVAGPGLGRVITDGFFRTDYGKGIAGAIVVAVVALLLELGAAGAQRLLDPLGRATRAGSGNGRARRGEGRVSSEAPTLEAAASSGG
>NZ_CP015079.1|WP_169834674.1|1758816_1759758_+|ABC-transporter-substrate-binding-protein
MVRRSLAAVVSAGALLLAACAGDDLADDASEDTSTSGSGGGAVTIASQSFPEAALVASMYELLLADAGYDPTVQLVDSRDAYMATFPGDVDIVPEYVGGIVNYLNDTSDEGSGEPIVAGDGEELAEKGADLLDTAGIELLDLSEATDTNAYFVSQERADEEGWSVLSDLEGESVVLAAAPDCKGRLDCEAGLSNEYGIDVTKVLPLGYAGDQTYQSVLKGESDLGQTSTTDGTLESLGLVVLDDDQEIQPAQNLVPAVSQDFLEDNADVEDLLNELMAALTTDKLTELNGRMSLDREKAEDVARDFLESEGLL
>NZ_CP015079.1|WP_068108130.1|1759783_1760890_-|glycosyltransferase
MKFGRRAPLLSVVVPVYDVADYLPACLDSLLAQTYRPLEVVVVDDGSPDDSGAIADAYAARHPEITVLHTGNYGLGAARNTGVAHARGALLGFADSDDVVPPEAYAVLARALRGREVDLATGSIVRWEDGALVEPPWMRRLHHERRTVRIEEHPEVLGDVFAWNKLYRRSFWDDHALSWPEGVRYEDQPTTTRAFLAARRFAVLPEVVYHWRIRSDGTSITQQRSSVEDLRDRWRTKQMALASVEAHGSPEVTEVFRDRVLAGDLHRYFTEIPGCPDEWWALLHEGVVALWGNRSLVHSGLPPVHRLTGWLVEQGRRSDAAAVMTYAARHPGPVPRHDTPAGAVIDVPLPDGAAPVPHEAVALRAHER
>NZ_CP015079.1|WP_084528066.1|1761011_1762106_+|sulfotransferase-family-protein
MPADPDPASYPRKVLFVAGAGRSGTSTMAGLMKILGLHVPQPEVEPDETNPKGFAEPAWAVEHHTRLLREAMVQVSDSRPDAWFETGRVSAREPERIATAEWLEGHFAVNPELVVKDPRLSWFLSLWRVAAIRCDATPVFATMLRPPSEVVGSKQKYYANRLGSAHLAASWLNMLLHTERATRESVADGGRVFVRYGDLLDDWVRATSHVGETLGLQHIVNAKSERIRDGHRFVDPGLRRVSGSLEDLGLPKRLHDLTAETWNELNKLAEPGGDQPEVHQALDQIRETYVDLYEESEAISRSSVVAAEQKSRRGRDKNGPAPAASTADPAPEAGSAADRIPHGLRAAIPPSVRRGLRKVAGRER
>NZ_CP015079.1|WP_068108134.1|1762113_1763028_+|hypothetical-protein
MNAIRNAEGLTNIEGHHDFDITWPWNRPGGLRPGSTAVLRVKDEAPSLPFVLPPLLRATDHVIVVDNGSTDGTAEVAARTAADLGLSAKLTQASYPFEVARAGAEHLAAHELSVHSLSYFYNWCFAQVGTRYSWKWDGDMVLTTEGEVSMADLTWQVGGVQTIIRVPRHGLYIEDESLAYLDLGLRNAEEWGYPVGPDFVFTKAFEWEIRSTPEHCRTMGLPQGLCVELKYLHGDEFAHWTDPASFATSWRNRRKRREWAVFHALKEGTVPPGVHEIRAPEGVHVVDHVTRHWLPHAPRPLQVG
>NZ_CP015079.1|WP_084527348.1|1763357_1764308_+|DUF2520-domain-containing-protein
MSLPVFRVGVVGAGRVGAVLAARLRSAGHDVVAAAGDSDASLHRIATLLPGVANDKPTAVARACDLLLLTVPDDMLANVVSTLAGAGALHEGQLVVHTSGRHGLAVLEPARAAGARTAAIHPAMTFTGTALDLERLSGCVFGLTADDAEREVAERLVHDLGGRPMWVPEQMRTLYHAGLAHGANHLVTLVTEAMEMLAAAGADDPAGTLRPLLVAALDNALEHGDAALTGPIVRGDLGTVRAHLEDISANAPQTKASYVALARATLGRAVTDGRIVPLRAMRIHELLDEHAHDDSTGHATASRVTSTGPAAQRDVR
>NZ_CP015079.1|WP_068108136.1|1764304_1765222_+|pantoate--beta-alanine-ligase
MSGPTLVRTRLELAAHLAAARRTGERVALVPTMGALHDGHASLMRLARERVGAGPVVVSVFVNPLQFGEAADLDSYPRTLEADLEVCAREGVDVVFAPGVDEVYPGGEPQVTVHPGPLGDVLEGRTRPGHYRGVLTVVAKLLGLVRPDVAVFGQKDYQQLVLIRRMVADLCLDVEVVGAETRREDDGLAMSSRNVHLDPEQRLQAVALSRALGAAADQASFGAKVALDAAREELRDAAGVDLDYLEVTDPALDVLPDDPAAGTEARALIAARVGSTRLIDNVPLVLGVPAAGPASSPSSTDPHQE
>NZ_CP015079.1|WP_068108138.1|1765227_1765647_+|aspartate-1-decarboxylase
MLRTMMTSKIHRATVTQADLHYVGSVTVDEDLLDAADLLAGELVHIVDITNGARLETYTIAGERGSGVIGINGAAARLVHPGDLVILIAYGQMETAEAREHQPHVVFVDGDNKILATGFDPAETFEGPGLVRGDVTAGR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP015079_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015079_4

1783928-1784025

Orphan

Consensus_repeat	Method
CTCCGGATGGTTGCTGGCTCACCGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015079_4

>merge|NZ_CP015079|4|1783928-1784025|CRISPRCasFinder
CTCCGGATGGTTGCTGGCTCACCGCCGCCGCGCTGCCGCTCCGCCGGGCGGTGAGCTGGCAACGGGAACCGGTCTGCGGATGGTTGCTGGCTCACCGC

>NZ_CP015079|4|4|1783928-1784025|CRISPRCasFinder
CTCCGGATGGTTGCTGGCTCACCGC	CGCCGCGCTGCCGCTCCGCCGGGCGGTGAGCTGGCAACGGGAACCGGT
CTGCGGATGGTTGCTGGCTCACCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015079.1\|WP_169834675.1\|1780874_1781036_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015079.1\|WP_068108172.1\|1780475_1780679_+\|cold-shock-protein	unknown	unknown	gnl\|CDD\|224197
NZ_CP015079.1\|WP_068114599.1\|1787522_1788473_+\|phosphate-ABC-transporter-permease-subunit-PstC	unknown	unknown	gnl\|CDD\|273992
NZ_CP015079.1\|WP_068108187.1\|1789620_1790400_+\|phosphate-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|184587
NZ_CP015079.1\|WP_068108168.1\|1777672_1778458_+\|crotonase/enoyl-CoA-hydratase-family-protein	unknown	unknown	gnl\|CDD\|181723
NZ_CP015079.1\|WP_068108180.1\|1784055_1785183_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015079.1\|WP_068108182.1\|1785230_1786127_+\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|239645
NZ_CP015079.1\|WP_068108166.1\|1776965_1777577_+\|carboxymuconolactone-decarboxylase-family-protein	unknown	unknown	gnl\|CDD\|130981
NZ_CP015079.1\|WP_068108178.1\|1781626_1783879_+\|cadmium-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319783
NZ_CP015079.1\|WP_068108162.1\|1775129_1775411_+\|Rho-termination-factor-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|236490
NZ_CP015079.1\|WP_068108164.1\|1775534_1776182_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NZ_CP015079.1\|WP_068108196.1\|1792471_1793089_-\|DUF47-domain-containing-protein	unknown	unknown	gnl\|CDD\|224310
NZ_CP015079.1\|WP_084527353.1\|1793205_1795416_-\|RNA-degradosome-polyphosphate-kinase	unknown	unknown	gnl\|CDD\|235469
NZ_CP015079.1\|WP_068108189.1\|1790505_1791420_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015079.1\|WP_084527352.1\|1778506_1780192_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|312032
NZ_CP015079.1\|WP_068108176.1\|1781417_1781630_+\|heavy-metal-associated-domain-containing-protein	unknown	unknown	gnl\|CDD\|238219
NZ_CP015079.1\|WP_068108184.1\|1786298_1787396_+\|phosphate-ABC-transporter-substrate-binding-protein-PstS	unknown	unknown	gnl\|CDD\|270283
NZ_CP015079.1\|WP_068108191.1\|1791468_1792470_-\|inorganic-phosphate-transporter	unknown	unknown	gnl\|CDD\|376541
NZ_CP015079.1\|WP_068108185.1\|1788478_1789564_+\|phosphate-ABC-transporter-permease-PstA	unknown	unknown	gnl\|CDD\|223654
NZ_CP015079.1\|WP_068108174.1\|1781113_1781407_+\|metal-sensitive-transcriptional-regulator	unknown	unknown	gnl\|CDD\|376835

Protein	Function_ID	Function_description	E-value
NZ_CP015079.1\|WP_068108166.1\|1776965_1777577_+\|carboxymuconolactone-decarboxylase-family-protein	gnl\|CDD\|130981	TIGR01926, peroxid_rel, uncharacterized peroxidase-related enzyme. This protein family with length of about 200 amino acids. One member, from Myxococcus xanthus, is a selenoprotein, with an otherwise conserved Cys replaced by Sec. This family is drawn narrowly enough to suggest that These proteins contain a domain described by TIGR00778, with a CxxCxxxHxxxxxxxG motif. Some members of that family are known to act as peroxidases or correlate with resistance to oxidative stress.	1.03664e-12
NZ_CP015079.1\|WP_068108172.1\|1780475_1780679_+\|cold-shock-protein	gnl\|CDD\|224197	COG1278, CspC, Cold shock proteins [Transcription].	1.01403e-36
NZ_CP015079.1\|WP_068114599.1\|1787522_1788473_+\|phosphate-ABC-transporter-permease-subunit-PstC	gnl\|CDD\|273992	TIGR02138, phosphate_transport_system_permease_protein_PstC, phosphate ABC transporter, permease protein PstC. The typical operon for the high affinity inorganic phosphate ABC transporter encodes an ATP-binding protein, a phosphate-binding protein, and two permease proteins. This family consists of one of the two permease proteins, PstC, which is homologous to PstA (TIGR00974). In the model bacterium Escherichia coli, this transport system is induced when the concentration of extrallular inorganic phosphate is low. A constitutive, lower affinity transporter operates otherwise. [Transport and binding proteins, Anions].	5.88143e-71
NZ_CP015079.1\|WP_068108168.1\|1777672_1778458_+\|crotonase/enoyl-CoA-hydratase-family-protein	gnl\|CDD\|181723	PRK09245, PRK09245, crotonase/enoyl-CoA hydratase family protein.	1.55084e-150
NZ_CP015079.1\|WP_068108182.1\|1785230_1786127_+\|NUDIX-hydrolase	gnl\|CDD\|239645	cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily. Ap6A hydrolase specifically hydrolyzes diadenosine polyphosphates, but not ATP or diadenosine triphosphate, and it generates ATP as the product. Ap6A, the most preferred substrate, hydrolyzes to produce two ATP molecules, which is a novel hydrolysis mode for Ap6A. These results indicate that Ap6A hydrolase is a diadenosine polyphosphate hydrolase. It requires the presence of a divalent cation, such as Mn2+, Mg2+, Zn2+, and Co2+, for activity. Members of the Nudix superfamily are recognized by a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which forms a structural motif that functions as a metal binding and catalytic site.	2.02222e-46
NZ_CP015079.1\|WP_068108187.1\|1789620_1790400_+\|phosphate-ABC-transporter-ATP-binding-protein	gnl\|CDD\|184587	PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional.	0
NZ_CP015079.1\|WP_068108178.1\|1781626_1783879_+\|cadmium-translocating-P-type-ATPase	gnl\|CDD\|319783	cd02094, P-type_ATPase_Cu-like, P-type heavy metal-transporting ATPase, similar to human copper-transporting ATPases, ATP7A and ATP7B. The mammalian copper-transporting P-type ATPases, ATP7A and ATP7B are key molecules required for the regulation and maintenance of copper homeostasis. Menkes and Wilson diseases are caused by mutation in ATP7A and ATP7B respectively. This subfamily includes other copper-transporting ATPases such as: Bacillus subtilis CopA , Archeaoglobus fulgidus CopA, and Saccharomyces cerevisiae Ccc2p. This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP015079.1\|WP_068108162.1\|1775129_1775411_+\|Rho-termination-factor-N-terminal-domain-containing-protein	gnl\|CDD\|236490	PRK09376, rho, transcription termination factor Rho; Provisional.	0.000104118
NZ_CP015079.1\|WP_068108164.1\|1775534_1776182_+\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	2.66662e-23
NZ_CP015079.1\|WP_068108196.1\|1792471_1793089_-\|DUF47-domain-containing-protein	gnl\|CDD\|224310	COG1392, COG1392, Phosphate transport regulator (distant homolog of PhoU) [Inorganic ion transport and metabolism].	4.84069e-30
NZ_CP015079.1\|WP_084527353.1\|1793205_1795416_-\|RNA-degradosome-polyphosphate-kinase	gnl\|CDD\|235469	PRK05443, PRK05443, polyphosphate kinase; Provisional.	0
NZ_CP015079.1\|WP_084527352.1\|1778506_1780192_+\|alpha/beta-hydrolase	gnl\|CDD\|312032	pfam08386, Abhydrolase_4, TAP-like protein. This is a family of putative bacterial peptidases and hydrolases that bear similarity to a tripeptidyl aminopeptidase isolated from Streptomyces lividans. A member of this family is thought to be involved in the C-terminal processing of propionicin F, a bacteriocidin characterized from Propionibacterium freudenreichii.	5.86535e-20
NZ_CP015079.1\|WP_068108176.1\|1781417_1781630_+\|heavy-metal-associated-domain-containing-protein	gnl\|CDD\|238219	cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain contains two cysteine residues that are important in binding and transfer of metal ions, such as copper, cadmium, cobalt and zinc. In the case of copper, stoichiometry of binding is one Cu+ ion per binding domain. Repeats of the HMA domain in copper chaperone has been associated with Menkes/Wilson disease due to binding of multiple copper ions.	2.16258e-12
NZ_CP015079.1\|WP_068108184.1\|1786298_1787396_+\|phosphate-ABC-transporter-substrate-binding-protein-PstS	gnl\|CDD\|270283	cd13565, PBP2_PstS, Substrate binding domain of ABC-type phosphate transporter, a member of the type 2 periplasmic-binding fold superfamily. This subfamily contians phosphate binding domain found in PstS proteins that serve as initial receptors in the ABC transport of phosphate in eubacteria and archaea. After binding the ligand, PstS interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The PstS proteins belong to the PBPII superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	8.29564e-74
NZ_CP015079.1\|WP_068108191.1\|1791468_1792470_-\|inorganic-phosphate-transporter	gnl\|CDD\|376541	pfam01384, PHO4, Phosphate transporter family. This family includes PHO-4 from Neurospora crassa which is a is a Na(+)-phosphate symporter. This family also contains the leukaemia virus receptor.	3.2581e-97
NZ_CP015079.1\|WP_068108185.1\|1788478_1789564_+\|phosphate-ABC-transporter-permease-PstA	gnl\|CDD\|223654	COG0581, PstA, ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism].	2.57732e-88
NZ_CP015079.1\|WP_068108174.1\|1781113_1781407_+\|metal-sensitive-transcriptional-regulator	gnl\|CDD\|376835	pfam02583, Trns_repr_metal, Metal-sensitive transcriptional repressor. This is a family of metal-sensitive repressors, involved in resistance to metal ions. Members of this family bind copper, nickel or cobalt ions via conserved cysteine and histidine residues. In the absence of metal ions, these proteins bind to promoter regions and repress transcription. When bound to metal ions they are unable to bind DNA, leading to transcriptional derepression.	4.93484e-32

>NZ_CP015079.1|WP_068108178.1|1781626_1783879_+|cadmium-translocating-P-type-ATPase
MTTTPAPTQHPTDRQGDVELAITGMTCASCANRIERKLNKLDGVDATVNYATEKAHVVFTSAISTDLLLDTVAKAGYAATVPDPAADHDEAAAHAELDALRRRLVVSAMLAVPVIALAMVPPWQFDRWAWVSLVLATPVVVWGAWPFHRAAAINLRHGTTTMDTLVSVGVSAAYLWSVVALVFGEAGMPGMTHEFSLALQRGDGLSDVYLEVAAGVTTFLLAGRWFEKRSKRRAGAALEALLTMGAKEVAVLRDGVETPVPAEQLRVDDVFVVRPGEKVATDGEVVEGASAVDVSMLTGEPVPVDVGPGDTVTGATVNTSGRLVVRATRVGADTQLAQMARLVEQAQQGKAQVQRLADRVSGIFVPVVIVLSLLTLAGWLLSGATTTTAFAAAVAVLIIACPCALGLATPTALMVGTGRGAQLGILIRGPEILESTRRVDTIVLDKTGTVTTGRMSLVDVVAHGATDDEVRRVAAALEHGSEHPIARAVAEAAPRAEHPEVSGFANREGLGVVGDVAGRRTLVGRPALLEAEGLVVPTELAEALDAAQAQGRTPVLVGWDGAARGVLVVSDTVKPTSAAAVARLRELGLEPVLLTGDHERAARAVAAEVGITTVVADVLPAGKVDEVRRLQESGRVVAMVGDGVNDAPALAQADLGIAMGTGTDVAIEAADLTLVSGDLRVAGDAVALSRRTLSTIRGNLFWAFAYNVAALPLAALGLLSPMIAGLAMALSSVFVVSNSLRLRRFRSSIA
>NZ_CP015079.1|WP_068108176.1|1781417_1781630_+|heavy-metal-associated-domain-containing-protein
MSTHTSTWTVTGMTCGHCVASVTEELSEVAGVESVDVTLETGAVVVTSTGPLERATVEQAVSEAGYTLQS
>NZ_CP015079.1|WP_068108174.1|1781113_1781407_+|metal-sensitive-transcriptional-regulator
MADHQHGYLHRKDDYLARLRRIEGQARGLQRMVEEEQYCIDILTQVSAMTKALQSVSLGLLDEHMHHCVADAARQGEDEGRAKIDEAVAAITRLVKS
>NZ_CP015079.1|WP_169834675.1|1780874_1781036_+|hypothetical-protein
MHDQFDVSLEDSDLLGEVELTTNLIIAASESEEHLSEIEIDEILGVPEPRDAI
>NZ_CP015079.1|WP_068108172.1|1780475_1780679_+|cold-shock-protein
MAQGTVKWFNAEKGFGFIAQEDGGDDVFVHYSAIQTQGYKSLDENQKVEFDVTQGPKGPQAENVRAV
>NZ_CP015079.1|WP_084527352.1|1778506_1780192_+|alpha/beta-hydrolase
MTSSSPRRAVAFVAALAVSVPLLASLAVAPAVSVAPPLAPLLAPPGVGAAASAPRADLPRIRWRDCGRRIDCGRVDAPLDYDKPDGATVGLNLLRVRARKQARRVGAIFVNPGGPGGAAADFAPYAASQMFDRKIRNRFDVIGIDPRGVGGSQGLYCRGRSTASYPAFAFPDTRHQIRVWRAFDAAEHRLCAGKRIVDHMSTADTARDMDLVRRILGDEQASFYGASYGSVLGATWASMFPDTVRAAVVDGVLDPVAWTTGRDLADGTPGSSLPSSGRLGSEVGAREGLAAGLAECDAAGRQDCRLAGDALARWDAVAARLRSDKQAARAIGFSYSDFVGTTLGLLYGGDLDLIARITFRAEKQLARTAGRPATGEPAQGDGSLRRLVREARQDLADSPFPGPYAASGAARRPAKRLYVDGSFHGVLCTDGLNPTDPQAWVENAERTRAAGGADFGPLWSWASSACAGWPGSAADAYRGPFEMPDAQRLLLVSNRYDPATPLSGALALQRLMPGSRLVVTQDTGHVATGTNKCATAAVRDFLRTAQAPAEDVACGRSRSPF
>NZ_CP015079.1|WP_068108168.1|1777672_1778458_+|crotonase/enoyl-CoA-hydratase-family-protein
MSDPLLVERDGHVETWTINLPETRNAISGPDVVEAFMTHTARVDRDDDVRCIILTGAGSAFSAGGNVHEMAERRGMFSGAPYEQRNGYRHGIQQIPLALRRCEVPMIAAVNGPAVGAGCDLAMMCDLRIASEKAFFAESFVQLGIIPGDGGAWFLTRAIGPARAAEMALTGDRVDAATALEWGMVSRVTTPEDLMDAARELAQRVAKNPTHATRMAKKLLQESQQRDLEGVLELSAAMQAIAHHTQAHTDAVQAFVERTRR
>NZ_CP015079.1|WP_068108166.1|1776965_1777577_+|carboxymuconolactone-decarboxylase-family-protein
MPRIEPLRREDLPQHARTFAAVEQALGVLPNSTLTMARWPELMEAFASLNAVIMGSGRVSPVLKQMVASMVSSAAGCSYCQAHTSHVAEKRGADEEKLAHLWEFETSEHFSAAERAALRVAHGAGCVPNAVTDEDMAALRQHFSDDEVVELVAVMANFGFLNRWNDTMSTELERSPLLWAREKLSGAGWEAGAHAPAEDDLTP
>NZ_CP015079.1|WP_068108164.1|1775534_1776182_+|response-regulator-transcription-factor
MSNSRPVRVALIDNFEVSVAGLRALLAPFSGRVTLLELRTAMNKPSAVDVILYEPVRQSPTSQAMLRDLVRASQKQAVVYSWRDQDGALRGSFAGHLSKALPVADLVSALEALHDGGEATVRRRMPADPGPLSIVARSSVEDFELTPREAEILALVTQGLTNSEIGAQLYLSINSVKTYIRAAYRKIEVTRRAQAVAWGMEHGLAPLSEHELVPG
>NZ_CP015079.1|WP_068108162.1|1775129_1775411_+|Rho-termination-factor-N-terminal-domain-containing-protein
MAKDTSDQDPGPSVKDDELYEKLRDEGNSKEKSARIANAAAASSRSEVGSRGGSSPAYEEWTVEELHERAAELEIEGRSTMAKDELIEALREH
>NZ_CP015079.1|WP_068108180.1|1784055_1785183_-|hypothetical-protein
MAEPSSSPQRRVRPLVVAVVVVALTLLVIAVLAGAARWWRGPDTDLERAVALAPADTQRWTWTDWAGVRERLGVEGSGPDAVRRLVDAGFDADLTSTSGLVESAPLLEQALGWSPLDIEWELLAQSDLGALELVGLGEDADTDALGDRLEAVGYTRPDSPDGVWEGGEEVLARLNAGSGLTGTPTLQFIAFDEERSLVLTSDTQRYLEQALEEAAEEHEPTAAGVTDVLDTLPTQPLSAVLMTGEQACGALSMGQAGASDQAAADELLAQAGSVNPVTGFVLALLPAADDAGRDAPLDLRVGLGFESEEQARTNADTRATLAAGPAPGQGGDFSDRFTVDEVSADQRTVTLDLAPVDGAYVVSDLSSGPVLLATC
>NZ_CP015079.1|WP_068108182.1|1785230_1786127_+|NUDIX-hydrolase
MAAAPSLTRDVHAAGAVVFRPGREVLLVHRERYDDWSFPKGKVDPGEHPVATAVREVEEETGLRVSLGRPLPSHRYPNARAMKTVHYWTGRVVGADDVSGFEPNAEISDVRWVPVDEAAALLSYERDQALLQTARASRRRTQALVVQRHSRACARSEWTDDDRLRPLERPGLLQAEALGPLLAAYDVRRLVTSPATRCRETLAPYAATAGVDLEPLEELTEEAATGRGGPAAVAAAVTGLVDDLHAGRRGIVLCTHRPVLPMVFEALGVDDPGLAPGEMVVVHLRRGRVLATEQHLPH
>NZ_CP015079.1|WP_068108184.1|1786298_1787396_+|phosphate-ABC-transporter-substrate-binding-protein-PstS
MTSTSIRRAIVPGIAALALALSACGAANEQSGAADAGGELSGTLAGGGASTQQAAMGAWAVGFQGTHPDVTIEYDPIGSGGGRENFISGAFPYAGSDAYLSDNEGELSAATERCSGDVPIQVPSYISPIAVAYNLPGVDELHLSPQALAGIMAGTITEWDDQAIAADNEGVDLPAERINAVHRSDESGTTENFTDYLTTVAPDEWDAGVVETWPTEYGGEGAKGTSGVVQTVANSEFSVGYADASQTADLGKALIGVGDDFVEPSAEAAAKILEASPEAENASDTAVIYDLDFATEEAGTYPIVLTSYLMACQTYDDAADGELVKAFMEYVVSDEGQDQAAAEAGSAPLSDTIQEQALAIIESIG
>NZ_CP015079.1|WP_068114599.1|1787522_1788473_+|phosphate-ABC-transporter-permease-subunit-PstC
MTTEPRADAAATPLDQSTGRVGDAVFAGLARGSGLLIMMALAGVAIFLVVQGSGALGSTGDAVYGKDSIWAYVWPLLFGTLLASVIAMVIAAPLAIGVALIISHYAPRPIAKTLGWLIDLLAAIPSIVYGLWGINFVALNLVPAYDWLMRWFSWLPFFEGPVPNSGRTMLTAGIVLAVMALPIITAICREVFAQTPKMHQEAALALGATRWEMIRMTVFPYARSGMISAVLLGLGRALGETMAVALVLAPSLLVSFNLITAESSSSTIAANIALNFGNASGAKIETLIFTGLVLFIITFAVNFLGRAVATRGVAKG
>NZ_CP015079.1|WP_068108185.1|1788478_1789564_+|phosphate-ABC-transporter-permease-PstA
MNDTTTPLEDVSHVPHTSMPLQGAQLPRYAPALAAVIALGIGALLALLAGFGPVAALSVAWLLLAVGLPAWSRAVEGSRKAADRVAGVLVWSAFALAMIPLVSLVWTVVTKGLPILSSQFFQNSMRGILGEGGGIYHAIVGTLIITALATVISVPIGVLTAIYLVEYGKGSKLARVITFLVDVMTGIPSIVAGLFAYALFVIFFGPGVRMGFGGSVALSVLMVPIVVRAAEEMLKLVPDELREAAYALGVPKWRTIVKVVLPTAVAGIVTGVTLAVARVAGETAPLLVIAGLTTGTNFNPFSERMATLPVYIFYAVTEPGIYDEEMTAYAWGAALTLVTLVMLLNVAARLIGGLFAPKTGR
>NZ_CP015079.1|WP_068108187.1|1789620_1790400_+|phosphate-ABC-transporter-ATP-binding-protein
MAKSIDVSDLNIYYGDFLAVEGVSMTIKARSVTAFIGPSGCGKSTFLRSLNRMHEVIPGARVEGKVMVDGQSLYDASVDPVAVRRQIGMVFQRPNPFPTMSIYDNVLSGKKLNAKRMKKSEADDLVEKSLRGANLWTEVKDRLGKPGMGLSGGQQQRLCIARAIAVEPQVLLMDEPCSALDPISTSAIEDLIHELKSDYTIVIVTHNMQQAARVSDDTGFFNLRATGEPGQLVEFNPTRKMFTNPDNESTEAYISGRFG
>NZ_CP015079.1|WP_068108189.1|1790505_1791420_+|hypothetical-protein
MPAYVDTTPAQRVAEVGVLLRGTAAVTGWGALTWRGARWFDGLTVDGTPLPVPVVAPTRRLRPQPCLELHEERLPATDVECRDGLRVTTALRSVVSVLRHAGDLDAAVSALEMAYCNDLVSPDEVAGWLAAHPGVPGVVQARAALDLADQNSWSPMEWTLRRLWTERFGSARLLTNRPVFDHSGRHVATPDVIDADTGVSGEYDGVAHHGGARRAKDLRREADLRRVGVEPVVMVAADAHRRTAFWARLEDAYARARRTSASDRAWTLEPPHWWRSTHTVDLRRSLEGTEREVWLGGRSARPSS
>NZ_CP015079.1|WP_068108191.1|1791468_1792470_-|inorganic-phosphate-transporter
MTLAIVIAVVVVALVFDYTNGFHDAANAIATSVSTRALTPRVALAMAAVMNFIGAFLGQEVANTVGSVISPAAGTHGLVIVMAGLLGAIAWNLLTWYYGLPSSSSHALIGGLVGAAIASGSAVKWDVIVDKILLPMVASPLFGFAAAFVLMVAIMWIFRRRNPHRTQRGFRIAQTLSAAAMALGHGLQDAQKTMGVIFLALVTGGYYAADDGLPVWVILAAAAAISAGTWAGGWRIMRTLGRRIIALDPARGFASETVAAGVLYTTAFVFEAPISTTHTITSAVMGAGATKRFSAVRWGVARSIVAAWVLTFPAAGLMAASLYWICRYVFQLP
>NZ_CP015079.1|WP_068108196.1|1792471_1793089_-|DUF47-domain-containing-protein
MGLRFRPVETTFYDQFTQAAQHLVVGAGLLAEMLAEGADEEAIAQRMRDAEHQADETTHAIVKLVNSTFVTPFDREDIYSLASGLDDVMDMMDEVVDMVLLYEPKMLPAALLDQVELLQRCAELTAAVMPRLRSMQSLGEYWIEINRLENAGDRNHRRIIANLFSGEFKAMEVLKLKDIAEALEGSIDAFEKVANIVEQIAVKES
>NZ_CP015079.1|WP_084527353.1|1793205_1795416_-|RNA-degradosome-polyphosphate-kinase
MPAVPPDTAAVDAPDVAEDPTALEELEGLVGPGDDEAPYVPDEEALAAVQAHDDRFLDRELSWLHFNQRVLELAEDRDLPLLERVRFLAIFTSNLDEFFMVRVAGLKRRIATGLAVRAASGLMPREVLERIWTTARDLSERQAALFRDEIVPALAEEGVELVRWDDLDRDEQKQCKRMFKDRIFPVLTPLAVDPAHPFPYISGLSLNLAVMVRNPKTGKEHFARVKVPPSFSRFVPLGNHRFVPLEDVIREHLKKLFPGMEVLEVHSFRVTRNEDLEVEEDDAENLLAALEKELLRRRFGPPVRLEVEESIAPTVLELLMEELGVTRDEVFHLPGPLDLRGLHGLADIGREELKYPAFVPTTHKLLAEVESAAPVDVFKAARRHDVLLHHPYDSFATSVQRFIEQAAADPHVLAIKQTLYRTSGDSPIIDALIDAAEAGKQVLVIVEIKARFDEQANIRWARKLEQAGCHVVYGLVGLKTHCKLSMVVRDEGEGQGGIRRYTHIGTGNYNPKTSRTYEDLGLITTDEKIGEDVAHLFNNLSGWSRNASYDELLVAPDAVRPGLVEQVHREIGHHRAGRPARIRIKANSVVDEGVIDALYLASQAGVPVEMLVRGTCALRPGVPGLSEHITVRSVLGRFLEHSRVFWFENGGDPVAWIGSADLMHRNLDRRVEVLVRLPDPACIELVRELLDLAFDPDTQAWELGSDGYWTRNGGGVHLQEALIERQRRRRHTIAAG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP015079_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015079_5

1965472-1965556

Orphan

Consensus_repeat	Method
CGGTTTCCCCGGGTACCCGGGGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015079_5

>merge|NZ_CP015079|5|1965472-1965556|CRISPRCasFinder
CGGTTTCCCCGGGTACCCGGGGATTCCGTAGGCGTTGGGGTGTTGCAACACCCGAACGCCTCCAGTTTCCCCGGGTACCCGGGGA

>NZ_CP015079|5|5|1965472-1965556|CRISPRCasFinder
CGGTTTCCCCGGGTACCCGGGGA	TTCCGTAGGCGTTGGGGTGTTGCAACACCCGAACGCCTC
CAGTTTCCCCGGGTACCCGGGGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015079.1\|WP_068108585.1\|1967996_1968884_-\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
NZ_CP015079.1\|WP_068108580.1\|1966246_1967026_+\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|184509
NZ_CP015079.1\|WP_068108553.1\|1954888_1956799_-\|glycoside-hydrolase-family-13-protein	unknown	unknown	gnl\|CDD\|200477
NZ_CP015079.1\|WP_068108566.1\|1961896_1962766_+\|16S-rRNA-(adenine(1518)-N(6)/adenine(1519)-N(6))--dimethyltransferase-RsmA	unknown	unknown	gnl\|CDD\|234708
NZ_CP015079.1\|WP_179948575.1\|1970539_1971268_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224051
NZ_CP015079.1\|WP_068114644.1\|1967614_1967857_+\|metal-sensitive-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197385
NZ_CP015079.1\|WP_068108591.1\|1969596_1970478_-\|glutamate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270408
NZ_CP015079.1\|WP_068108557.1\|1956872_1957586_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|212491
NZ_CP015079.1\|WP_068108599.1\|1973049_1974573_+\|tRNA-(N6-isopentenyl-adenosine(37)-C2)-methylthiotransferase-MiaB	unknown	unknown	gnl\|CDD\|237674
NZ_CP015079.1\|WP_084527386.1\|1960483_1961776_+\|resuscitation-promoting-factor	unknown	unknown	gnl\|CDD\|226111
NZ_CP015079.1\|WP_068108588.1\|1968880_1969531_-\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
NZ_CP015079.1\|WP_068108582.1\|1967025_1967424_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319909
NZ_CP015079.1\|WP_068108559.1\|1958574_1959435_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|235628
NZ_CP015079.1\|WP_068108572.1\|1963670_1965464_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP015079.1\|WP_169834745.1\|1971379_1972927_-\|CehA/McbA-family-metallohydrolase	unknown	unknown	gnl\|CDD\|213987
NZ_CP015079.1\|WP_068108577.1\|1965576_1966062_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP015079.1\|WP_068114642.1\|1957753_1958578_+\|16S-rRNA-(cytidine(1402)-2'-O)-methyltransferase	unknown	unknown	gnl\|CDD\|223390
NZ_CP015079.1\|WP_068108562.1\|1959431_1960313_+\|TatD-family-hydrolase	unknown	unknown	gnl\|CDD\|238635
NZ_CP015079.1\|WP_068108550.1\|1953653_1954865_-\|DUF4032-domain-containing-protein	unknown	unknown	gnl\|CDD\|379077
NZ_CP015079.1\|WP_068108569.1\|1962762_1963671_+\|4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol-kinase	unknown	unknown	gnl\|CDD\|235110

Protein	Function_ID	Function_description	E-value
NZ_CP015079.1\|WP_068108585.1\|1967996_1968884_-\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	1.7885e-50
NZ_CP015079.1\|WP_068108580.1\|1966246_1967026_+\|methyltransferase-domain-containing-protein	gnl\|CDD\|184509	PRK14103, PRK14103, trans-aconitate 2-methyltransferase; Provisional.	1.08687e-93
NZ_CP015079.1\|WP_068108553.1\|1954888_1956799_-\|glycoside-hydrolase-family-13-protein	gnl\|CDD\|200477	cd11338, AmyAc_CMD, Alpha amylase catalytic domain found in cyclomaltodextrinases and related proteins. Cyclomaltodextrinase (CDase; EC3.2.1.54), neopullulanase (NPase; EC 3.2.1.135), and maltogenic amylase (MA; EC 3.2.1.133) catalyze the hydrolysis of alpha-(1,4) glycosidic linkages on a number of substrates including cyclomaltodextrins (CDs), pullulan, and starch. These enzymes hydrolyze CDs and starch to maltose and pullulan to panose by cleavage of alpha-1,4 glycosidic bonds whereas alpha-amylases essentially lack activity on CDs and pullulan. They also catalyze transglycosylation of oligosaccharides to the C3-, C4- or C6-hydroxyl groups of various acceptor sugar molecules. Since these proteins are nearly indistinguishable from each other, they are referred to as cyclomaltodextrinases (CMDs). The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.	5.8388e-139
NZ_CP015079.1\|WP_068108566.1\|1961896_1962766_+\|16S-rRNA-(adenine(1518)-N(6)/adenine(1519)-N(6))--dimethyltransferase-RsmA	gnl\|CDD\|234708	PRK00274, ksgA, 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase RsmA.	1.98346e-114
NZ_CP015079.1\|WP_179948575.1\|1970539_1971268_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	1.89198e-155
NZ_CP015079.1\|WP_068114644.1\|1967614_1967857_+\|metal-sensitive-transcriptional-regulator	gnl\|CDD\|197385	cd10148, CsoR-like_DUF156, Transcriptional regulators CsoR (copper-sensitive operon repressor), RcnR, and FrmR, and related domains; this domain superfamily was previously known as DUF156. This superfamily includes various transcriptional regulators that respond to stressors including Cu(I), Ni(I), sulfite, and formaldehyde. It includes CsoR (copper-sensitive operon repressor) from Mycobacterium tuberculosis (MtCsoR), Bacillus subtilis (BsCsoR), Thermus thermophilus (TthCsoR), and Staphylococcus aureus (SaCsoR), Mycobacterium tuberculosis RicR (regulated in copper repressor, MtRicR), Escherichia coli RncR (formally known as YohL, nickel and cobalt-sensitive), Alcaligenes xylosoxidans NreA (nickel-sensitive), E. coli FrmR (formally known as YaiN, formaldehyde sensitive), and Staphylococcus aureus CstR (CsoR-like sulfur transferase repressor, NWMN_0026.5, SaCstR). CsoR is Cu(I)-inducible, and regulates the expression of genes involved in copper homeostasis. For example, TthCsoR binds the promoter region of the copZ-csoR-copA operon, and represses expression of these genes, which encode the copper chaperone CopZ, CsoR, and the copper efflux P-type ATPase CopA, respectively. In the presence of excess Cu(I), TthCsoR binds this ion, and is released from the DNA, allowing expression of the downstream genes. TthCsoR also senses other metal ions such as Cu(II), Zn(II), Ag(I), Cd(II) and Ni(II). CsoRs form a homotetramer (dimer of dimers). In the case of MtCsoR, two Cys residues on opposite subunits within each dimer, along with a His residue, bind the Cu(I) ion. These residues are conserved in the majority of members of this superfamily. Exceptions include the functionally uncharacterized Bacillus subtilis YrkD where there is an Asn instead of His (C-N-C), E.coli RcnR where there is a Thr instead of the second Cys (C-H-T), or TthCsoR and E.coli FrmR where there is a His instead of the second Cys and which have an additional N-terminal His (not found in those family members having C-H-C) that may also be involved in metal binding (H-C-H-H). A conserved Tyr and a Glu residue facilitate allosteric regulation of DNA binding. SaCstR regulates genes predicted to function in sulfur metabolism; it is thought that oxidation of the intersubunit Cys pair to a mixture of disulphide and trisulphide linkages by sulfite, results in a reduced affinity of SaCstR for the operator DNA. SaCstR exists as a mixture of oligomeric states, including dimers, tetramers and octamers. The sequence of SaCstR was not available at the time this hierarchy was curated and therefore was not included. Escherichia coli RncR represses expression of the gene encoding the nickel and cobalt-efflux protein RcnA. The gene encoding Alcaligenes xylosoxidans NreA is part of the nre nickel resistance locus located on the pTOM9 plasmid from thisbacteria. Escherichia coli FrmR regulates the formaldehyde degradation frmRAB operon.	1.07257e-15
NZ_CP015079.1\|WP_068108591.1\|1969596_1970478_-\|glutamate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270408	cd13690, PBP2_GluB, Substrate binding domain of ABC glutamate transporter; the type 2 periplasmic binding protein fold. This group includes periplasmic glutamate-binding domain GluB from Corynebacterium efficiens and its related proteins. The GluB domain belongs to the type 2 periplasmic binding protein fold superfamily (PBP2), whose many members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	8.16038e-77
NZ_CP015079.1\|WP_068108557.1\|1956872_1957586_+\|SDR-family-oxidoreductase	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.53639e-63
NZ_CP015079.1\|WP_068108599.1\|1973049_1974573_+\|tRNA-(N6-isopentenyl-adenosine(37)-C2)-methylthiotransferase-MiaB	gnl\|CDD\|237674	PRK14326, PRK14326, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional.	0
NZ_CP015079.1\|WP_084527386.1\|1960483_1961776_+\|resuscitation-promoting-factor	gnl\|CDD\|226111	COG3583, COG3583, Uncharacterized protein conserved in bacteria [Function unknown].	6.11825e-57
NZ_CP015079.1\|WP_068108588.1\|1968880_1969531_-\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	1.81687e-50
NZ_CP015079.1\|WP_068108582.1\|1967025_1967424_+\|VOC-family-protein	gnl\|CDD\|319909	cd07245, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	3.93668e-17
NZ_CP015079.1\|WP_068108559.1\|1958574_1959435_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|235628	PRK05855, PRK05855, SDR family oxidoreductase.	1.01744e-31
NZ_CP015079.1\|WP_068108572.1\|1963670_1965464_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	1.56339e-169
NZ_CP015079.1\|WP_169834745.1\|1971379_1972927_-\|CehA/McbA-family-metallohydrolase	gnl\|CDD\|213987	cd07432, PHP_HisPPase, Polymerase and Histidinol Phosphatase domain of Histidinol phosphate phosphatase. HisPPase catalyzes the eighth step of histidine biosynthesis, in which L-histidinol phosphate undergoes dephosphorylation to produce histidinol. HisPPase can be classified into two types: the bifunctional HisPPase found in proteobacteria that belongs to the DDDD superfamily and the monofunctional Bacillus subtilis type that is a member of the PHP family. The PHP (also called histidinol phosphatase-2/HIS2) domain is associated with several types of DNA polymerases, such as PolIIIA and family X DNA polymerases, stand alone histidinol phosphate phosphatases (HisPPases), and a number of uncharacterized protein families. The PHP domain has four conserved sequence motifs and contains an invariant histidine that is involved in metal ion coordination. The PHP domain of HisPPase is structurally homologous to other members of the PHP family that have a distorted (beta/alpha)7 barrel fold with a trinuclear metal site on the C-terminal side of the barrel.	5.58038e-17
NZ_CP015079.1\|WP_068108577.1\|1965576_1966062_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	3.77069e-17
NZ_CP015079.1\|WP_068114642.1\|1957753_1958578_+\|16S-rRNA-(cytidine(1402)-2'-O)-methyltransferase	gnl\|CDD\|223390	COG0313, COG0313, Predicted methyltransferases [General function prediction only].	7.22403e-107
NZ_CP015079.1\|WP_068108562.1\|1959431_1960313_+\|TatD-family-hydrolase	gnl\|CDD\|238635	cd01310, TatD_DNAse, TatD like proteins; E.coli TatD is a cytoplasmic protein, shown to have magnesium dependent DNase activity.	1.13369e-93
NZ_CP015079.1\|WP_068108550.1\|1953653_1954865_-\|DUF4032-domain-containing-protein	gnl\|CDD\|379077	pfam13224, DUF4032, Domain of unknown function (DUF4032). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, and is approximately 170 amino acids in length. The family is found in association with pfam06293.	3.14278e-83
NZ_CP015079.1\|WP_068108569.1\|1962762_1963671_+\|4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol-kinase	gnl\|CDD\|235110	PRK03188, PRK03188, 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional.	3.31158e-115

>NZ_CP015079.1|WP_068108572.1|1963670_1965464_+|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MAAPQNLLNLERVSKSYGVRPLLTDVSLGIAEGERIGIVGRNGDGKTTLLEVMTGLEEPDSGRVSMSRGLHVGYLHQGDELTDTHTVREAVLGGMDDHEWAADYRTREVVEELLAGVSLDRPVLGLSGGERRRCSLAALLLGEHDLIVLDEPTNHLDVEAVAWLARHLKKRPSAMVVVTHDRWFLDEVCQWTWEVHDGVVDAYEGGYAAHVLAKAERTRQASASEARRQNLAKKELAWLRRGAPARTAKPKFRIEAANALIEDVPPPRDRLELQKFATQRLGKQVIDVEHVDLQRGERTLLTDATWRLGPGDRVGLVGVNGAGKTSVLAMLAGDLAPSAGKVKHGRTISMRHLTQQLDDLDPNARVLPMVESYRRVVKTDGGEISATSMLERFGFTGDKLTARIGELSGGERRRFQLLMLLLEEPNVLLLDEPTNDLDIDTLNVLEDFLDAWPGTLIVVSHDRYFLERVTDSVWALLGDGQISMLPRGVDEYLERRAQGAASGSVTGGGGGVGASDVPASKRAKPGSAEERAARKAVTRVEKAMKRLDAREAELNALVLEHAQDHAKVATLGKELSTLAAEKDELELEWLEASELLE
>NZ_CP015079.1|WP_068108569.1|1962762_1963671_+|4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol-kinase
MSLTVRAPAKINLHLGVGALGADGYHPLATLYQAVGLYDDVTVEEQLEWSVHLRGDGRIDLGEVPSGDDNIALRAGRALAAHHGLDRAAKVEIRKGIPVAGGMAGGSADAAATLVALDRLWDLQTPDDDLLRLAAGLGSDVPFALVGGTALGSGHGELVTPVADHGSWWWVVVEDDAGLATPGVYRAFDELHAGRDVPTPEIPSALYDALADGDVEQLARLLRNDLQEPALRLRPDLATTFDDALAAGAHAALLSGSGPSVLLLCADRDQAEGVEAELAERGHRRTSVVPAPVAGAHVVEYV
>NZ_CP015079.1|WP_068108566.1|1961896_1962766_+|16S-rRNA-(adenine(1518)-N(6)/adenine(1519)-N(6))--dimethyltransferase-RsmA
MTDTSAGPRLLGPAEVRQLAAELDLRPTKQRGQNFVIDPNTVRRIVRESGVGADDVVLEVGPGLGSLTLALLEVSGRVVAIELDPLLAGRLPRTIAEHAPAQADRFEVVLGDAMRVTEVPGPAPTALVANLPYNVSVPVLLHLLALLPSLERGLVMVQSEVADRLAARPGSKVYGVPSVKAAWYADVRRAGAIGRTVFWPAPNVDSGLVAWTRRDPPQTTATREQVFAVVDAAFSQRRKALRGVLRALAPAVEVDAALEQAGVAPLTRGETLEVGDYVRIAEALAQVAR
>NZ_CP015079.1|WP_084527386.1|1960483_1961776_+|resuscitation-promoting-factor
MVPPVPLVASTIVARHSRHSSTTHDSGAARTGRRRGLRPGQLRPWRTVRRINTLVSTAARSRVWLVSLSAVVVLAVAGTTLGYSAMADTVTLTVDGEERQLDARAATVGDVLADEGIEIGEHDQVAPSLGEPIEDGSEISVRYGRPLDLTVDGKTETHWVTATDVDSALAQIGRGFDGAELSLSRGGELDRSGAELDVVTPKKLTLVVAGKKPVKKTMTASTVEDALEELGVKVDKLDEVKPGFDKRVRNGDKIVFTDVRKVTRKMTESIAFGTVERNDSSMFEGEDEVAREGRAGARSATYRVTLRNGQVANRTLLSATVTRKPVDRVVEVGTKERPTAPAAPAANYAGGSSVWDSLAQCESGGNWAINTGNGYYGGLQFNLQTWRAYGGTGYPHTNSRETQIAVATRLRDANGGYGAWPSCSSKLGLR
>NZ_CP015079.1|WP_068108562.1|1959431_1960313_+|TatD-family-hydrolase
MSTPATAPREDLPPVPEPLPHPVVDNHCHLDMGRGDAPALPVEEALVAAAAVGVTRIVQIGCDLPGARWAVQAAATYDALVASVALHPNEAPRLAAAGRLEAALAEIEQLAGAHPGVRAVGETGLDHFRTGEEGRAAQVESFRRHIDLAKRLDKTLVIHDRDAHDEVLAVLDEEGAPERWVMHCFSGDAEFARRCLDRGAHLSFAGTITFKNADPLREALALVPGERLLVETDAPYLTPMPHRGRTNASYLVPLTVRTMAEVRGDDLAELCAGIDAATEQAFGGTWGAAASSI
>NZ_CP015079.1|WP_068108559.1|1958574_1959435_+|alpha/beta-fold-hydrolase
MSGLPPRPLPARITSYRHDGLEFDVVDEGPLDGDVVVLLHGFPERASSWHQVAARLHAHGLRTLAPDQRGYSPGARPPRRRDYRLSLLTADVVALIERVGGPVHLVGHDWGAIVAWSLTQARPDQVRTLTAFSVPHPRALARSMRSSRQPLRSWYVGAFQVRGLAERVLAHPRLAARILTRAGMDADDLAHFERGIVAHGALRGGLMWYRALGLVDRDRSARHVTVPTTLVWSDGDSFLDRDGAERTEEYVDAPYELVVLAGVTHWIPSQAPDAAAEAVLERITGT
>NZ_CP015079.1|WP_068114642.1|1957753_1958578_+|16S-rRNA-(cytidine(1402)-2'-O)-methyltransferase
MLVLAATPIGQAGDAPPRLAAELSGADVVAAEDTRRLRRLTTDLGIELSGRVVSYFEGNEVARTPTLLEALQAGQRVVLVTDAGMPSVSDPGYRLVAAAVEVGIRVTAVPGPSAVLTALAVSGLPVDRFCFEGFLPRKAGERARRLDSLAAEERTMVFFEAPHRTEAALAAMATSWGEDRVAAVCRELTKTHEEVRRGPLGELVAWAGEGVRGEVTIVVTGADPTAALSTEPAALVAAVTEREEEGMSRKEAIAEVARLAGVPKREVYQLVHVP
>NZ_CP015079.1|WP_068108557.1|1956872_1957586_+|SDR-family-oxidoreductase
MSNRVVVITGAASGIGFATAERFRDLGDTVFGLDIAPTVPDGVTYVACDVGDKTAVDAAIATCAAAGRIDVLANVAGIVQFGRFETISEDLFDRVQAIDLKGPFFLMQAALPHLRASRGCVVNVSSVAGRVPQPYAAAYAAAKGGLTALTRSLALELSPDGIRVNAVCPGAVDTPLIARVAENYPTDLDPRVSDRLLAMLPGPASSADEIASSVVYLASADARMMTGAVLAHDGGMS
>NZ_CP015079.1|WP_068108553.1|1954888_1956799_-|glycoside-hydrolase-family-13-protein
MSSTSPGATPSLLHEPHHDGSVLYLDPEAPAPGWPVRVRLRTWVGDPVEAVWLRTSYDAEPVFHRCAEVGRDDSADGQGSVWWEGELPVHNPVTHYRFLIAGPDGTQRWLGAAGVVDHDPPDALDFRVTSHAPPPEWGREAVVYQVFPDRFARSAAADERPVPAWAVPAAWDDEVVFEGSDPRTPLQYFGGDLDGVTEHLDHVVELGATVLYTTPVFPGESNHRYNASTFDGVDPLLGGDDAYARLSAAVHERGLRLLGDLTTNHTGDTHEWFRSAVAEPDGPTRGWYCFRADGSYECWMGHHTLPKLDHTDPGLRAAMTEGPDSVVARWLRAPYDVDGWRIDVANMTGRLGATDVAHDVARTVRATAHAERPDALVIGEHNHDASQDLDGDGWHGTMNYSGFSWPVWSWLRDPASPARAFGRPLPVPRRPGALVQRSMREWVARHGWRATTWSWNILGSHDSSRIRTLTGSPEVHRVAAGLQFTLPGVPMVFAGDEIGLEGVNGEDARRTMAWDSPEGWDRTTMQVYADLARVRSEHPALVRGGLRWAHVDDDTLVFVREHPAGSVLVCARRAPGGAVELPAAALAQPTHDGAPARPVGEPEPLLATAGAPRALVVRDGVLGVPAGGVGVELWRL
>NZ_CP015079.1|WP_068108550.1|1953653_1954865_-|DUF4032-domain-containing-protein
MALRIVASRPDPAILTLPWSTPLEDWGDEHTVPLPRGLSRHVVRIVQLRERVYAVKETVEEIAVREYRLLRDLQRMGMPSVVPQGVVAGRVDADGEPLPAALITQHLRFSLPYRSLFSHGAGREDLPSLIDALVVLLVRLHLADFYWGDVSLSNVLFRRSAGGFAAYLVDAETGELRPSLSRQMREYDVTVATENVFAELLDLQASSTGPNEIDPHEVVTLLQRRYDELWSELTGHEEFSSGEMWRLERRIERLNDLGFDVDELDIVTDYDGDQVRIQPKVVEAGHHRRELQSLTGLDVEDAQARRLLNDLAAFTAHHDLGREDRQLVANRWFTRVYEPLTAMIPPESRGKLEPAEFFHEVLVHRWYLSERAERPVDIFDTARDYIDTVLATRPDEALATDPE
>NZ_CP015079.1|WP_068108577.1|1965576_1966062_-|MarR-family-transcriptional-regulator
MRDEVDELVEAWARERSDLDLGPVEVFSRISRLARYLDLARRAAFSAQGVESWEFDVLAALRRAGTPYELSPGRLLRETLVTSGTMTNRVDRLVTRGFVERLPDPADRRGVKVRLTPEGKATVDRAFTALIEAERGFLADLPTHDRERLGDLLRTLLTPFR
>NZ_CP015079.1|WP_068108580.1|1966246_1967026_+|methyltransferase-domain-containing-protein
MTHSWDPQHYLTYADERGRPFVELLGRVGAEAPRTVVDLGCGPGNLTALPAQRWPDAEVRGLDSSAAMVEAARRDVPHVEVERADLREWLAAGGASVDVLVSNATLQWVPGHLDLLPALLERVAPGGWLALQVPANFDEPSHTIRAELAAEPAYAAHTQGVAVPASHDPATYLDALARLGARVDAWETTYLHVLTGDDPVFEWVSATGARPTLQALPDDLRPGFEAELRRRLRAAYVPGPAGVVLAFRRVFVVAQKAGA
>NZ_CP015079.1|WP_068108582.1|1967025_1967424_+|VOC-family-protein
MRLHHVQVSCPRGGEDAARRFWAEGLGLVEVEKPVALRARGGAWFRAYDDAGAVGAEVHVGVEDAFAPARKAHPALLLDSVAALEAATTRLEALGFEVDLTERHTFDGHERVHARDGHGNRVELLAVEEHPR
>NZ_CP015079.1|WP_068114644.1|1967614_1967857_+|metal-sensitive-transcriptional-regulator
MTAVMNRVKRAQGQLGGVLRMLEEARDVSDVVVQLKAVSRALDRAGFAIISADLRRQVAGGDAVNGDDLDRLERWFLSLA
>NZ_CP015079.1|WP_068108585.1|1967996_1968884_-|amino-acid-ABC-transporter-permease
MSQLSVLYDAPGPRAVRRARIGTILAILVFVGFLAVAAKRLNDRGQFASELWSPWANPSDENFSAVWELVGKGLAATLTAATLAIVLSLVLGVLLGVGRLMLGPILRVPVVLWIELFRALPVVVTIVLVWRAFKELKIDLGPLPGDPGLWYLVIGLTLYNSVIIAEILRAGVNSLPSGQGEAALAVGLTNGQTMRAILLPQAFRVMLPALISQLVVALKDTSLAAVVSLGYLELLRRGNLISQNLDNPIQSLLIIATIFILINYALSKLAEYVERRMSRSSGDPAAAAQLEGAGA
>NZ_CP015079.1|WP_068108588.1|1968880_1969531_-|amino-acid-ABC-transporter-permease
MSPVLDNLDLYWQGFLTSLGIIGWALVGSLLLGTLIAAFRVSPVASLRAFGSAWVTVVRNCPLTIVLFFMAFGLPEVGINVSFYTFGVIGLIIYTSAFVCEAIRSGINSVSAGQAEAARAIGLPFTKTLTQVVLPQALRATVPPLGSVQIAMFKNSAVVGAFGVGGDLWSVGRNLTSAQGYAFIPVLTGVAIGYLIITLTAGALLAVLERKVAIAR
>NZ_CP015079.1|WP_068108591.1|1969596_1970478_-|glutamate-ABC-transporter-substrate-binding-protein
MRLTKFTAAFAGLVLAGSLAACGDDSSDSEPEVVTDAEFDSGTTMAKLKEAGSMTVGTKFDQPGFGLLGLEDVPEGFDVEVAKIIAGAMGIAPEDIEWKQASSDIREQVIEDGDVDMVVATYTINEERAERITFAGPYYEAGQQLMVNSDNDSIEGPEDIKDNPDMKVCSVTGSTPSEQIKEYLASDDQLVLFDIYDKCKDALGNGQVDIVTTDNVILLGYVDESDGDFKLVGEQFTEEPYGIGIAKGDVEFCEFINKTLADNEDAYVAAWEATAGEVEGTETPELPEAAPCA
>NZ_CP015079.1|WP_179948575.1|1970539_1971268_-|ATP-binding-cassette-domain-containing-protein
MVVLDGVQKWYGDLHVLQDINLTVHRGEVVVVIGPSGSGKSTLCRAINRLETIDEGTISLDGQPLPAEGKALASLRAEVGMVFQSFNLFAHKTILENVTLGPIKVRGVKKAEADQHAMELLERVGVAHQAEKYPAQLSGGQQQRVAIARALAMEPKVMLFDEPTSALDPEMIKEVLDVMVDLAKRGMTMVVVTHEMGFARTAADRVVFMSDGAIVEENTPEEFFTNPSSERAQDFLSKILKH
>NZ_CP015079.1|WP_169834745.1|1971379_1972927_-|CehA/McbA-family-metallohydrolase
MVGAGLGAGLGVVAGAVLVPPAAAYADGATAAGLVYRGRFTGVGDPDWYALPVEVPRGTTRIEVSYDYDKLETGAGVSFNIIDIGIFDPGGVGLGDAAGFRGWSGGARDRFSISRTRATPGYLAGPITPGTWHVVLGPFTIIPPGVGWTVTVTLHRGRPGRRFRPRPAPRRVRGTGPGWYRGDLHTHTVHSDGRHTQRSLLALAREAGLDFLASTEHNTTSAQLTWGRHVPDDFLVLPGEEVTTRAGHCVTFGQPAGAWIDWRYRPEDDQLGRFTDRVRALGGMAVAAHPFAPTSGSTWQYDYADVDAVELWNGPWTLDDQTALSHWHALLVAGRFVPAVGSSDSHHDGQQVGRAQTVVRAGSLSVGAIVRGLRGGHAWLAESAAVDLSLQARLGDRTATCGDSLDAAPTDLVDVRLEVAGAPGCVVQLWGPLGPLAGAVTDTEGAAEVTLRVAAGVAPFVRAEVRRADGAPVVNPVEGVPAWATVALSNPVFLGPHPGRGASVTGSRSQTATKM
>NZ_CP015079.1|WP_068108599.1|1973049_1974573_+|tRNA-(N6-isopentenyl-adenosine(37)-C2)-methylthiotransferase-MiaB
MTATTAPSEARTYEVKTYGCQMNVHDSERLTGLLEDAGYLPFDKQGAPAGDQADVVVFNTCAVRENADNKLYGNLSHLAPIKASRPGMQIAVGGCLAQKDRATITEKAPYVDVVFGTHNIGSLPVLLERARVAEEAQVEILESLDVFPSTLPTKRESAYAAWVAISVGCNNTCTFCIVPALRGKEKDRRPGDILAEIRALVAEGVSEVTLLGQNVNAYGVEFGDRQAFSKLLRACGGIEGLERVRFTSPHPAEFTDDVIEAMAETPNVMPSLHMPLQSGSDKVLKDMRRSYRSAKYLGIIERVRAAIPDAAITTDIIVGFPGETEEDFAETLRVVAESRFSSAFTFQYSKRPGTPAATLPDQISPEVVKDRYGRLVDLVTEIAWDENKRIVGRTVELMVAEGEGRKDAETRRLSGRAPDNRLVHFAAPGDDLLTDGRGDVRPGDMVTVEVTYAAPHHLVADRVVSVRRTRSGDAWEARTSAPTPSGVGLGMPVVGVPAPLPDAPACR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP015079_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015079_6

2036408-2036494

Orphan

Consensus_repeat	Method
GGAGGTTCATCGGCCGGCCGATGAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015079_6

>merge|NZ_CP015079|6|2036408-2036494|CRISPRCasFinder
GGAGGTTCATCGGCCGGCCGATGAACCTGACGGGTGGACGACGAAACTTCATCGTCCACCCAGGAGTTTCATCGGCCGGCCGATGAA

>NZ_CP015079|6|6|2036408-2036494|CRISPRCasFinder
GGAGGTTCATCGGCCGGCCGATGAA	CCTGACGGGTGGACGACGAAACTTCATCGTCCACCCA
GGAGTTTCATCGGCCGGCCGATGAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015079.1\|WP_068108746.1\|2028065_2028821_+\|PH-domain-containing-protein	unknown	unknown	unknown
NZ_CP015079.1\|WP_084528079.1\|2043115_2043724_-\|HAD-family-phosphatase	unknown	unknown	gnl\|CDD\|319790
NZ_CP015079.1\|WP_157520013.1\|2030265_2031351_-\|DUF2183-domain-containing-protein	unknown	unknown	gnl\|CDD\|227187
NZ_CP015079.1\|WP_068108769.1\|2037197_2038892_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP015079.1\|WP_068108748.1\|2029714_2030086_-\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|132914
NZ_CP015079.1\|WP_068108744.1\|2027469_2028069_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015079.1\|WP_068108772.1\|2038888_2039932_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|173926
NZ_CP015079.1\|WP_068108778.1\|2045359_2045803_+\|50S-ribosomal-protein-L13	unknown	unknown	gnl\|CDD\|181703
NZ_CP015079.1\|WP_068108762.1\|2035202_2036390_+\|23S-rRNA-(uracil(747)-C(5))-methyltransferase-RlmC	unknown	unknown	gnl\|CDD\|235128
NZ_CP015079.1\|WP_068108775.1\|2039950_2041243_-\|trypsin-like-peptidase-domain-containing-protein	unknown	unknown	gnl\|CDD\|273938
NZ_CP015079.1\|WP_068114660.1\|2028879_2029758_+\|bile-acid:sodium-symporter-family-protein	unknown	unknown	gnl\|CDD\|223462
NZ_CP015079.1\|WP_157520015.1\|2033201_2034752_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|371045
NZ_CP015079.1\|WP_068108766.1\|2036545_2037040_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|184918
NZ_CP015079.1\|WP_068108781.1\|2045838_2046366_+\|30S-ribosomal-protein-S9	unknown	unknown	gnl\|CDD\|178888
NZ_CP015079.1\|WP_084527404.1\|2043762_2045052_-\|citrate-synthase	unknown	unknown	gnl\|CDD\|99869
NZ_CP015079.1\|WP_068108755.1\|2031404_2032496_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274465
NZ_CP015079.1\|WP_084527402.1\|2041361_2043002_+\|long-chain-fatty-acid--CoA-ligase	unknown	unknown	gnl\|CDD\|235730
NZ_CP015079.1\|WP_068114662.1\|2034834_2035095_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|182475
NZ_CP015079.1\|WP_068108784.1\|2046391_2047762_+\|phosphoglucosamine-mutase	unknown	unknown	gnl\|CDD\|237672
NZ_CP015079.1\|WP_068108758.1\|2032581_2032998_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319899

Protein	Function_ID	Function_description	E-value
NZ_CP015079.1\|WP_084528079.1\|2043115_2043724_-\|HAD-family-phosphatase	gnl\|CDD\|319790	cd02603, HAD_sEH-N_like, N-terminal lipase phosphatase domain of human soluble epoxide hydrolase, Escherichia coli YihX/HAD4 alpha-D-glucose 1-phosphate phosphatase, and related domains, may be inactive. This family includes the N-terminal phosphatase domain of human soluble epoxide hydrolase (sEH). sEH is a bifunctional enzyme with two distinct enzyme activities, the C-terminal domain has epoxide hydrolysis activity and the N-terminal domain (Ntermphos), which belongs to this family, has lipid phosphatase activity. The latter prefers mono-phosphate esters, and lysophosphatidic acids (LPAs) are the best natural substrates found to date. In addition this family includes Gallus gallus sEH and Xenopus sEH which appears to lack phosphatase activity, and Escherichia coli YihX/HAD4 which selectively hydrolyzes alpha-Glucose-1-P, phosphatase, has significant phosphatase activity against pyridoxal phosphate, and has low beta phosphoglucomutase activity. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	3.61496e-32
NZ_CP015079.1\|WP_157520013.1\|2030265_2031351_-\|DUF2183-domain-containing-protein	gnl\|CDD\|227187	COG4850, COG4850, Uncharacterized conserved protein [Function unknown].	3.79414e-56
NZ_CP015079.1\|WP_068108769.1\|2037197_2038892_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	4.35081e-99
NZ_CP015079.1\|WP_068108748.1\|2029714_2030086_-\|STAS-domain-containing-protein	gnl\|CDD\|132914	cd07043, STAS_anti-anti-sigma_factors, Sulphate Transporter and Anti-Sigma factor antagonist) domain of anti-anti-sigma factors, key regulators of anti-sigma factors by phosphorylation. Anti-anti-sigma factors play an important role in the regulation of several sigma factors and their corresponding anti-sigma factors. Upon dephosphorylation they bind the anti-sigma factor and induce the release of the sigma factor from the anti-sigma factor. In a feedback mechanism the anti-anti-sigma factor can be inactivated via phosphorylation by the anti-sigma factor. Well studied examples from Bacillus subtilis are SpoIIAA (regulating sigmaF and sigmaC which play an important role in sporulation) and RsbV (regulating sigmaB involved in the general stress response). The STAS domain is also found in the C- terminal region of sulphate transporters and stressosomes.	6.94067e-16
NZ_CP015079.1\|WP_068108772.1\|2038888_2039932_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|173926	cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate. NAT (N-Acyltransferase) is a large superfamily of enzymes that mostly catalyze the transfer of an acyl group to a substrate and are implicated in a variety of functions, ranging from bacterial antibiotic resistance to circadian rhythms in mammals. Members include GCN5-related N-Acetyltransferases (GNAT) such as Aminoglycoside N-acetyltransferases, Histone N-acetyltransferase (HAT) enzymes, and Serotonin N-acetyltransferase, which catalyze the transfer of an acetyl group to a substrate. The kinetic mechanism of most GNATs involves the ordered formation of a ternary complex: the reaction begins with Acetyl Coenzyme A (AcCoA) binding, followed by binding of substrate, then direct transfer of the acetyl group from AcCoA to the substrate, followed by product and subsequent CoA release. Other family members include Arginine/ornithine N-succinyltransferase, Myristoyl-CoA: protein N-myristoyltransferase, and Acyl-homoserinelactone synthase which have a similar catalytic mechanism but differ in types of acyl groups transferred. Leucyl/phenylalanyl-tRNA-protein transferase and FemXAB nonribosomal peptidyltransferases which catalyze similar peptidyltransferase reactions are also included.	0.00163121
NZ_CP015079.1\|WP_068108778.1\|2045359_2045803_+\|50S-ribosomal-protein-L13	gnl\|CDD\|181703	PRK09216, rplM, 50S ribosomal protein L13; Reviewed.	5.24276e-91
NZ_CP015079.1\|WP_068108762.1\|2035202_2036390_+\|23S-rRNA-(uracil(747)-C(5))-methyltransferase-RlmC	gnl\|CDD\|235128	PRK03522, rumB, 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC.	2.15451e-170
NZ_CP015079.1\|WP_068108775.1\|2039950_2041243_-\|trypsin-like-peptidase-domain-containing-protein	gnl\|CDD\|273938	TIGR02037, Probable_periplasmic_serine_protease_do/HhoA-like, periplasmic serine protease, Do/DeqQ family. This family consists of a set proteins various designated DegP, heat shock protein HtrA, and protease DO. The ortholog in Pseudomonas aeruginosa is designated MucD and is found in an operon that controls mucoid phenotype. This family also includes the DegQ (HhoA) paralog in E. coli which can rescue a DegP mutant, but not the smaller DegS paralog, which cannot. Members of this family are located in the periplasm and have separable functions as both protease and chaperone. Members have a trypsin domain and two copies of a PDZ domain. This protein protects bacteria from thermal and other stresses and may be important for the survival of bacterial pathogens.// The chaperone function is dominant at low temperatures, whereas the proteolytic activity is turned on at elevated temperatures. [Protein fate, Protein folding and stabilization, Protein fate, Degradation of proteins, peptides, and glycopeptides].	1.7822e-81
NZ_CP015079.1\|WP_068114660.1\|2028879_2029758_+\|bile-acid:sodium-symporter-family-protein	gnl\|CDD\|223462	COG0385, COG0385, Predicted Na+-dependent transporter [General function prediction only].	4.73949e-57
NZ_CP015079.1\|WP_157520015.1\|2033201_2034752_+\|hypothetical-protein	gnl\|CDD\|371045	pfam10428, SOG2, RAM signalling pathway protein. SOG2 proteins in Saccharomyces cerevisiae are involved in cell separation and cytokinesis.	1.54354e-05
NZ_CP015079.1\|WP_068108766.1\|2036545_2037040_+\|hypothetical-protein	gnl\|CDD\|184918	PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional.	0.00273535
NZ_CP015079.1\|WP_068108781.1\|2045838_2046366_+\|30S-ribosomal-protein-S9	gnl\|CDD\|178888	PRK00132, rpsI, 30S ribosomal protein S9; Reviewed.	3.03381e-72
NZ_CP015079.1\|WP_084527404.1\|2043762_2045052_-\|citrate-synthase	gnl\|CDD\|99869	cd06116, CaCS_like, Chloroflexus aurantiacus (Ca) citrate synthase (CS)_like. CS catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). This group is similar to gram-negative Escherichia coli (Ec) CS (type II, gltA) and Arabidopsis thaliana (Ath) peroxisomal (Per) CS. However EcCS and AthPerCS are not found in this group. The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the hydrolysis of citryl-CoA to produce citrate and CoA. There are two types of CSs: type I CS and type II CSs. Type I CSs are found in eukarya, gram-positive bacteria, archaea, and in some gram-negative bacteria and are homodimers with both subunits participating in the active site. Type II CSs are unique to gram-negative bacteria and are homohexamers of identical subunits (approximated as a trimer of dimers). Some type II CSs are strongly and specifically inhibited by NADH through an allosteric mechanism. C. aurantiacus is a gram-negative thermophilic green gliding bacterium, its CS belonging to this group may be a type I CS; it is not inhibited by NADH or 2-oxoglutarate and is inhibited by ATP. Both gram-positive and gram-negative bacteria are found in this group.	0
NZ_CP015079.1\|WP_068108755.1\|2031404_2032496_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|274465	TIGR03169, selenide_water_dikinase_putative, pyridine nucleotide-disulfide oxidoreductase family protein. Members of this protein family include N-terminal sequence regions of (probable) bifunctional proteins whose C-terminal sequences are SelD, or selenide,water dikinase, the selenium donor protein necessary for selenium incorporation into protein (as selenocysteine), tRNA (as 2-selenouridine), or both. However, some members of this family occur in species that do not show selenium incorporation, and the function of this protein family is unknown.	3.17487e-54
NZ_CP015079.1\|WP_084527402.1\|2041361_2043002_+\|long-chain-fatty-acid--CoA-ligase	gnl\|CDD\|235730	PRK06187, PRK06187, long-chain-fatty-acid--CoA ligase; Validated.	0
NZ_CP015079.1\|WP_068114662.1\|2034834_2035095_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|182475	PRK10457, PRK10457, hypothetical protein; Provisional.	8.79188e-06
NZ_CP015079.1\|WP_068108784.1\|2046391_2047762_+\|phosphoglucosamine-mutase	gnl\|CDD\|237672	PRK14318, glmM, phosphoglucosamine mutase; Provisional.	0
NZ_CP015079.1\|WP_068108758.1\|2032581_2032998_-\|VOC-family-protein	gnl\|CDD\|319899	cd06588, PhnB_like, Escherichia coli PhnB and similar proteins. The Escherichia coli phnB gene is found next to an operon of fourteen genes (phnC-to-phnP) related to the cleavage of carbon-phosphorus (C-P) bonds in unactivated alkylphosphonates, supporting bacterial growth on alkylphosphonates as the sole phosphorus source. It was originally considered part of that operon. PhnB appears to play no direct catalytic role in the usage of alkylphosphonate. Although many of the proteins in this family have been annotated as 3-demethylubiquinone-9 3-methyltransferase enzymes by automatic annotation programs, the experimental evidence for this assignment is lacking. In Escherichia coli, the gene coding 3-demethylubiquinone-9 3-methyltransferase enzyme is ubiG, which belongs to the AdoMet-MTase protein family. PhnB-like proteins adopt a structural fold similar to bleomycin resistance proteins, glyoxalase I, and type I extradiol dioxygenases.	5.55625e-39

>NZ_CP015079.1|WP_068108762.1|2035202_2036390_+|23S-rRNA-(uracil(747)-C(5))-methyltransferase-RlmC
MQCDYFDAGACRSCTWMGRAYSDQVAEKQRLVADLLAPALAGRGPARRAPLTWLPPVTGPEEGFRNKAKMVVAGTVDAPTLGILDPRGGGTDLRHCGLHEPGLHDALPVLAEHVSRARLAPYDVTTRRGELKHLLVTRAPGGELMVRWVLRSTEPEARLRKHLAWLCERLPVAVASVNIQPEHKAVLEGEREIVLTERATLPMELPMELPVDLPGGAGLRLHLRPQSFFQTNTLVATALYEQARAWAAEIGPASVWDLYGGVGGFALALAAPGRAVTGVEISPEAVASAQQSAAEAGLADARFVAADATAWALEQPAASHPDLVVVNPPRRGIGPQLTGWLESSEVGEVLYSSCNATTLARDLAALPSYDVVTARLLDMFPQTTHHEVLVRLRRR
>NZ_CP015079.1|WP_068114662.1|2034834_2035095_-|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MIGLLVVGLIIGALARLIKPGKQSLSILATLVLGVVGALIGGIAASALGTGDIFELNILGFVIAVVAAVLLIGVAEGMSSKGKARV
>NZ_CP015079.1|WP_157520015.1|2033201_2034752_+|hypothetical-protein
MAASGAAACLVLAAGAVAAPAAPAPVAAGAGAEGSGTVVVRGLAFPEGRAMRLGFVGCQNIYDRAPETPQAMIGVGPGAAPAGERSLRYDLAGGNAVGALSFVSSVALTESAGLTAYAADGTTGVVYAGYQEPADRRTGLVWFGRADVVVPAGTWTRIEATDLTYSWSKWDMHAQAPVPVAAGTRPAPVGTLADMVVRHRGDGAGFVMTGLGCDGHEFAMDALHLDTAGTATTYDLEGLATSTRMLAPPVRRVVAGQDLDLGGTLVDSTGAPLSGVTMMLESRAAGSSTWEVAQVVDVDGTSPSVAVAPVTGTTYRWRFADRPMAEGSVSAPFTVQVVGGVSADLVGTGTERAITGAVTPAAPGSEAVLWRLDDGAWRRVATAAVGPLGGYRFDLPADAAGRWSVTLPAAPGRLEGRSPWLTVAGASTPEASPSPSATQSPTKSPSQSPTRSPSTSSTPSATASPTKSASAWATASPTKSPTASSSPSSSSSASASAGQSASGSASPSAGADTSTP
>NZ_CP015079.1|WP_068108758.1|2032581_2032998_-|VOC-family-protein
MPVHLNPYLTLAGTAREAMTFYRSVLGGELELMSYGDMGAEGDLADKIMHASLTTPDGLALMASDVAPGEVVEHGSTVRISLSGDDEPTLRGWFDALAEGGEVHVPMEMQPWGDMFGQCADRFGIIWLVNAAVGDQTA
>NZ_CP015079.1|WP_068108755.1|2031404_2032496_+|FAD-dependent-oxidoreductase
MPGTQTLLLVGAGHAHLHLLRHADRLRAAGWDVVLLAPRWFDYSGVASAVATGALPVSDGRLDVAALAARSGVRHLESLLGDLDTGARIATSATGEQVTYDVVSIGIGSVTAGGGGPVGEDVVAVKPLARLQTLVDRLPAHAAATVSVIGGGSSGLELAAQLAVRDGVARVRLVDGADRVGAGLPPGARRYVDRLLAARGVEVLTDRQVTRLEATSVTLADGQVFEHDLAVLAAGLDAPPLLERLRLGDARGIPVRATLQHVDHDDVYAVGDCAFFTPGPLPRVGVHGVRQAPVLLAALEARGRGESTAGHVYVPPRHWLSVLDLGDGLGLAVRGRWWWGGRGALRLKRRIDRRWIDGYRGTA
>NZ_CP015079.1|WP_157520013.1|2030265_2031351_-|DUF2183-domain-containing-protein
MSPLPSPRMHPAVLVEDAVHGLIDRGLRRAGWVPRVVPHVGYGLEGEWVRVLARVVLVPEGSLASRHPDDARGWRRFVTQSASGIPVQVEVGGTVTSVETDREGYVDVRLPADLPAGWGRARLLLDDSPPTSAHLSIAAADARHGLVSDVDDTVMVTMLPRPLVAFRNAFVSREVDRVPVPGMAALYRDLLAAHPDTFVVYLSTGAWNVASAIGRFLQRHGYPPGPALLTDWGPAPTGWFRSGQQHKITELRRLLVDFPQLSWILVGDDGQHDPSTYAQIAREHPGRVDAVLIRQLSLPEQVVRHGRLDGEADEADDEPADLGRAAHPEHEPGHEAGARRTGRGADGAALTLEARRLGLLD
>NZ_CP015079.1|WP_068108748.1|2029714_2030086_-|STAS-domain-containing-protein
MGTDTLATATTATPDGCRFSVVGELDLASVRALRARWSEALVGAPRRLDLDLAGLTFLDATGLGTILWCRQRALAVGLGCRVVAASPSAVRIMRLTGTHVLLVEDPPARLSRPAGAAAPGSDG
>NZ_CP015079.1|WP_068114660.1|2028879_2029758_+|bile-acid:sodium-symporter-family-protein
MNDSALISVGLPVALAVIMFGLGLSLQVEDFRRVARSPRAVVVALTLQVLVLPLIAFGLVLLLDLDPLLAVGVMLLAASPGGTTANLFSHLFHGDVALNVTLTAINSVIAAFTIPLITNLAIGYFDADGELGLQVGKVLQVIAIVLVPVVIGMLVRRRSAGFAARADKPVRIFSIAVLVVVAVGALLGERENLPDYVRQVGLVTALFCAASLSLGYLGARMLRLDQPQAIASSMEVGIHNTTVALTIALSVLDSTEVAIPAAVYSVIMYVFATAFGFLLTRRTRGRQHQPVG
>NZ_CP015079.1|WP_068108746.1|2028065_2028821_+|PH-domain-containing-protein
MTTIRDGGPLVAPDAAYRSLGRYAVLALIALLVPIGALFAVAGLRAEQPAFPVALGALLVVMGVAGAGSLTAPRHGPRADPPPAVAVEGGLALPLRRAHVLMRAVVGAAIAGLGVGMVLLGGSATRPLLVFGRDVDPRVVGVLVVLGVVAAAVLATRTENRLVVGPDGVRMPGGLTRARTVPWRDIAEVGAVRGWQPHLVVAFKGPGLVACRLLPQAWPASSLVALLEHHRRKAGDRGALVHPDAVERFRT
>NZ_CP015079.1|WP_068108744.1|2027469_2028069_+|hypothetical-protein
MRIPMLPLSVPGPADVRVVLDALLDAGPRVLHLIGAAEEIVLDVGGLLDRIEATRVRADEVVAATDRTRGDAATMLADLAPLSGRLEALLDCLEPLAARAVPPAEKLLPVLDHLAETTSPREVDAMVGLIDQLPLLSQRMETQVLPILETLGTVAPDLHDLLDVSQELNEMLGKLPGMRGIKKRVEEAQAEEQQEEGRA
>NZ_CP015079.1|WP_068108766.1|2036545_2037040_+|hypothetical-protein
MSSTDFCDLCELPLSTCVHGMPAPVEPPPPVKKAPPKASPVTRRRTTPAASGSSTSPAAPAAPARPRRRTPQADFKPWIVKMLQEAGGQAEADDLLSDLEQRLGDVLRPGDLETGPTGEVRWRTAARTARKQLADDGLLLAPRPGTWALTDRGSVEWVPDLPSA
>NZ_CP015079.1|WP_068108769.1|2037197_2038892_+|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MGHVDVAGVRYELPDGRVLLDEVAFRVGEGAKVALVGANGAGKTTLLRIITGDLAPHAGAVTRSGGLGVMRQDVKAGLREGATVADLLLSVAPPRVREAAAEVERLELALMESDDEATQMRYAEALGEYADAGGYDVEVTWDVCATAALGFSYDRAKYRELTTLSGGEQKRLVLEFLLRGPDQVLLLDEPDNYLDVPGKIWLEGRIRESDKTVLMISHDRELLDNTATRVVTVELGAAGNRVWTHPGGFASYHQARTDRFARFEEQRKRWDEEHAKLKALVLRLKIKAEYNDGMSSQYRASQTRLRKFEEAGPPLEQPREQQVSMRLKGGRTGKRAVVCEDLELTGLMKPFDLEVWYGERVAVLGSNGSGKSHFLRLLAAGGSDPDVEHRPVSEVPVKPVPHTGKAKLGARVRPGWFVQTHEHPELVGRTLLDILHRGDGHPGGRGGLGREQAARVLDRYELAHAGEQTFDSLSGGQQARFQILLLELSGATLLLLDEPTDNLDVQSAEALEEGLEAFEGTVLAVTHDRWFARGFDRFLVYGADGEVYESPGPVWDEGRVVRAR
>NZ_CP015079.1|WP_068108772.1|2038888_2039932_+|GNAT-family-N-acetyltransferase
MTAPSGTGELRIEAVDPFDDDTFEAWHAVYLSSQRHVREPAAVTAWTLGEMRPQMQAQGSKRWAGAFLGRVDEVPVASGYLATPLLDNLAQAQVSLDVGPDHRGRGHGSTMLAHLLRQAASRGRDVVTAETSWEWDAPVDGAGRAGPALLRRHGFELGLTEVLRVLDLPVAAERLHDLAAQAAPHHAAYPLRSFVGRVPDELAEQWAAITASLSTEAPVGSLSVEAETGDVALLREEEDMLARQARTRYASVALTADGQVAGYTEIVTTEHEPGKAYQWGTVIRREHRGRRLGSAVKTATLLLLQEHVADLHSVRTWNADSNTHMVAVNDALGYRPVERLGTFERRV
>NZ_CP015079.1|WP_068108775.1|2039950_2041243_-|trypsin-like-peptidase-domain-containing-protein
MNETPSDAPQPPHDPQHDPYRDTTAYDLGPQPSWNPGGTPAPAAAPPARGRKGFAAAVVAASLVVGGVAGFGGAAAWSAFDGEGGSSQDSPAVQTSEVVDTPEAGAEPGSVQQVAADVLPSVVRIDVRSGQEGGSGSGIVLSSDGQILTNEHVIAAAGDGAEITVSFDDGSRAAATVLGSDPLTDTAVIQAEGVEGLTPATIGKSEDLRVGQAVVAIGSPFGLDATVTSGIVSALDRPVGVGSNEDGDATIYPAVQTDAAINPGNSGGPLVDMNGHVVGINSSIRTAGSSGSPFGESSQGGSIGLGFSIPIDEVMGVVEQMAAGETPTHARLGISVSDVALRGGSDESSSGADVVQGALVREVGDGSTAADAGLQKDDVITKVDDTMIVSSDSLVATIRSYRPGDSVTITYVRGGDEDTVELVLDSDATS
>NZ_CP015079.1|WP_084527402.1|2041361_2043002_+|long-chain-fatty-acid--CoA-ligase
MTATPTPATSPENQQAQPGATPGPTPRFVDDRLAHWAATTPDAEAMTYLARTWTWAELDDRVRRCTGMLAGLGVGRGDVVAFLDKNHPACVELSMAAGALGAANAIINFRLAGEEIDYAVNDSGATVLLVGSELMGQVEQIRDRLTRVEHVIEVTPDGGLESDDYERRLAEATPTGRAADVDPGDTCLVMYSSGTTGHPKGVMLSHANMVAHTTNAHDGWGFEPGDKSMVAMPLFHVGGSSYVLFGIHDGIPSVMTRDPDGASLAGAILAGANRTFLVPAVLAQVLQSGPDAIKLFGALKTYTYGAAPMPPPLLRAAMEAWPDTDFMQVYGLTEVSGVATHLMPEEHRTAVADGHPERLVSAGRALPEMEVRIVDPATLEDQPTGSAGEIWLRTPQLFQGYLGKPEATAEVITPDGWFRTGDMGKVDAEGYVFVEDRLKDMIISGGENIYSPEVERVLAEHPAVMEVAVIGIPDDTWGESVKAVVALKEGESATEQEIIAYCREHLAHFKCPKTIDVLEALPRNPTGKILKRELRAPYWEGRDRAV
>NZ_CP015079.1|WP_084528079.1|2043115_2043724_-|HAD-family-phosphatase
MGAGVVWDLGNVLIDWDASRAIAAGVGEDEAARFLGADDFDFRAYNHGPDSGMTWDEAEAAVARSHPHWLAHARAYRAHFPASLVGEVPGTPELVRALHAGGVPQWGLTNWSHELYPHAPRMFEVLALLEDVVVSGTEGLAKPDPRVYELLVARTGRALGELVFVDDRPENVDAAVALGMTGLVFTDAEALRVDLAGLGLPL
>NZ_CP015079.1|WP_084527404.1|2043762_2045052_-|citrate-synthase
MTDSLTVRDNRTGQEYDVPILDGSIKAADIGKIKADDETPGLAVYDPGFVNTASCRSSVTYIDGEKGILEYRGYPIEQLAEKSSFLEVSYLLIHGALPTKAEYDTWVHEITYHTFVHENVKTFMQGFRYDAHPMGMLMASVGALSTFYPDARNISDPQNRHMQIVRMIAKMPTLGAWSFRHAQGKPYIYPDNDLSYTANFLSMLFKMSESKFEVDERLVKALDILFILHADHEQNCSTNAVRSVGSSQVDPYSAVAAGIGALYGPLHGGANEAVLRMLRRIGSKENIPAFIEGVKNGNEKLMGFGHRVYKNHDPRATIIKKACDDVFEVTGVNPLLEIAKELEKIALEDEYFISRKLYPNVDFYSGLIYEAFQFPPEMFTVLFAIGRTPGWLAQWIELVQDKEQKIARPKQIYTGERQLQFTPASERWA
>NZ_CP015079.1|WP_068108778.1|2045359_2045803_+|50S-ribosomal-protein-L13
MRTYSPKPGDIQREWHIIDATDVRLGRLAVQAATLIRGKHKPMFAPHADTGDFVIIINAEKVSLSGDKATKKMAYRHSGFPGGLSATPIGEVLEKDARRAIEMAVWGMLPKNKLGRQVLKKLKVYSGPSHPHQAQQAVPFEISQISQ
>NZ_CP015079.1|WP_068108781.1|2045838_2046366_+|30S-ribosomal-protein-S9
MAETTENEKTENTGEVEETFTPDEQGVAYSSESTPSAEAVAERPATIAPGAATGRRKQAVARVRIVPGTGVWTVNGRALDSYFPNKLHQQVVNEPFAALQLEGRFDVIARIHGGGITGQAGALRLGVARSLNAIDVDANRAILKKDGLLTRDARVIERKKAGLKKARKAPQFSKR
>NZ_CP015079.1|WP_068108784.1|2046391_2047762_+|phosphoglucosamine-mutase
MTRLFGTDGVRGRANGVLTAGLALDLSVAAARVLADAGEFEGHRPRAVVGRDTRISGEFLEAAVVAGLASAGVDVELVGVLPTPGVAHLTDVLDADLGVMISASHNPMPDNGIKFFARGGRKLDDALEEQIEQRMHADEALPTGAAVGRVRSHPEAVQRYADHLVSTLATSPGAPGAGPLTGLRIVLDCAEGAAYDAGPRALQAAGATVVAIHAAPDGLNINDGCGSTHLEPLRRAVLEHGADAGFALDGDADRMLAVDAAGEVVDGDQVLAILALAGLEDGSLVDSTVVATVMSNLGFVQAMEAAGIKVALTKVGDRYVLEQMGASGFVLGGEQSGHVIMSRHATTGDGLLATLHVAARMAATGRSLADLAGVVTRLPQVLVNVPDVDKSRTHDDVLVAAVEREEAAMAGSGRVLLRPSGTESLVRVMVEAPTQQQAQDVADRLADVVRERLALA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP015079_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015079_7

2297598-2297684

Orphan

Consensus_repeat	Method
TTCATCGGCCGGCCGATGAAACTCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015079_7

>merge|NZ_CP015079|7|2297598-2297684|CRISPRCasFinder
TTCATCGGCCGGCCGATGAAACTCCTGGGTGGACGACAAAACTTCATCGGCCACCCGTCAGGTTCAGCGGCCGGCCGATGAAACTCC

>NZ_CP015079|7|7|2297598-2297684|CRISPRCasFinder
TTCATCGGCCGGCCGATGAAACTCC	TGGGTGGACGACAAAACTTCATCGGCCACCCGTCAGG
TTCAGCGGCCGGCCGATGAAACTCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015079.1\|WP_068109400.1\|2302930_2305093_+\|PAS-domain-S-box-protein	unknown	unknown	gnl\|CDD\|380161
NZ_CP015079.1\|WP_068109367.1\|2286352_2291269_+\|NAD-glutamate-dehydrogenase	unknown	unknown	gnl\|CDD\|377452
NZ_CP015079.1\|WP_068109361.1\|2284950_2285442_-\|DUF2505-domain-containing-protein	unknown	unknown	gnl\|CDD\|378476
NZ_CP015079.1\|WP_068109358.1\|2284468_2284951_-\|DUF2505-domain-containing-protein	unknown	unknown	gnl\|CDD\|378476
NZ_CP015079.1\|WP_068109397.1\|2302083_2302902_+\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|319832
NZ_CP015079.1\|WP_068109378.1\|2294869_2296702_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP015079.1\|WP_068109373.1\|2291909_2293019_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015079.1\|WP_068109355.1\|2284274_2284484_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015079.1\|WP_068109404.1\|2306356_2306734_+\|response-regulator	unknown	unknown	gnl\|CDD\|381104
NZ_CP015079.1\|WP_068109353.1\|2283015_2284086_-\|alkene-reductase	unknown	unknown	gnl\|CDD\|239243
NZ_CP015079.1\|WP_068109364.1\|2285485_2286304_+\|tryptophan-2,3-dioxygenase	unknown	unknown	gnl\|CDD\|188272
NZ_CP015079.1\|WP_068109386.1\|2298783_2299713_+\|DNA-ligase	unknown	unknown	gnl\|CDD\|274295
NZ_CP015079.1\|WP_157520539.1\|2293211_2294873_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP015079.1\|WP_169834690.1\|2305177_2305717_+\|pyruvoyl-dependent-arginine-decarboxylase	unknown	unknown	gnl\|CDD\|376631
NZ_CP015079.1\|WP_068114742.1\|2305724_2306291_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015079.1\|WP_068109395.1\|2301343_2302057_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP015079.1\|WP_068109370.1\|2291328_2291913_+\|SigE-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|132028
NZ_CP015079.1\|WP_068109388.1\|2299712_2300621_+\|ATP-dependent-DNA-ligase	unknown	unknown	gnl\|CDD\|236599
NZ_CP015079.1\|WP_068109392.1\|2300744_2301281_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015079.1\|WP_068109383.1\|2297688_2298645_-\|Ku-protein	unknown	unknown	gnl\|CDD\|238408

Protein	Function_ID	Function_description	E-value
NZ_CP015079.1\|WP_068109400.1\|2302930_2305093_+\|PAS-domain-S-box-protein	gnl\|CDD\|380161	NF033092, HK_WalK, cell wall metabolism sensor histidine kinase WalK. This model describes WalK as found in Staphylococcus aureus (sp\|Q2G2U4.1\|WALK_STAA8). A shorter version, as found in Streptococcus pneumoniae, called WalK(Spn) or VicK, is not included. WalK is part of a two-component system and works with partner protein WalR.	2.20345e-58
NZ_CP015079.1\|WP_068109367.1\|2286352_2291269_+\|NAD-glutamate-dehydrogenase	gnl\|CDD\|377452	pfam05088, Bac_GDH, Bacterial NAD-glutamate dehydrogenase. This family consists of several bacterial proteins which are closely related to NAD-glutamate dehydrogenase found in Streptomyces clavuligerus. Glutamate dehydrogenases (GDHs) are a broadly distributed group of enzymes that catalyze the reversible oxidative deamination of glutamate to ketoglutarate and ammonia.	0
NZ_CP015079.1\|WP_068109361.1\|2284950_2285442_-\|DUF2505-domain-containing-protein	gnl\|CDD\|378476	pfam10698, DUF2505, Protein of unknown function (DUF2505). Members of this family are all Actinobacteria. The function is not known.	1.31678e-36
NZ_CP015079.1\|WP_068109358.1\|2284468_2284951_-\|DUF2505-domain-containing-protein	gnl\|CDD\|378476	pfam10698, DUF2505, Protein of unknown function (DUF2505). Members of this family are all Actinobacteria. The function is not known.	1.19133e-37
NZ_CP015079.1\|WP_068109397.1\|2302083_2302902_+\|HAD-family-hydrolase	gnl\|CDD\|319832	cd07530, HAD_Pase_UmpH-like, UmpH/NagD family phosphatase, similar to Escherichia coli UmpH UMP phosphatase/NagD nucleotide phosphatase and Mycobacterium tuberculosis Rv1692 glycerol 3-phosphate phosphatase. Escherichia coli UmpH/NagD is a ribonucleoside tri-, di-, and monophosphatase with a preference for purines, it shows peak activity with UMP and functions in UMP-degradation. It is also an effective phosphatase with AMP, GMP and CMP. Mycobacterium tuberculosis phosphatase, Rv1692 is a glycerol 3-phosphate phosphatase. Rv1692 is the final enzyme involved in glycerophospholipid recycling/catabolism. This subfamily belongs to the UmpH/NagD phosphatase family, and to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	3.71254e-127
NZ_CP015079.1\|WP_068109378.1\|2294869_2296702_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	1.27185e-166
NZ_CP015079.1\|WP_068109353.1\|2283015_2284086_-\|alkene-reductase	gnl\|CDD\|239243	cd02933, OYE_like_FMN, Old yellow enzyme (OYE)-like FMN binding domain. OYE was the first flavin-dependent enzyme identified, however its true physiological role remains elusive to this day. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction. Members of OYE family include 12-oxophytodienoate reductase, pentaerythritol tetranitrate reductase, morphinone reductase, and related enzymes.	0
NZ_CP015079.1\|WP_068109364.1\|2285485_2286304_+\|tryptophan-2,3-dioxygenase	gnl\|CDD\|188272	TIGR03036, trp_2_3_diox, tryptophan 2,3-dioxygenase. Members of this family are tryptophan 2,3-dioxygenase, as confirmed by several experimental characterizations, and by conserved operon structure for many of the other members. This enzyme represents the first of a two-step degradation to L-kynurenine, and a three-step pathway (via kynurenine) to anthranilate plus alanine. [Energy metabolism, Amino acids and amines].	5.06528e-74
NZ_CP015079.1\|WP_068109386.1\|2298783_2299713_+\|DNA-ligase	gnl\|CDD\|274295	TIGR02779, NHEJ_ligase_lig, DNA ligase D, ligase domain. DNA repair of double-stranded breaks by non-homologous end joining (NHEJ) is accomplished by a two-protein system that is present in a minority of prokaryotes. One component is the Ku protein (see TIGR02772), which binds DNA ends. The other is a DNA ligase, a protein that is a multidomain polypeptide in most of those bacteria that have NHEJ, a permuted polypeptide in Mycobacterium tuberculosis and a few other species, and the product of tandem genes in some other bacteria. This model represents the ligase domain.	7.43689e-78
NZ_CP015079.1\|WP_157520539.1\|2293211_2294873_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	7.97691e-140
NZ_CP015079.1\|WP_169834690.1\|2305177_2305717_+\|pyruvoyl-dependent-arginine-decarboxylase	gnl\|CDD\|376631	pfam01862, PvlArgDC, Pyruvoyl-dependent arginine decarboxylase (PvlArgDC). Methanococcus jannaschii contains homologs of most genes required for spermidine polyamine biosynthesis. Yet genomes from neither this organism nor any other euryarchaeon have orthologues of the pyridoxal 5'-phosphate- dependent ornithine or arginine decarboxylase genes, required to produce putrescine. Instead,these organisms have a new class of arginine decarboxylase (PvlArgDC) formed by the self-cleavage of a proenzyme into a 5-kDa subunit and a 12-kDa subunit that contains a reactive pyruvoyl group. Although this extremely thermostable enzyme has no significant sequence similarity to previously characterized proteins, conserved active site residues are similar to those of the pyruvoyl-dependent histidine decarboxylase enzyme, and its subunits form a similar (alpha-beta)(3) complex. homologs of PvlArgDC are found in several bacterial genomes, including those of Chlamydia spp., which have no agmatine ureohydrolase enzyme to convert agmatine (decarboxylated arginine) into putrescine. In these intracellular pathogens, PvlArgDC may function analogously to pyruvoyl-dependent histidine decarboxylase; the cells are proposed to import arginine and export agmatine, increasing the pH and affecting the host cell's metabolism. Phylogenetic analysis of Pvl- ArgDC proteins suggests that this gene has been recruited from the euryarchaeal polyamine biosynthetic pathway to function as a degradative enzyme in bacteria.	3.91606e-25
NZ_CP015079.1\|WP_068109395.1\|2301343_2302057_+\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	1.29697e-73
NZ_CP015079.1\|WP_068109370.1\|2291328_2291913_+\|SigE-family-RNA-polymerase-sigma-factor	gnl\|CDD\|132028	TIGR02983, putative_RNA_polymerase_ECF-subfamily_sigma_factor, RNA polymerase sigma-70 factor, sigma-E family. This group of similar sigma-70 factors includes the sigE factor from Streptomyces coelicolor. The family appears to include a paralagous expansion in the Streptomycetes lineage, while related Actinomycetales have at most two representatives.	9.09693e-39
NZ_CP015079.1\|WP_068109388.1\|2299712_2300621_+\|ATP-dependent-DNA-ligase	gnl\|CDD\|236599	PRK09632, PRK09632, ATP-dependent DNA ligase; Reviewed.	2.58823e-138
NZ_CP015079.1\|WP_068109404.1\|2306356_2306734_+\|response-regulator	gnl\|CDD\|381104	cd17552, REC_RR468-like, phosphoacceptor receiver (REC) domain of Thermotoga maritima response regulator RR468 and similar domains. Thermotoga maritima RR468 (encoded by gene TM0468) is the cognate response regulator (RR) of the class I histidine kinase HK853 (product of gene TM0853). HK853/RR468 comprise a two-component system (TCS) that couples environmental stimuli to adaptive responses. This subfamily also includes Fremyella diplosiphon complementary adaptation response regulator homolog RcaF, a small RR that is involved in four-step phosphorelays of the complementary chromatic adaptation (CCA) system that occurs in many cyanobacteria. Both RR468 and RcaF are stand-alone RRs containing only a REC domain with no output/effector domain. The REC domain itself functions as an effector domain. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	3.23472e-54
NZ_CP015079.1\|WP_068109383.1\|2297688_2298645_-\|Ku-protein	gnl\|CDD\|238408	cd00789, KU_like, Ku-core domain, Ku-like subfamily; composed of prokaryotic homologs of the eukaryotic DNA binding protein Ku. The alignment includes the core domain shared by the prokaryotic YkoV-like proteins and the eukaryotic Ku70 and Ku80. The prokaryotic Ku homologs are predicted to form homodimers. It is proposed that the Ku homologs are functionally associated with ATP-dependent DNA ligase and the eukaryotic-type primase, probably as components of a double-strand break repair system.	9.83683e-125

>NZ_CP015079.1|WP_068109378.1|2294869_2296702_+|ABC-transporter-ATP-binding-protein
MSGGASRSWRGEAEVDRDEAAERLTSGSLGGGAGRLLRDLLRPYRRALQVLVLIVLVENTARLAIPYLVKVGIDSGIPPIRERDDLSTLLIVVAVVLVATVTQALARNRFLVRQGEIGQDVLLALRRRVFGHFQVLSPAFHDGYTSGRVISRQTSDVDAIHEMLETGFDGLVTAALTLVGTAGILLFLDVRLGLVALLCGPFLALLTNWFRKASADSYRVTREKVALVIVHFVESMGGVRAVQAFRREDRNQEIFDDVNEQYRRANLVAFRLVAWFMPGIRLIGNITIAVVLLYGGYLAHEGEVTVGVLAAFLLYLRQFFEPMMEISQFYNTFQSASAALEKLAGVLEQEPDVPEPLHPRPLDRAAGELHFDGVRFEYVQGRPVLPGLDLRVPAGQTVALVGTTGAGKTTLAKLATRFYDPTGGRVLLDGIDVRDLASDTLRDHVVMVTQENYLFSGTIADNIRFGRPDASMDDVVAATTALGAHDFIAAMPDGYETEVANQGGRLSAGQRQLVAFARAFLADPAVLILDEATSSLDVPSERLVQQALRTVLAGRTAVIIAHRLSTVQIADRVLVMEHGRVVEDGSPAALVAAGDGRFSALHEAWQASLA
>NZ_CP015079.1|WP_157520539.1|2293211_2294873_+|ATP-binding-cassette-domain-containing-protein
MLFASLGGVGLAIGIPLVTRAIIDGPVEQRDLAALFPLAGLALVLGVLEAVLVWWRRWVQSNAVLGLETTMRRDLYAHLQQLPMAFHTRWQSGQLLSRATTDLAAIRRFSGFGMLFLLINVVQLVVTTLVLLQMYWPLGVVVAAAAVPIVWLSMRFEKRYVVISRQVQDEQGDLATLAEEGAVGIRVIKSFGRSAHMGERYDVASRRLHATSVAKARLSARFWTFLEVIPNVAVVVVLLLGAIGVGRGQLSLGELVAFITLMLSLVWPVSSLGVILAMAQEAMTAAARILEIYDTEPSILSGEREVAEPRGHLRLENVDFAFPDAPDEPVLRGLDLEVHPGETIALVGATGSGKTILTALVPRLWDVTGGRVLLDGVDVRELRTEHLRTLVATAFEDPTLFSMSARENLTLGRADATEAEIEEALEISQAGFVHDLPWGLDTRIGEQGMALSGGQRQRLALARAVLAGPRVLVLDDTLSALDVHTEALVEEALARVLSSTTAIVVAHRASTVQLADRVALLQDGRITHVGGHRELLATVPAYRDLLAGDEVPA
>NZ_CP015079.1|WP_068109373.1|2291909_2293019_+|hypothetical-protein
MSTQDLARGLEAELSALPVPPGDLDRAIREGTGRRRRRRAGIVAAASTLVLLAGGLGVALLSGEDPGGARVLDPAGVGPFDVSGGLRAYADPGVSLHLGDRTFPAEGLGALDTDASATDLGVVHTVSGRPYLLGPDGASRPLVDGPVDDVSSFHPGSRADRAGTSVVVATLSGDVATLHLVDLRDLSTLGTRTLECGGGCEALRLDALDEGRVFLQGPTGPAVWDTRDDSWTPFGARTRVADVRNGVVLHDGPPAAELDGLGLRQVAGAIDSQLTFDGGHVLGWSSRLEPTTRGGTAILLERGAGGADRADKGALGFWSIDSDGSVLLALSTRYPRYDVLDCEVPSGRCEQIGTLEPTGGDPAFMGNDM
>NZ_CP015079.1|WP_068109370.1|2291328_2291913_+|SigE-family-RNA-polymerase-sigma-factor
METVSTSSRPPSRSGRERPGTPRDGDFASFFAATWPRVYPVAVAVAGEHAAAEDALQSVFAKVYARWDRVQQADHPEAYVRRMVVNEVVGARRYGFARRERTAEQVPHDDRRASGSPEPGVVRRDEVLAALRTLPPRQRAVVVLRYYEDLSEAEIARTLGCSRGTVKSQASAALASLRRCGLVSLATDDEGDAR
>NZ_CP015079.1|WP_068109367.1|2286352_2291269_+|NAD-glutamate-dehydrogenase
MSTTTHDLEKSELISRAAELARSGRGSGGPPHDQVGDLLTAYYRHVAAEDVAERSESDVYGALASHYRLAQQRPQGRATVRVFTPTLADHGWSAGGHSVVEVVTDDMPFLVDSLTMELSRQLRDVHVVVHPHFDVERDITGALQRVAVVDDGALPPQDSSVRESWMHVEIDRLADDDDPDQVVEDVQRVLRDVREAVEDWSRTRQRMLDVVEGLQSDPPPGLDPEEVRQGAALLEWLADDHFTFLGYREYRLETVPGHDGGEHAVDDEVLRAVPGTGLGILRADQAHSGSFARLPEPVKAKAREKSLLVLAKANSRATVHRPAYLDYVGVKTFDERGEVVGEQRFLGLFSSTAYAESLTRIPLLREKAREVLRRSGFDPRSYAGRALMDTLETYPRDELFHTEVAQLATMAESAMHARERRSVRAIIRPDTYGRYVSVLVYLPRDRYNTAVRERFSEILLERLGGESIEFTVRINESTTARVHFVVHLPRGEADPTVTGQLRALDTTDLERRLADASRSWRDDFMAAVLSEYGEQSGAVLGRRYVDSFPEAYKEDFSARTAAIDVGRLEAITGDEGIDLSLHEDLDAGRGEVRLKVYRVGSPLSLSEVLPMLSSLGVEVVDERPYELDGLSRSSFVYEFGLRYPRSLPEGSRDLFVQSLHAIWDVRTDTDGFNTLVLGAELTWRQVAVLRAYAKYMRQGGSPFQLDTIEEALSSNVDITRLLVRLFEIRFDPACAEREQQEERLREQLVSALDDVASLDHDRILRSYLTHVGATLRTNHYQRGTDGEPADYLSLKLEPSSIPDLPEPRPKYEVFVHSPRVEGVHLRFGSVARGGLRWSDRRDDFRTEVLGLVKAQMVKNTVIVPVGAKGGFFAKQLPDASDREAWMTEGIAAYRTFISGLLDITDNLVEGAVVPPTDVVRHDGDDSYLVVAADKGTATFSDIANELSQDYGFWLGDAFASGGSVGYDHKAMGITARGAWVSVQRHFRERGIDSQTEDFTCVGVGDMSGDVFGNGMLCSEHIRLVAAFDHRDIFLDPTPDAASSYAERQRLFDKPRSSWQDYDTSLISEGGGVYPRSKKSIPISPQVREALGIADDVTRLSPAELMRAILTAPVDLLWNGGIGTYVKSRAESHADAGDKANDAIRVDGRDVRARSVAEGGNLGLTQAGRIEYARFGGDPDGGGGRINTDFIDNSAGVDTSDHEVNIKILLDRVVAAGDLTGKQRNELLAAMTDEVAALVLRDNYEQNLALANALSHAPSLLHVHEDFMKQLERDGTLTRSVEGLPSSQEVRRRGDRGEGLTAPELSALMAWTKIVLADELLASDVPDDPYLDEDLLAYFPSAMRERFTDQIRSHPLRREIIVTQVVNDLVNGAGMTFWPRLGGETGLGAAELTHANFVAREIFASLPLREELRSYDNRLDAAVQTRMRLEMRTLVERATRWLVANRRAPLDSSGTVEQLAGPVQETVARLPELMVGHELAAYEQRRDRLVKRGVPEDLAARVAALPPAYMVLGIVDAATREGLDPTEVARVHFALGERLGLTTLVLRILALPREDRWQTMARAALRDDLHSVHLQLTLRVIAATPAEESAPARIATWEDADATTVGRAATTLGEICSDDEADLARLSVGLRVVRGLLAS
>NZ_CP015079.1|WP_068109364.1|2285485_2286304_+|tryptophan-2,3-dioxygenase
MSEQFVSFGEQGAQLTYGSYLRLPQLLDAQHPESGTSDDPPAHDELLFITIHQVYELWFKQLLHEVGAARDALLSPSAGRDRLWWAQHLLSRVHVIERTLVQQVDVLETMTPQDFLEFRQRLAPASGFQSVQFRELEFLSGAKDPAYLERFRGLTQDEQERLRRRLVEPSLWDAFVAALATAGFAVDDDAAIAQALHTVAHDRDSHAALWALAEALLQHDELAASWRARHVVMVERMIGAKSGTGGSSGSAYLRSRLPVQYYPMLWELRSQL
>NZ_CP015079.1|WP_068109361.1|2284950_2285442_-|DUF2505-domain-containing-protein
MKFTHTLSYDASPDDVYAMLRDPAFRERVLAAQAVVSSEVTLEPRDGGAGGFHLVVEQVQDTAGLPAIARKITGDTTRAVVEEDWAGPSGGTVSITAPGKPTSATGTVALEAAGAGTREVVELDVKVKVPLVGGKLEALMADNIEKGLDIEQTVGIAWLAGER
>NZ_CP015079.1|WP_068109358.1|2284468_2284951_-|DUF2505-domain-containing-protein
MTTSLVHELTYDAPLADVAAMLADPAFREEVSQAQEVLRHDVHLERTDAALTVRVEQVRTADGMPSFARKIVGDEMAIVQEERWASPERGDVTVTIPGKPGDVTGTITLREDGGSTTETVDLTIKVSIPLVGGKVEKLVADILRKALVIENTVGRDYLSR
>NZ_CP015079.1|WP_068109355.1|2284274_2284484_+|hypothetical-protein
MLIATFLWTVLAPTALHLGSLHPVEKALTLALAFGPFLVLGVVIWWRSRHEDQDEDQDEDEDEPAQRER
>NZ_CP015079.1|WP_068109353.1|2283015_2284086_-|alkene-reductase
MPSIFDPLTAGAMTLPNRLVMAPLTRNRATGTVPGDLHVDYYAQRASAGLVITEGSQPVAEGQGYPNTPGFHSPEQLAGWRRVADAVHAQGGRIVAQLMHAGRVSHPDNTGGQDVVAPSALAAPGEMFTPTGAQPHPVPRALDTDEIPGVVEGIVQAARNAVEAGLDGVEVHAANGYLIHQFLAPGSNQRDDEYGGSPENRARFAIEVTRAVAEAIGADRVGIRISPAHNIQGATEEDAADVKATYTHLVEALAPLGLAYLSVLADPRLDLVQDLRRGFGGVVIANDGFGEITTRESAQEILDKDLADAVAVGRLFIANPDLPRRWAEGADLNEPDSATFYGGGAEGYTDYPALEG
>NZ_CP015079.1|WP_068109383.1|2297688_2298645_-|Ku-protein
MRAIWKGAVSFGLVNVPVKLYSATESHDVSFRQVHAEDGGRIRYQRVCAIDGEEVPYADIAKGYETEDGEMVILTDDDMAQLPSTSSREIAVEKFVPSDQIDPMLFEKSYYLEPEKSGAKPYALLRQALLDADRMAVVTVALRQRTTIAVLRVRDDVIVLQTMMWPDEIRTPDFSIEPGEVKDTEVKMATMLVETLAGDFDPSEFEDDYAAAVETMVKTKIEGGEMKRTPTSTKSSGEVVDLLAALQRSVDAAKSGRRGNEESEESKDESSGTESKKTSAAKATKKAPAKKSAAKKAAAKKSTAKKSTAKKTAAKKAS
>NZ_CP015079.1|WP_068109386.1|2298783_2299713_+|DNA-ligase
MLATKTDTVPVGADWSHEVKWDGVRILADRADRGAGGATRLWSRNANEVGVAWPDVVDSAVGSRDLLVDGEVIVLNEAGVPDFRVLQERLHVRRARTAEHLAGTLPATFMVFDLLRLDGTDLTALPLHERRARLADLDLGRWQVPPAYDDGAMLHAATHQQGLEGVVSKRLDSRYTFERRSPHWLKLAHRHRRSYVVGGWRPQEGTSDRLAALLVGEPTPQGLAYRGRVGSGIGARTSRQLAELVAGLARGSSPFDDEVPGIDARGTHWVEPVLVVDVDTHGTGHARLRQPSYRGLREDLVPADLPDQS
>NZ_CP015079.1|WP_068109388.1|2299712_2300621_+|ATP-dependent-DNA-ligase
MAGEEVHVDVEGRTLRLTNLDKVLYPATGTTKGEVLHYYAQIAPTLLPHLADRAVTRIRWPHGVGGSSFFEKNAPSGTPSWVRTVSVPTTGSRGESRHGDRLVFPVVDDLATLTWLANLAALELHVHQWRVGRNGRPRNPDRIVIDLDPGDPAGLHECCQVALLVRDRLAGRGLVARPVTSGSKGLHLYATLPQRLAADAATELAKEVADELSAARPRHVTATMTKARRGGKVFLDWSQNAASKTTITPYSLRGRERPYVAAPVSWAEVEAGAEDPLGLEQLRFEEVLERVADLGDLFAKPT
>NZ_CP015079.1|WP_068109392.1|2300744_2301281_+|hypothetical-protein
MTSIQLSRPAQAHLPSLSGSQWRGATVLLAVLLVLAGTVWLSGIPLRAADVDSGAGLSLSASERGTSLSVTSLDAGASASRTVTIRNPESTDVRLALVENAAPTTAAGGALVLRIEHDDRTVYEGPFGGMADVSQDMGWVPARGESTFTFTVSLPETADPLSAGGQPAMAAYAWESTP
>NZ_CP015079.1|WP_068109395.1|2301343_2302057_+|response-regulator-transcription-factor
MGQRVLVVEDEEDIAFPLVRTLEREGYEVSWVDTGQRALDDLAGIPADVVILDLGLPDIDGLEVCRRAREAGFEGAIMIVTARAGELDRVVGLDYGADDYLSKPFGLAELQARVRALLRRTSHGFAAPADTDPHGLRIDVAARRVHSGDQEVPLTGKEFEVLNILASQRDKVVARSRLMADVWDENWYGSTKTLDVTIGRLRQKLESVGVTEKIVAVRGVGFRLEGAAAAPDSSVQG
>NZ_CP015079.1|WP_068109397.1|2302083_2302902_+|HAD-family-hydrolase
MSDVPAVPEPREVSTWLTDMDGVLVHEDVPIPGAQEFIARLQESGLGFMVLTNNSIYTPRDLRARLLRSGIDVPESAIWTSALATAQFLRDQRPGGSAYVVGEAGLTTALHDVGYVMTDHDPDYVVLGETRTYSFEAITRAIRLIDAGARFIATNPDPSGPSQDGKLPATGAVAALITTATGRQPYYVGKPNSLMMRSALNRIDAHSETTVMVGDRMDTDIIAGLEAGLRTILVTTGSTTQDQVGTFPYRPTFVHESVADLVDLVDEWAQRG
>NZ_CP015079.1|WP_068109400.1|2302930_2305093_+|PAS-domain-S-box-protein
MPSGPPAARRQLVSLVVAAVVAAGLFLVLWALLSSSLALSVRGSISVLGLVVAGALATASTAIRARWSTGGRRRAWRLLSLAGLTALVGNVLAALLGDPESVGSSPVGDAAIAVALLLSIASLTWFTQVNRSRVDLAVMALDGVILGTAVLMIAASLVYDQLLASGGSVSLLAGTVIPILDVVLATVALILLRRTRGPDRVALGLVAAGFIVYTMTDLGYAVRIAAGTFDFGSVLDLGWIGGYLLLALAAWWPTRVTDVSREDGVAGAEDWDTAVVFGVLLVATMVEVIGDGPGRLLSIEALLWLVLIGGAGVRQGLIARDNRHLRQSLEDQVRERTADLRQMGRETEVLLSSVADGIYGVDLEGRVTFVNPSGAEMLGYATGGLAGMVAHDVFHAPDAEGRPFPFDACYIEEAVRSRVVTNGEEDLYVRADGDVFPVEITASPLVDDDTGEVRGGVVVFRDVTSRREVERVKNEFLSVVSHELRTPLTSIRGSLGLLSGGVLGALPEQAASMVDRALVSSERLTRMINDILDLERIESGNLALEVQPHDVDELLAIADREMSGLAASRDVRLVRSTGCPGLVLADHDRIVQSLTNLIGNAIKFSAPGSVVELDARLVGDDVEMRVRDRGRGIPADRLETIFERFVQVDSSDMRQEGGSGLGLAICRGIVERHGGRVWLESEVDVGTTAHLSLRAAPTPGVDAVPAAGGATAGGPSAPSA
>NZ_CP015079.1|WP_169834690.1|2305177_2305717_+|pyruvoyl-dependent-arginine-decarboxylase
MDSAPLLDLGDDAASAAPPVGPRITVRTGSGTGRTRLSAFDAALRAAGVADLNLVTLSSVVPPGSTVVESHEPLAHTHGDRLWCVLASAGAEQHGEVVWAGLGWARETRGGAGVFVEHHSGSEEALRTQIALSLEDLCASRGWTAVESHTVVASAECVSDPVCALAVAAYEVQGWGTGG
>NZ_CP015079.1|WP_068114742.1|2305724_2306291_+|hypothetical-protein
MDGLSITVDVEGALDADVIERFHDLYTVTFAPMAELAVARQVLHREEFVEEMSDPRVMKYVARDPAGEVVGLTTLTRDLRTVPWISPEYFAARYPEHTARNAVFYLGFTLVAPQHRRSHVFQFMIEEVIDRVLAAQGVCGWDVCAYNERVLGFSDMVGALLHAHADCTVTEIDTQSYSVVEMHGPAGG
>NZ_CP015079.1|WP_068109404.1|2306356_2306734_+|response-regulator
MPTVLIVDDDDDVRMVTSLSLSRVGGWDVLEASRGREAIDLARAAQPDAILLDLMMPEMDGITAFGLLQEDAATRHIPVILLTAKSRVGATQPWDGLAVAGVLAKPFSPMQLPGDVAALLGWETT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP015079_8

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015079_8

2349661-2349858

Orphan

Consensus_repeat	Method
CNNCNGCAACGGCAACGG	CRT

4 spacers

The CRISPR arrays of NZ_CP015079_8

>merge|NZ_CP015079|8|2349661-2349858|CRT
CAAGAGCAACGGCAACGGGCCGGGCGCCAACAGTGCCGGCGGCAACAGCAACGGCAACGGCAACGGCAACGCCACCGGCCCCGGCGCGAACAGCAACGGCAACGGGCCGGGCGCGAACAGTGCCGGCGGCAACGGCAACAGCAACAGCAACAGCAACAGCAACGACGGCGCCACCGGCCCCGGCGCGAACAGCAACGG

>NZ_CP015079|8|1|2349661-2349858|CRT
CAAGAGCAACGGCAACGG	GCCGGGCGCCAACAGTGCCGGCGG
CAACAGCAACGGCAACGG	CAACGGCAACGCCACCGGCCCCGGCGC
GAACAGCAACGGCAACGG	GCCGGGCGCGAACAGTGC
CGGCGGCAACGGCAACAG	CAACAGCAACAGCAACAGCAACGACGGCGCCACCGGCCC
CGGCGCGAACAGCAACGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015079.1\|WP_068114761.1\|2343291_2343480_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015079.1\|WP_068109471.1\|2344314_2344785_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379164
NZ_CP015079.1\|WP_068109461.1\|2341452_2342307_+\|type-II-secretion-system-F-family-protein	unknown	unknown	gnl\|CDD\|227300
NZ_CP015079.1\|WP_169834694.1\|2347912_2349220_+\|CAP-domain-containing-protein	unknown	unknown	gnl\|CDD\|349398
NZ_CP015079.1\|WP_068109487.1\|2350631_2351288_+\|class-F-sortase	unknown	unknown	gnl\|CDD\|320678
NZ_CP015079.1\|WP_068109511.1\|2358330_2359233_+\|amidohydrolase	unknown	unknown	gnl\|CDD\|368185
NZ_CP015079.1\|WP_068109503.1\|2355586_2356501_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|225088
NZ_CP015079.1\|WP_068109505.1\|2356555_2357812_+\|M23-family-metallopeptidase	unknown	unknown	gnl\|CDD\|223810
NZ_CP015079.1\|WP_068109464.1\|2342303_2343245_+\|type-II-secretion-system-F-family-protein	unknown	unknown	gnl\|CDD\|366122
NZ_CP015079.1\|WP_068109494.1\|2351847_2352966_+\|peptide-chain-release-factor-2	unknown	unknown	gnl\|CDD\|234799
NZ_CP015079.1\|WP_068109468.1\|2343877_2344318_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015079.1\|WP_157520082.1\|2359261_2361361_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|341066
NZ_CP015079.1\|WP_068109490.1\|2351342_2351813_+\|CAP-domain-containing-protein	unknown	unknown	gnl\|CDD\|349398
NZ_CP015079.1\|WP_068114763.1\|2343488_2343881_+\|pilus-assembly-protein	unknown	unknown	gnl\|CDD\|377921
NZ_CP015079.1\|WP_068109500.1\|2354826_2355516_+\|cell-division-ATP-binding-protein-FtsE	unknown	unknown	gnl\|CDD\|225438
NZ_CP015079.1\|WP_157520073.1\|2338522_2339692_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015079.1\|WP_068109477.1\|2346498_2347812_+\|cation:proton-antiporter	unknown	unknown	gnl\|CDD\|223104
NZ_CP015079.1\|WP_068109496.1\|2352990_2354712_-\|fibronectin-type-III-domain-containing-protein	unknown	unknown	gnl\|CDD\|238020
NZ_CP015079.1\|WP_068109508.1\|2357858_2358338_+\|SsrA-binding-protein-SmpB	unknown	unknown	gnl\|CDD\|376590
NZ_CP015079.1\|WP_068109474.1\|2344902_2346423_+\|GntP-family-permease	unknown	unknown	gnl\|CDD\|225330

Protein	Function_ID	Function_description	E-value
NZ_CP015079.1\|WP_068109511.1\|2358330_2359233_+\|amidohydrolase	gnl\|CDD\|368185	pfam04909, Amidohydro_2, Amidohydrolase. These proteins are amidohydrolases that are related to pfam01979.	1.07692e-25
NZ_CP015079.1\|WP_068109471.1\|2344314_2344785_+\|hypothetical-protein	gnl\|CDD\|379164	pfam13400, Tad, Putative Flp pilus-assembly TadE/G-like. This is an N-terminal domain on a family of putative Flp pilus-assembly proteins. The exact function is not known. The Flp-pilus biogenesis genes include the Tad genes, and some members of this family are putatively assigned as being TadG.	0.000511081
NZ_CP015079.1\|WP_068109461.1\|2341452_2342307_+\|type-II-secretion-system-F-family-protein	gnl\|CDD\|227300	COG4965, TadB, Flp pilus assembly protein TadB [Intracellular trafficking and secretion].	1.22104e-14
NZ_CP015079.1\|WP_169834694.1\|2347912_2349220_+\|CAP-domain-containing-protein	gnl\|CDD\|349398	cd05379, CAP_bacterial, Bacterial CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain proteins. Little is known about bacterial and archaeal members of the CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain family. The wider family of CAP domain containing proteins includes plant pathogenesis-related protein 1 (PR-1), cysteine-rich secretory proteins (CRISPs), and allergen 5 from vespid venom, among others. Studies of eukaryotic proteins show that CAP domains have several functions, including the binding of cholesterol, lipids and heparan sulfate. This group includes Borrelia burgdorferi outer surface protein BB0689, which does not bind to cholesterol, lipids, or heparan sulfate, and whose function is unknown.	1.79172e-12
NZ_CP015079.1\|WP_068109487.1\|2350631_2351288_+\|class-F-sortase	gnl\|CDD\|320678	cd05829, Sortase_F, Sortase domain found in the class F family of sortases. Class F sortases are mainly present in Actinobacteria, Chlorobacteria and Firmicutes. Their functions are largely unknown.	1.04567e-32
NZ_CP015079.1\|WP_068109503.1\|2355586_2356501_+\|ABC-transporter-permease	gnl\|CDD\|225088	COG2177, FtsX, Cell division protein [Cell division and chromosome partitioning].	5.5331e-46
NZ_CP015079.1\|WP_068109490.1\|2351342_2351813_+\|CAP-domain-containing-protein	gnl\|CDD\|349398	cd05379, CAP_bacterial, Bacterial CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain proteins. Little is known about bacterial and archaeal members of the CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain family. The wider family of CAP domain containing proteins includes plant pathogenesis-related protein 1 (PR-1), cysteine-rich secretory proteins (CRISPs), and allergen 5 from vespid venom, among others. Studies of eukaryotic proteins show that CAP domains have several functions, including the binding of cholesterol, lipids and heparan sulfate. This group includes Borrelia burgdorferi outer surface protein BB0689, which does not bind to cholesterol, lipids, or heparan sulfate, and whose function is unknown.	7.83142e-23
NZ_CP015079.1\|WP_068109496.1\|2352990_2354712_-\|fibronectin-type-III-domain-containing-protein	gnl\|CDD\|238020	cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.	2.90385e-06
NZ_CP015079.1\|WP_068114763.1\|2343488_2343881_+\|pilus-assembly-protein	gnl\|CDD\|377921	pfam07811, TadE, TadE-like protein. The members of this family are similar to a region of the protein product of the bacterial tadE locus. In various bacterial species, the tad locus is closely linked to flp-like genes, which encode proteins required for the production of pili involved in adherence to surfaces. It is thought that the tad loci encode proteins that act to assemble or export an Flp pilus in various bacteria. All tad loci but TadA have putative transmembrane regions, and in fact the region in question is this family has a high proportion of hydrophobic amino acid residues.	1.45944e-06
NZ_CP015079.1\|WP_068109464.1\|2342303_2343245_+\|type-II-secretion-system-F-family-protein	gnl\|CDD\|366122	pfam00482, T2SSF, Type II secretion system (T2SS), protein F. The original family covered both the regions found by the current model. The splitting of the family has allowed the related FlaJ_arch (archaeal FlaJ family) to be merged with it. Proteins with this domain in form a platform for the machiney of the Type II secretion system, as well as the Type 4 pili and the archaeal flagella. This domain seems to show some similarity to PF00664 but this may just be due to similarities in the TM helices (personal obs: C Yeats).	3.32596e-09
NZ_CP015079.1\|WP_068109474.1\|2344902_2346423_+\|GntP-family-permease	gnl\|CDD\|225330	COG2610, GntT, H+/gluconate symporter and related permeases [Carbohydrate transport and metabolism / Amino acid transport and metabolism].	1.31163e-61
NZ_CP015079.1\|WP_157520082.1\|2359261_2361361_+\|hypothetical-protein	gnl\|CDD\|341066	cd09603, M1_APN_like, Peptidase M1 family similar to aminopeptidase N catalytic domain. This family contains mostly bacterial and some archaeal M1 peptidases with smilarity to the catalytic domain of aminopeptidase N (APN; CD13; alanyl aminopeptidase; EC 3.4.11.2), a type II integral membrane protease belonging to the M1 gluzincin family. APN preferentially cleaves neutral amino acids from the N-terminus of oligopeptides and, in higher eukaryotes, is present in a variety of human tissues and cell types (leukocyte, fibroblast, endothelial and epithelial cells). APN expression is dysregulated in inflammatory diseases such as chronic pain, rheumatoid arthritis, multiple sclerosis, systemic sclerosis, systemic lupus erythematosus, polymyositis/dermatomyosytis and pulmonary sarcoidosis, and is enhanced in tumor cells such as melanoma, renal, prostate, pancreas, colon, gastric and thyroid cancers. It is predominantly expressed on stem cells and on cells of the granulocytic and monocytic lineages at distinct stages of differentiation, thus considered a marker of differentiation. Thus, APN inhibition may lead to the development of anti-cancer and anti-inflammatory drugs. APNs are also present in many pathogenic bacteria and represent potential drug targets. Some APNs have been used commercially, such as one from Lactococcus lactis used in the food industry. APN also serves as a receptor for coronaviruses, although the virus receptor interaction site seems to be distinct from the enzymatic site and aminopeptidase activity is not necessary for viral infection. APNs have also been extensively studied as putative Cry toxin receptors. Cry1 proteins are pore-forming toxins that bind to the midgut epithelial cell membrane of susceptible insect larvae, causing extensive damage. Several different toxins, including Cry1Aa, Cry1Ab, Cry1Ac, Cry1Ba, Cry1Ca and Cry1Fa, have been shown to bind to APNs; however, a direct role of APN in cytotoxicity has been yet to be firmly established.	5.78442e-78
NZ_CP015079.1\|WP_068109505.1\|2356555_2357812_+\|M23-family-metallopeptidase	gnl\|CDD\|223810	COG0739, NlpD, Membrane proteins related to metalloendopeptidases [Cell envelope biogenesis, outer membrane].	3.04385e-30
NZ_CP015079.1\|WP_068109500.1\|2354826_2355516_+\|cell-division-ATP-binding-protein-FtsE	gnl\|CDD\|225438	COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning].	6.58358e-122
NZ_CP015079.1\|WP_068109477.1\|2346498_2347812_+\|cation:proton-antiporter	gnl\|CDD\|223104	COG0025, NhaP, NhaP-type Na+/H+ and K+/H+ antiporters [Inorganic ion transport and metabolism].	4.64187e-36
NZ_CP015079.1\|WP_068109508.1\|2357858_2358338_+\|SsrA-binding-protein-SmpB	gnl\|CDD\|376590	pfam01668, SmpB, SmpB protein.	3.92774e-87
NZ_CP015079.1\|WP_068109494.1\|2351847_2352966_+\|peptide-chain-release-factor-2	gnl\|CDD\|234799	PRK00578, prfB, peptide chain release factor 2; Validated.	0

>NZ_CP015079.1|WP_169834694.1|2347912_2349220_+|CAP-domain-containing-protein
MNRDRRLALAALALTAGLVALVPVASNAGHPAGAAQETAQQRVPATASRAEVRRDYLDVWLPLQKIPTTWTGGDVATCQEGRTGGQTQQGILDAVNYARDLAGLGPVVMNAAWSAKAQKAALMMHAANRLSHSPDPGWPCWSEEGSEAAGRSNLYLGRTGVPSIGGYLDDPGSNNAAVGHRSWILDPDIVRVGAGSTSGANALWVVDTQWPSSGHTEPVTWPTAGWFPRPLLPISGRWSLSTVPADPRSLESAVVHVSVDGGPRVLADVEYRSRSRVVYAVPGLGSNVGDRRVVVSISGVELDEAPTADIGYEVRLLDPDQAAPTPTPTTSPSPSPTVTPTATTPTAAGRVGIRGRARPRSTLRAKVPTFDPSSSVVSLQWLSDGKELRGRTGPRLVLRGRDVGHRISLQVTAVHEVDGSTEETVVVSTAKVVRR
>NZ_CP015079.1|WP_068109477.1|2346498_2347812_+|cation:proton-antiporter
MTADLVYLVAGASLLLAIVLPSSLSRLPLTSPMVLVAVGMLLGATSLPDDLPLSPQDNRAAIEHITEITVLVALMGVGLALDRPFDPRQRASRRAWSPTWRLLAIAMPLSIAGVALLGWWAGLAPAVAILLGAVLAPTDPVLASDVQVGGPATHALDEVDDCAPIDEDDEVRFALTAEAGLNDGLAFPFVYLAVLVAGGGALGATTLEWLGWYLLGKTVIGVVVGVAVGWVLARLAFRASSPALRVADRGEPLLAVAALATSYGAAEALGGYGFLAVFACAMTFRASERRHDYHRAMHEVVERLERLLTLFVLLVLGIALTRGLLEALDWRGVTIGLGLVLVIRPLAAYLALSVLPVPAGERGGLTRAERSATAFFGVRGVGSLFYLAYAAGQVDAFGQPWLWSTVGFTIVASVLVHGAASGWVMKRLEGQPRVTSR
>NZ_CP015079.1|WP_068109474.1|2344902_2346423_+|GntP-family-permease
MIGLAGIILSLVLLIVFAYRGVNVIILAPLMALLATAFAGGLPMLATYTQVFMPALGNYLITYFPLFLLGALFGKLMDDSGAARAIAYFIVEKLGDTKAILAIVLACGILTYGGVSLFVVAFAVFPIAAALFREAGVPKRLIPATIALGSFTFTMTALPGTPQIQNAIPAPFFGTNAFAAPGLGIIAALIMFGGGTAWLMYRAKRLTAAGEVYLPEEAPKGGGLLSRFRGKKTDRDAPSGAVDQAGPIPGGSGTATATATTTEPVAVDQSTLPRPSVLIAFLPIFVVIALNYVLVTWVFPAMDTDYLSGDAYGNTDIDTVGGIWAIVVALVVSCLLVVATNVSRFGDVKESVNSGTMGSFLPIFNTASEVGYGAVIASLPAFRTVRDSVLGISNNPVISLAVAVNVLAGITGSASGGMSIALQTLGEQFRGLADAQGISLELMHRVTVLAAGGFDALPHNGAVVTVLAICGLTHRQSYKDIFVVAVAIPLVALVVVITLGTAFGGF
>NZ_CP015079.1|WP_068109471.1|2344314_2344785_+|hypothetical-protein
MRRRRRGHHSRGRDERGQVTVLIIGFAFVLALGVAVVVDASAAYLQRSGLSTLADGAALYGADAGATGASTYTEGVPEGQLALDADVARAGVADYLRSVGAYEEYPGLRVLIQVDPARSAVEVRVSAPLDLPLGLPGAPESPTVSAEGSAVSDVER
>NZ_CP015079.1|WP_068109468.1|2343877_2344318_+|hypothetical-protein
MSRPRDEEGSALVELVWLGILLLVPLLWIVVSVFDVQRGAFGTESAARSAARAYALAPDDASGRERAHAAARQALADQGLDGAPVDVEVSCRGLADCHSGTSVITVRVGSRVDLPLMPDVLGGGAPSFALSSSHTVPIGQYQEITR
>NZ_CP015079.1|WP_068114763.1|2343488_2343881_+|pilus-assembly-protein
MRHDRRSTGARGAAIVDFVLVLVVLVPLVLGILQVSLVLLVRNTLAAAAADGARYAATAGRGEADGAARTRDQIAGAISGRFAQDVSARTVLVDGAPTVVVTVRASVPALGLGGPGVDIQVAGHAVEEEQ
>NZ_CP015079.1|WP_068114761.1|2343291_2343480_+|hypothetical-protein
MVLLWLALVAPAPHRSARRDERGDVPGWVLVTVMSAGIVVAIGSIAQDELSQMLRNALNKVK
>NZ_CP015079.1|WP_068109464.1|2342303_2343245_+|type-II-secretion-system-F-family-protein
MSLTMWGALLGATTGAGLLLVLARLRVVRRPQLAARVLPYVRDLPQGVGPGAARSTGAGTEPVAVAVFGPVLRSLARSIERVLGGSASVRRRLHRAGLDRTVHEFRIEQVQWGLVAFAVAAAWGLLRTLGDPGAVVSSALVCALAFVAGVLGRDHHLSEQVHTRERRILAEFPTVAELLALAVAAGESPVGALDRVVSRSGGELSADLARVLAEVRTGEPVGAAFDTLAASSGLPLVSRFAQGIATAVERGTPLADVLHAQAADVREAGRRELIESAARREVLMMVPVVFLVLPVTILFAFWPGVVGLDLTTP
>NZ_CP015079.1|WP_068109461.1|2341452_2342307_+|type-II-secretion-system-F-family-protein
MGALVGLGVGVGLLLIWSAFAMPRRPRPVATGPGRTARLLGSAGLGGVSVTSFVLLCLGCGAGVAVLVQLVSGTPPVALVFGVLAAYLPVTVVAARARRRLREFAEVWPEAVDNLASAVRAGMSLPDALAALGGRGPEPLRAAFVAFALDYQVSGRFGESLDRLKDRLADPVGDRVVEGLRVAREVGGGELGRLLRNLSGYLREDSRTRSELESRQAWTVNGARLAVAAPWVVLLLMSLQSDVIRRYASPTGVVVLAVGAGLCVVAYRLMMRIGRLPTERRILS
>NZ_CP015079.1|WP_157520073.1|2338522_2339692_-|hypothetical-protein
MLKAPVPDELVWARVTRPPVSLVYLDLNHYIEIAKASRAADGHVMDSGRPITVLPGYTDLLAAARRAKADRRAMFPLSAVHFMEVAHSVPSPRQRGHVADVMEELSDFTYLLGRPSIVEMEIAAGLDKVYGTPPRYALMPLLGDSALWAFGRSGGFRFFNEITGEDTEAQLREELGDEAFENQLVEMRYFMERKLLEGPQDSEIADLRACGYAPETFQVSAQSRLAFELETSATLEKYPSWRRGRLRDLIFAREVTHEGMTAFIHHLQQREEDGLPHELPKDTEMVALWAAMPHIQVATTMKTRYHRNPGHRWKTNHIADIDALAVAYAYCDALLTDAEARTALSSAPELRGFGAHLPLNAAEMAGWIDKLPNLASPDDHVLHPLRGSA
>NZ_CP015079.1|WP_068109487.1|2350631_2351288_+|class-F-sortase
MAETSPARRTTSWVLTAAAVVLVGAGIVTWREQEPTPAGASEEGASAVGERALVSEAELPRPRRLARVPGSPRRLRVPALEVDVPVVAVGTRRDTLIPPTDPQQVGWWGEGAKPGAATGRALLAGHTVSSGGGALDDLETLVEGSEVVVTGDRGQVDYEVLSVRTFGKGRLAQQSERLFRQRGPGRLVLLTCEDWDGERYLSNVVVVARPTGRSSAGS
>NZ_CP015079.1|WP_068109490.1|2351342_2351813_+|CAP-domain-containing-protein
MSSRPLPSATWRATVVVAVVAAVLLTLVPPVSAKTAAGFQGGVRSRTNAVRVERDLPQLRKESCVQKYAARQARRMAKQGKMFHQDLKPVLRNCSLTSVGENVAYGYSSATDVLKAWMDSAPHRANIVKKRYRLLGVGARKSASGTWYLAQVFGRK
>NZ_CP015079.1|WP_068109494.1|2351847_2352966_+|peptide-chain-release-factor-2
MAGTDYDLEIKQLQATMRTIEQVLDIDAMRQEIVDLGEQVGAADLWDDQENATRVTGRLSLLQGQVDRFAELSSRIEDLEALVELGVEEGDADSMAEAERDLVKIKKSVEQLEVRTLLSGEYDVREALITIRAGAGGVDAADFAETLMRMYTRWAEQHKYPVDVFDTSYAEEAGLKSATFAVRAPYAYGTLSVEAGTHRLVRISPFDNQGRRQTSFAAVEVVPVFEQTDAIEVPDEEIRTDVYRSGGPGGQSVNTTDSAVRLTHIPTGIVVSCQNEKSQLQNKASAMVVLKAKLLARKKAEEKAHLDEMRGDVQASWGDQMRNYVLNPYQVVKDLRTSYEVGNPQAVFDGDIDGFLEAGIRWRMGAEKAGAS
>NZ_CP015079.1|WP_068109496.1|2352990_2354712_-|fibronectin-type-III-domain-containing-protein
MRRPPGRSRPLLAALAAALAAALALPAAGAAGSAAPAPDGDRLLEDAARVNDMTPAALRRLLAEDDTAALSSSGRVFFRDRRVARPDSGATPPKASLPQSQTFLLHSFPGAQRTIYLDFDGATVTGTGWNDQGLKTSPLLGFSLDGSYSTFNAEEHALIQTVWQRVAEDYAPFAVDVTTQPPAPGAIDRAGPGDQVYGTTALVTGDREALDTICPGSTCSGVGFLDVFDETSGHAYYQPALTFTAESSDVFNITETISHEVGHNLGLDHDGNASEEYDAGNGLWAPIMGSGYAPITQWSNGDYPGADNKGDDLVDIAANGAPMRADDAGGTPATAAALTATRGVISTRTDVDVYRLGTCSGSVSVTATPTSTSPDLDIELRLLPASGPALATSNPPAGTGDGETASGMGAALTHSASGQELFAAVDGVGHGTPSTGYSDYGSLGFYDLAVTGCGYGPDPEPEPEPEPEPEVTAPDAPTIGKARPGRRGKPLTIKISWSAPADDGGAAVTAYEVSAHKVDKRGQVRQTRTAEEPSTTRKVQYLMPRGRWAFTVVAVNSAGQGAASAMSRSVRAR
>NZ_CP015079.1|WP_068109500.1|2354826_2355516_+|cell-division-ATP-binding-protein-FtsE
MIRFEKVTKTYPGAGGHALDEVSVDVEKGEFVFLVGSSGSGKSTALRLILRESRPTSGRVYVAGKEINRLAGWKVPRLRRQIGTVFQDFRLLPSKTVAENVAFAMQVTGHSPKEVRALVPETLELVGLDTKADRMPDELSGGEQQRVAIARAFVNRPMILIADEPTGNLDPTTSVGIMKLLDRINRTGTTVVMATHDHGIVDQMRKRVIELDHGKVIRDQAQGAYGFQH
>NZ_CP015079.1|WP_068109503.1|2355586_2356501_+|ABC-transporter-permease
MRYVFSNLGQGLRRNLSMHLAVILTLFVSLTLVGAGALLNRQAEKTSDQLGSELEITAYLCRDSDPNQSCQGEVTGAEKKRIIQAVEDNPEVASYRLESQETAFEKVKELYGPEEADRFEGPNAILTAEDLPESIWITLENPAEFEGITSAIVGLDGVAKLVDQRETAGKIINTMEAMQRAALGIALLLVISALLLVANTIRLAAFARRREIGIMRLVGASTLYIALPFLLEALVTAAISVVLAGGALAGFQYFGIEQRFSGYLEFIPWVGWDDYLVALGVVAVLGPILTLLPTLALTRKYIKV
>NZ_CP015079.1|WP_068109505.1|2356555_2357812_+|M23-family-metallopeptidase
MRSFPSASRHRLATAATAGALVLGALAVPLAHADDDLKDQQRQVQKQINGAAEDLEESSKRTRQAYAAMTAAREKLDSAKAELGAVRTKLGDARLEDARMAERLATARLRLESARDELVEGQAALERQRGVVKDRIADTYMQGSPDLLVLGSLLNSSSTSDLTRQQSASSVIVGRETSMYDDLDAAEVLLQVREDDVEEAKDQVADERAAAAAHLSKVKSLTAQAVQVRDEVRGLVGKRLAARREATRAQQADRAALASLRKQEARIKARIAAAARRARGTSVSAKPSGYLQRPVGGTVTSPFGYRTHPIYGYRGLHDGTDFGVSCGQPMAAAGTGTVIAKYYSSVYGNRLFLNLGQVNGRSLTVVYNHARSYRYNVGARVSRGQTIGYVGDTGWSTGCHLHLSVLVNGTAVDPLNWM
>NZ_CP015079.1|WP_068109508.1|2357858_2358338_+|SsrA-binding-protein-SmpB
MAREQGQKMVAQNKKARHDYAIEDTFEAGLVLQGTEVKSLRMGRASLVDGFVDIDRNEAWLLNVHIPEYTQGTWTNHAARRKRKLLLNRAEIDKIERRVNEKGLTVIPLSLYFVDGRAKVEIGLAKGKKSWDKRHTIAERTAKREVEQAVGRRLKGMSD
>NZ_CP015079.1|WP_068109511.1|2358330_2359233_+|amidohydrolase
MTDGSGPSPEAWSAEVEQVTAFWRGLGLPGLLDVHTHFLPANIQRRVWAQFDDAGPKIGRAWPIRYRGSTEERVEQLRELGVRRFSSLPYAHRPGIAGYLNDWATTFKQQVPESLWSATFYPEPEAARYVAAGLAVGVEIFKVHVQVGEFDLDDPLLDPVWGLLAEAGTPVVVHAGHAPVGNDFTGPAPMARVLAAHPRLCLVVAHLGAPDYLDFMSFADTYDRVHLDTTMTFTDFWETTYPDGMLARLADLGDRILLGTDFPTIPYPYGHQLEGLARLDLGDDWLRAVCWHNAEALVGR
>NZ_CP015079.1|WP_157520082.1|2359261_2361361_+|hypothetical-protein
MTVSRALLGPLALVLAVALSGAAGPVAAGLPDGGAGPGSPGIGDPYWPRDGNGGYDVDHYDLDLRYRPGSKQLSGVSTISARSTRALSRFHLDLVGMQVTHVNVDGRPARWDRRGQELRITPRRAISRDTDFAVAVTYAGRPGRAGQGRFDEGWISLPDGAIVAGEPHSATSWFPSNDHPTDRARYTFRIEVPAALSVVANGRLEGTEEHGRTTTWTWRADEPMASYLTTVGIGDYDVTTYEEDGLRFHDAIDAGLPGRLSSPSTGTRLAVARGSNNAYQRLARRIEVPPDGATMAFDLARDTEPGFDFVFVEAHTVGRDDWTTLRDLGGHTSSRTGRQCATWSEERPFIVEHYQSQRRRSCRPVGPTGEWWAASGAGDGIERWEVDLGPYAGSEVEVSITYLTDGSFRGAGVTVDDVEVSAGVGSTSFEGGLEGWTVPGPPEGDAANRTDWRVGSTDDVPAGVGEKARRALARQPEIVRYLSGLFGEYPWRDVGGIVEDSGVGFALETQTRPVYESGFFASVSGGSSLIVHELAHQWFGDSLTVKRWKHIWLNEGFASYTQWLWSEAEGRASAAELAWRSWRSMPQGSDYWDLRIGAPGRDNLFDGAVYNRGALTLHALRVRVGDETFFRILQGWPTARAGQDVTTRQFVRYAERVAGRDLDGLFRRWLFTPKRPDFPGARPSADRRTVRDVPVVAHR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP015079_9

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015079_9

3830171-3830575

Orphan

Consensus_repeat	Method
GACCCGCTGGACCCCGACACCGACGACGACGGGCTC	CRISPRCasFinder

5 spacers

The CRISPR arrays of NZ_CP015079_9

>merge|NZ_CP015079|9|3830171-3830575|CRISPRCasFinder
GACCCGCGCAACCCCGACACGGACGGCGACAAGCTCCTCGACGGCGCCGAGGTCAACACCCACGACACGGACCCGCTGGACCCCGACACCGACGACGACGGGCTCGACGACGGTGACGAGGTGCGCGTCCACTACACCGACCCGCTGGACCCCGACACCGACAACGACGGGCTCAAGGACGGCCGCGAGGTGCACGAGACCAAGGCCGACCCGTTGAAGAAGGACACCGACGGCGACGGCCTCAGCGACGGGCGCGAGGTCAAGAAGTTCAAGACCAAGCCGCACAAGAAGGACACCGACAAGGACGGGCTCAACGACCGCGTGGAGGTCAAGGGCAGCGCCAACAAGCGCTACGACAAGTGCCCGACGAACCCGCGGAAGAAGGACACCGACAAGGACGGCCTG

>NZ_CP015079|9|8|3830171-3830575|CRISPRCasFinder
GACCCGCGCAACCCCGACACGGACGGCGACAAGCTC	CTCGACGGCGCCGAGGTCAACACCCACGACACG
GACCCGCTGGACCCCGACACCGACGACGACGGGCTC	GACGACGGTGACGAGGTGCGCGTCCACTACACC
GACCCGCTGGACCCCGACACCGACAACGACGGGCTC	AAGGACGGCCGCGAGGTGCACGAGACCAAGGCC
GACCCGTTGAAGAAGGACACCGACGGCGACGGCCTC	AGCGACGGGCGCGAGGTCAAGAAGTTCAAGACC
AAGCCGCACAAGAAGGACACCGACAAGGACGGGCTC	AACGACCGCGTGGAGGTCAAGGGCAGCGCCAACAAGCGCTACGACAAGTGCCCGACG
AACCCGCGGAAGAAGGACACCGACAAGGACGGCCTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015079.1\|WP_084527797.1\|3831836_3832712_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369777
NZ_CP015079.1\|WP_157520291.1\|3842931_3843111_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015079.1\|WP_068112853.1\|3823265_3824873_+\|anion-permease	unknown	unknown	gnl\|CDD\|273267
NZ_CP015079.1\|WP_157520294.1\|3843188_3844955_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015079.1\|WP_084527795.1\|3830836_3831838_-\|aminoglycoside-phosphotransferase-family-protein	unknown	unknown	gnl\|CDD\|270703
NZ_CP015079.1\|WP_068112872.1\|3836740_3840949_-\|DUF3367-domain-containing-protein	unknown	unknown	gnl\|CDD\|378735
NZ_CP015079.1\|WP_068112836.1\|3818293_3819277_+\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|235640
NZ_CP015079.1\|WP_068112845.1\|3821936_3823211_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|236215
NZ_CP015079.1\|WP_068112841.1\|3821314_3821737_+\|SRPBCC-domain-containing-protein	unknown	unknown	gnl\|CDD\|176864
NZ_CP015079.1\|WP_157520628.1\|3840945_3841695_-\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|369777
NZ_CP015079.1\|WP_084527803.1\|3835625_3836855_+\|acyltransferase	unknown	unknown	gnl\|CDD\|224748
NZ_CP015079.1\|WP_068112858.1\|3826192_3827695_-\|30S-ribosomal-protein-S1	unknown	unknown	gnl\|CDD\|236126
NZ_CP015079.1\|WP_068112839.1\|3819301_3820627_-\|glycosyl-hyrolase-family-3	unknown	unknown	gnl\|CDD\|366376
NZ_CP015079.1\|WP_157520288.1\|3825918_3826086_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015079.1\|WP_068112855.1\|3824880_3825825_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|181818
NZ_CP015079.1\|WP_068112865.1\|3832784_3833657_-\|DUF3068-domain-containing-protein	unknown	unknown	gnl\|CDD\|371444
NZ_CP015079.1\|WP_068115265.1\|3841754_3842906_+\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340831
NZ_CP015079.1\|WP_068115261.1\|3820623_3821214_-\|dephospho-CoA-kinase	unknown	unknown	gnl\|CDD\|234620
NZ_CP015079.1\|WP_068112869.1\|3833811_3835629_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|370749
NZ_CP015079.1\|WP_068112833.1\|3815874_3818043_+\|S9-family-peptidase	unknown	unknown	gnl\|CDD\|224684

Protein	Function_ID	Function_description	E-value
NZ_CP015079.1\|WP_084527797.1\|3831836_3832712_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	2.85277e-22
NZ_CP015079.1\|WP_068112853.1\|3823265_3824873_+\|anion-permease	gnl\|CDD\|273267	TIGR00785, Uncharacterized_transporter_HI_0020, anion transporter. The Divalent Anion:Na+ Symporter (DASS) Family (TC 2.A.47) Functionally characterized proteins of the DASS family transport (1) organic di- and tricarboxylates of the Krebs Cycle as well as dicarboxylate amino acid, (2) inorganic sulfate and (3) phosphate. The animal NaDC-1 cotransport 3 Na+ with each dicarboxylate. Protonated tricarboxylates are also cotransported with 3Na+. [Transport and binding proteins, Anions, Transport and binding proteins, Cations and iron carrying compounds].	2.54425e-72
NZ_CP015079.1\|WP_084527795.1\|3830836_3831838_-\|aminoglycoside-phosphotransferase-family-protein	gnl\|CDD\|270703	cd05154, ACAD10_11_N-like, N-terminal domain of Acyl-CoA dehydrogenase (ACAD) 10 and 11, and similar proteins. This subfamily is composed of the N-terminal domains of vertebrate ACAD10 and ACAD11, and similar uncharacterized bacterial and eukaryotic proteins. ACADs are a family of flavoproteins that are involved in the beta-oxidation of fatty acyl-CoA derivatives. ACAD deficiency can cause metabolic disorders including muscle fatigue, hypoglycemia, and hepatic lipidosis. There are at least 11 distinct ACADs, some of which show distinct substrate specificities to either straight-chain or branched-chain fatty acids. ACAD10 is widely expressed in human tissues and highly expressed in liver, kidney, pancreas, and spleen. ACAD10 and ACAD11 are both significantly expressed in human brain tissues. They contain a long N-terminal domain with similarity to phosphotransferases with a Protein Kinase fold, which is absent in other ACADs. They may exhibit multiple functions in acyl-CoA oxidation pathways. ACAD11 utilizes substrates with carbon chain lengths of 20 to 26, with optimal activity towards C22CoA. ACAD10 may be associated with an increased risk in type II diabetes. The ACAD10/11-like subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	2.04625e-18
NZ_CP015079.1\|WP_068112872.1\|3836740_3840949_-\|DUF3367-domain-containing-protein	gnl\|CDD\|378735	pfam11847, DUF3367, Domain of unknown function (DUF3367). This domain is functionally uncharacterized. This domain is found in bacteria and archaea. This presumed domain is typically between 667 to 694 amino acids in length.	0
NZ_CP015079.1\|WP_068112836.1\|3818293_3819277_+\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|235640	PRK05901, PRK05901, RNA polymerase sigma factor; Provisional.	2.1851e-105
NZ_CP015079.1\|WP_068112845.1\|3821936_3823211_+\|AMP-binding-protein	gnl\|CDD\|236215	PRK08276, PRK08276, long-chain-fatty-acid--CoA ligase; Validated.	7.41722e-97
NZ_CP015079.1\|WP_068112841.1\|3821314_3821737_+\|SRPBCC-domain-containing-protein	gnl\|CDD\|176864	cd07822, SRPBCC_4, Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins. Uncharacterized group of the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands. SRPBCC domains include the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD1-STARD15, the C-terminal catalytic domains of the alpha oxygenase subunit of Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs_alpha_C), Class I and II phosphatidylinositol transfer proteins (PITPs), Bet v 1 (the major pollen allergen of white birch, Betula verrucosa), CoxG, CalC, and related proteins. Other members of the superfamily include PYR/PYL/RCAR plant proteins, the aromatase/cyclase (ARO/CYC) domains of proteins such as Streptomyces glaucescens tetracenomycin, and the SRPBCC domains of Streptococcus mutans Smu.440 and related proteins.	2.95406e-32
NZ_CP015079.1\|WP_157520628.1\|3840945_3841695_-\|methyltransferase-domain-containing-protein	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	6.50029e-20
NZ_CP015079.1\|WP_084527803.1\|3835625_3836855_+\|acyltransferase	gnl\|CDD\|224748	COG1835, COG1835, Predicted acyltransferases [Lipid metabolism].	2.15709e-31
NZ_CP015079.1\|WP_068112858.1\|3826192_3827695_-\|30S-ribosomal-protein-S1	gnl\|CDD\|236126	PRK07899, rpsA, 30S ribosomal protein S1; Reviewed.	0
NZ_CP015079.1\|WP_068112839.1\|3819301_3820627_-\|glycosyl-hyrolase-family-3	gnl\|CDD\|366376	pfam00933, Glyco_hydro_3, Glycosyl hydrolase family 3 N terminal domain.	1.7473e-55
NZ_CP015079.1\|WP_068112855.1\|3824880_3825825_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|181818	PRK09393, ftrA, transcriptional activator FtrA; Provisional.	2.94957e-108
NZ_CP015079.1\|WP_068112865.1\|3832784_3833657_-\|DUF3068-domain-containing-protein	gnl\|CDD\|371444	pfam11271, DUF3068, Protein of unknown function (DUF3068). Some members in this family of proteins with unknown function are annotated as membrane proteins however this cannot be confirmed.	1.21439e-57
NZ_CP015079.1\|WP_068115265.1\|3841754_3842906_+\|glycosyltransferase-family-4-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	6.94755e-56
NZ_CP015079.1\|WP_068115261.1\|3820623_3821214_-\|dephospho-CoA-kinase	gnl\|CDD\|234620	PRK00081, coaE, dephospho-CoA kinase; Reviewed.	7.65767e-88
NZ_CP015079.1\|WP_068112869.1\|3833811_3835629_+\|hypothetical-protein	gnl\|CDD\|370749	pfam09913, DUF2142, Predicted membrane protein (DUF2142). This domain, found in various hypothetical prokaryotic proteins, has no known function.	4.11988e-05
NZ_CP015079.1\|WP_068112833.1\|3815874_3818043_+\|S9-family-peptidase	gnl\|CDD\|224684	COG1770, PtrB, Protease II [Amino acid transport and metabolism].	0

>NZ_CP015079.1|WP_068112858.1|3826192_3827695_-|30S-ribosomal-protein-S1
MTSTISFLPDYDAPQIAINDIGSEEDFLAAIDATIKYFNDGDIVEGTIVKVDRDEVLLDIGYKTEGVIPSRELSIKHDVDPNEVVAVGDKVEALVLQKEDKEGRLILSKKRAQYERAWGTIEQVKEEDGVVEGTVIEVVKGGLILDIGLRGFLPASLVEMRRVRDLQPYVGQTLEAKIIELDKNRNNVVLSRRAWLEQTQSEVRHGFLTQLQKGQIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSEVVAVGDEVTVEVLDVDMDRERVSLSLKATQEDPWQHFARTHQIGQIVPGKVTKLVPFGSFVRVEEGIEGLVHISELAERHVEIPEQVVQVNDDVMVKIIDIDLERRRISLSLKQANETAAASDVEEFDPTLYGMTATYDDQGNYVYPEGFDSETGEWLEGFDDQRAVWEEQYAKAHARWEAHVKQQAEAKVAENEAGEATSYSSGSGSSSVEDESGEPTESAEGGSLASDEALQALREKLTGGAS
>NZ_CP015079.1|WP_157520288.1|3825918_3826086_+|hypothetical-protein
MSPLLFFLLLVLLVTGVALALLEVIDADDPFFHTDYRPPSSHPDDPFSRPGAWYH
>NZ_CP015079.1|WP_068112855.1|3824880_3825825_-|helix-turn-helix-domain-containing-protein
MQSVAVVVQDGVEPFGLGTLVEVWGEPYHPEDDAPVFDFRVCTPRPGRVRGRSGFDLHVDHGLEAAADADLVCFAPKQDFATHEDAVLEVARAAHDRGALIYAHCTGAFELAAAGVLDGHEATTHWRHTDQLARLYPRVRVRPDVLYVQAGNVLTGAGAAAGIDASLHLMRQQFGARVAATTARRIVVPPQRDGGQAQFIARAVPDCDAATLGPLLTWIVSHLEEDLGVEALARRSMLSPRTFARRFREETGTTPHSWVTHHRVAAAEELLERSSLSVEQVAVRVGFGNAATLRQHFTRVRGVSPQRYRRQFAC
>NZ_CP015079.1|WP_068112853.1|3823265_3824873_+|anion-permease
MTSTDQDIPQRGTDAADGPGRSARHTWGVRALGVVLAAAVYVALGGAELSQDGRVVAAVGALMAAWWMTEALPLAATALLPIALLPALTDALGIADATAPYADPIVFLFLGGFLIAIAMQKWNLHRRIALLTLRRVGTHPRRIILGMMIATAFLSMWVSNTATTLMMLPIALSVLALVVENSAGSNQSTDAAELTERLGGRETMSDVIDDVDVRLFGVALLLSVAWSASIGGLGTLLGSPPNAIVAGYLASELDRDIGFAEWMMLGLPLVVVFLALAWLLITRVIFRFRLESIPGGAELIDTQIAELGAPSRGEKVVLAVFATAAFFWVVPGVLASIGDLGDRAPWLGGFDDTVIAITAGLVMFLIPGDERGRMTLEWHDAEKGLPWGVLLLFGGGLSLASAVAGTGLDAWFGEQVGALGALPIVLLLAAVVALVLMLTEVTSNTATAATFIPVLGGVAGGLGVDPVTLLIPAALAATCAFMLPVGTPPNAIVFGTGAVRIADMARGGAVLNVVGVVLITMFTVLIGPFALDLVL
>NZ_CP015079.1|WP_068112845.1|3821936_3823211_+|AMP-binding-protein
MHPTLPEGSRVALLVPGSLLLLEAVMALLAHGVFPVPLDPRLTAYERERILADVEPTLVVEGERELAALLDRTRPDGPMSGWTPRARPMHVTSGTTGTPKGVCSGLLSPAASATLVDEERDLWGFAATDVNLVLSPLHHSAPLRFAMGTVLAGGRVVVPGPFDPDRITRAIETECPTTMFCVPTHLQRLFAHWDEVGTPDLSRFRLVAHAGAPCPVATKQRLVETFPPGSTWEFYGSTEGQFTACRSEEWLEHPGTVGRARPGRTLHLDDDGTIWCTVPPHARFEYHGAPDKTAAAWRESPDGPAFSVGDVGRLDPEGYLYLDGRRTDLIISGGVNVYPLEVEHALRELEGVDDVAVYAVPDPDWGQRVCAAVVGTATAGQLDAWARERLAPPKRPKTWTTVSDLPRTATGKVLRAALAPHHQG
>NZ_CP015079.1|WP_068112841.1|3821314_3821737_+|SRPBCC-domain-containing-protein
MTTTASTTTTISAPPEHVWALLTDADWWNRADNGVVDVSGTIREGQKIKLVSELDPKRGFALRVAEVQAPRHMVWTGGMPLGLFTGRRTFTLEPAGDAACTFTMAEAFSGLLAPLILRSMPDFQASFDQFASALKTDSEA
>NZ_CP015079.1|WP_068115261.1|3820623_3821214_-|dephospho-CoA-kinase
MRVGLTGGVASGKSTVAAMLAELGAVVIDADALAREVVEQGTPGLAAVVEEFGDQLLTPEGDLDRPAMGRLVFGDDAARKRLEAIVHPLVFERYAALEASAPAGALVVHDIPLLAESGRADGFDAVLVVDVPAETQVERMLQQRGWTREDADSRIAAQATREQRLAIATHVIENTGTLDELRERVQAVHDELGASA
>NZ_CP015079.1|WP_068112839.1|3819301_3820627_-|glycosyl-hyrolase-family-3
MRRPARLAVAAVTLGLALSGCTAAGDDDDTGPASPAASATPDQEDAPAEPVAPAEPVDPDEPTSWGPTEGELAEARELVAEMSPEELAGQVIVGRYAGTDPAVPAQLVSDLHLSGVCVTGDNVVDEAQVRATTAAVSAAVADSGRDFPAVIGVDQEGGTVSHLRGIATEFPAFQTAGRAVDGGGRSGKVAVRDAAYTTGLELRDLGFTWVYAPVADVTIGAADPTIGSRSPSTDPRLAAKATAAAVDGFDRSGTVSTTKHYPGHGGATADSHLTLPGLDAPIEELEKRDLMPFRAATKAGAPSVMIGHLDVEALAPGTPSSIAPEVYDHLRDEVGFEGVAITDSLGMGAVAGIPGLAVKALVAGADLLLMPADTRRTHAHVTKAIASGEVSPERIEEAAARVVALQMWQARVAGGLQVPDDISARAAEAAQALEVAAYAAP
>NZ_CP015079.1|WP_068112836.1|3818293_3819277_+|sigma-70-family-RNA-polymerase-sigma-factor
MATSTATRTAARTVTASTGREIEGRDSVGLYLDEIARNPLLDAAAEVDLSQTIEAGLYAEALLKEGRVGRRKGGAPGRASEEELEWLAEQGRQAVDTFITANLRLVVSIARKYGRAQMPMLDLIQEGNTGLIRAVEKFDYTKGYKFSTYATWWVRQAITRGIAQQARVVRLPVHVVEELNQVGGARRTLERQLGRDPEPGEIALELGMDVDRVLDLLAWGREHVSLDTPVDEDGDTSLGDLMAQETSPGPDLSVIDVESRDRLNALVCHLDDRAADIIRSRYGLSDGRQHKLADIGAKHGISAERVRQLEREALQKLRRFADPDLAA
>NZ_CP015079.1|WP_068112833.1|3815874_3818043_+|S9-family-peptidase
MSSAPQHPSVTPPVAERRPTEREFHGRTRHDDYEWLREKDSPEVRAHLEAENAWTEARTAHLSDLRTRIFEEIKARTRETDLSVPVRNRDHWYYGRSFEGREYGATCRVPVAGPDDWTPPTPAEDCAPDQPALPGEEVLLDLDALAEGHEFFSLGGASISPDATRLAYSVDVVGDERYTARVKDLATGDLLPDVLEGVIHGTTWDRDGENLYYATVDEAWRADKIWRHRLGTAQSEDELVHHETDGRFFVGIGRSRSDRFLVLVAGSKTTTEYRFLDADDPAAGWQVFAERVEGVEYSLDHAVIAGEDRFLVLHNATGPDFELATAPLAPTPAAGWEAMIAHDPAVRLEDVDAFAGHLVVHQRSEGLTQLRIIELGPDGVGDDYLVPFDAEVYTVGAGGNPTFDQPVVRLGFTSMAVPSSVYDYDVRSRGLTLLRRTPVLGGYDPADYEEHRLWATADDGAQVPISVVCRRGSREDDGGGTRPVPTLLYGYGSYEASIDPYFSVARLSLLDRGAAFAIAHVRGGGEMGRRWYDEGKMTTKQNTFSDFIACARHLVDTGWSSPRTLVAEGGSAGGMLMGAVANQAPELFTGIVAAVPFVDALTTMLDATLPLTVTEYDEWGNPEADPEVYDYMASYAPYDNVTEQDYPAILAETSLNDTRVLYVEPAKWVAKLRATAPDHRPDVLLRTEMSAGHGGVSGRYKAWHDRAFALAWMLDRMGLADA
>NZ_CP015079.1|WP_084527795.1|3830836_3831838_-|aminoglycoside-phosphotransferase-family-protein
MGQRYGPAPSLAARRGSIHDVDVPDQTAGAGFVSLEPLEGGWSGETFVAEAGGERTVVRIYSGRRGPEAPAVDAAVLAYAAGVVPGVPPVLEVRRADPGRGVPGLLVTGFLPGERGDLVLPGLDAAEAARAGEALGLVLVALAGTALPRGGAFVDASLSIGAHPAPYDADGMLELVEVLLAATGSRLRDLRADEQATLRTLAREAQDLLDEVPQHCLVHGDLNPKNLLLQRGEGGPAVSGVLDWEFAHAGHPAADLGNLLRFERRPAFHDAVAATYAERRGLDVAHALDLARAADLLALVELASRAGSSPPADRALGRLRAVLATGDLHATEA
>NZ_CP015079.1|WP_084527797.1|3831836_3832712_+|class-I-SAM-dependent-methyltransferase
MPLSPPPASSGAQPPVTPDSRDHPPQPPVRAERRAVGEIESRRANGPDWDRYADDYQATHGEFLGDVGFVWGPEGLTESEARVLGDLAGRDVLEVGSGAGQCSRWVRAAGGRSYGLDLSHRQLQHSQRIDHATGVTVPSMVGTATALPFRDASFDVVFSSFGALQFVADIELAVAETARVLRRGGRFAFSITHPTRWMFPDDPDEAGLVASQSYWDRTPYVEVDEASGQVSYVEHHRTLGDWVALLAGAGFTITRLLEPEWPDHHDRVWGGWSGVRGRVTPGTAIFAADLP
>NZ_CP015079.1|WP_068112865.1|3832784_3833657_-|DUF3068-domain-containing-protein
MIAGLLGLVWAPGVVKKTPLQVETVTYLDGEAGKIDTSTGDLVENPIYAISDTRTDTELSTDDTVAWVSSSCVMIDRGEEPECVDGSEDMITASVDVFASDRVTALADNESLDLPADAVPHEGLINKFPFDTEKKTYPYWDGTTGQAVEAVYDRTEDLQGTETYVFTVNVDEAPIDIAEGTPGTYTTAKEIYVEPQTGAILNQTEDQQRYLENGTPVLDLQLAFTEDQITQSLDDNAGDRLLLDALTVWLPIVGFVGGALALVAGFLLMRGGKRSGNGHARQRKPVPAGR
>NZ_CP015079.1|WP_068112869.1|3833811_3835629_+|hypothetical-protein
MPVDPKNVLQARTNRSGVLAAAVLVLLLGTAGRAWALAGSWFYTDDHRLVRDAQATSALRDLLEPFDSQFMPLGRALAWVVSTASPDRWPLAATTTVLMHLLASVACLAMLLVLVGARWRVVVLLAVYETSAVTLPATMWWAAALNQLPLQAVLMGSVATWVLHLRTGRLRWLAATVALVALGLTAYVKAVLVPLVLAAVLLGWFTEGGPWRRVRSALRERWQAAVVFGTLGTAFSAYYVTQVPQVFVETGRTVADDLARSMLLTTLPTGLLGGPWRWNTDNPPTSYADPPIAAVVATWVVLAALALLLALRRRGTGRAWALLGGYAAIAFVLVLGSRAQVAGGVIGLEYRYLTDVLPVALLALVLATTRVEGAVGSSEARRTRRHLPPRTWSGATAVLVVAVVAGGVLSSVTYVRTWHEDNPGEDYLRTARDSLAGRGSLDLADQVVPAEVVPGYQFPANTTLLLLPLQVEGLRFPEVTEDLVVLDDDGRARRADIDVAVDAPPGPEADCGWRIGSSPVTIDLDGTAFDSTWWVHLGFAAASDDTLEVTVDGTTTRIGVRQGPGEVFWRTEAEIGQVTLGGLRGGNSLCVDLVEVGEAVPGDLL
>NZ_CP015079.1|WP_084527803.1|3835625_3836855_+|acyltransferase
MSTPPPERAVEQFPHLDSLRAVGALAVLTTHAAFWGGEYTDNGTAGRLLARLDVGVALFFVLSGFLLSRAWLQAAADATPRPATGHYFWKRSLRIVPVYLVAAVAALTLIDANAVLTLGDRVATLLLASTLVGPGFPAGLTHMWSLAVEVHFYLVLPLLMLLATGRRPGLDVRRVGTLLVAMTATSVWWHLDGAARVGRGHDMDTAQWLPAYLDWFAIGVGLALAQVLLARGRDGRGIGLLVRLAGQPGVCWSVAGGLLLIASTPVAGPVLLAAPTPGQSLTKNLLYAAVGALVVLPAVLRAPHPGTTTTFDRLLTNRAARHLGLVSYGIFCLHLPLLHLVMWATGWELFAGRGLQIWALTLIISLVAAEAVYRLVERPTLRLKAVQPLRRRGRAPAESSTAATGTSAR
>NZ_CP015079.1|WP_068112872.1|3836740_3840949_-|DUF3367-domain-containing-protein
MSAAGVATAPSGFGLRVLAGCALLVGLAFIQDPGLLVADTKFDLVAAPGDFLARALHLWDGEGALGQLQNQAYGYLWPMGGFFWLGAVASVPGWVVQRLWWGLVLAVAFSGTARLTRALGVRSDLACLVAGMAFALSPRVLSTMGPISSETWPVALAPWVLLRLVTGSERGSPRRAAALSALAVSLVGGVNAAASFAVIPLGALWLLTRTPGPRRRSLMLWWPTFTLLGTLWWLVPLALMGSYSPPFLDYIESASVTTFPTTLVDALRGTSNWVPYVEPGARAGRDLLTTSYLALNSAVVLALGLAGLMLRSNPHRRFLGLGLLVGLLMVTAGHLGAVQGWFAPTLQVQLDGVLSPLRNVHKFDPVLRLPLVIGLALSLDALVRAGRREADRAPDPRTRRLVRLNTATALAVTVAVVAGAAAPALAGRIAPAGAVLEVPPYWSEAADWLDEQEEASGDATALLVPGSNFARYLWGAPDDEPMQWLADSRWAVRNVVPLVPPGSIRSLDGIEARLSQGHGSPGLAAALRRAGLRYLVVRGDLERTDGAPDPVLVRQALRDSPGVSPVAGFGPLLGGVAHLEPDTGGRVSVAGGWQTTYRAIEVWEVAAAAPVVEADVTAVVAAGPEDLADLADTSALDDRPVVLAADAPVELPAQLASAPVVLTDGLRARERSFARIHDGSSAVLVEGDVRRTGNPVRDYLIDTEDRWSTTARLVGARSLSASSSASDADSLGFLERGASPWAALDGANDSAWVSRPGFTGTAWWRLDLDTPVAPSTVRLVGGPTAAADQRLVVRTDAGTSQPVAVGPGESRTVPLDVAGTSFVEVRSLDADRDISIAEVRIPGVQVRRPLVLPLLPEAWGPPDAVVLRADKDRRTGCVEVEDLAAERTEVRCVARRVVQAEEPTGLDRVVRLAGPADFSELSVRVRPRASNALEALVLEGRAVGVQASSTAVPDPRASALAALDGDLGTTWVADPDDPSPSLQVSWLGRERVTSLRLRTDADAAAAAPTRLRLTWDEGSLDVDLDDGRARLPGIRTDALRLEVLESENVTDLGFDGVAHPVGVGIGELRLGGVPYEPLRLSSDQRRYACGTGPTLRIGRTTWRTRLMASPAQLAAGASTEAVPCGAGAGPSLRRLRLPAGETEVRVQDTAAVEIESVVLGAMPTPAPGAASDAPLALTREPAARVVAAPSTDAVLVVSRENANPGWQGEQDGQPAEPVVVDGWQQGWLLPADAQGPLALRFGPDRVYRLGLLAGALTLLGLLVVVGVSLSPRGRATGAALPPLAAREVRPATAAVTAVLGAGLLAGWWGALVAGATVGLVALLRRRAPGGEPWLFAAPVLAATAAYAARPWGDPDGWAGTLAWPVYLALVPVAAVLLSAGARPRRRSGWTAFRRSVGRSTSR
>NZ_CP015079.1|WP_157520628.1|3840945_3841695_-|methyltransferase-domain-containing-protein
MSPKTTPFRATLRRSVRLLREFGHEQDDPARFYTALAQDSAAQLGSYTDLEDAVLLDVGGGPGYFRDAFTSAGATYLALDSDVGELAGLGTIANGTVVGSGMRLPFRDDAVDVCYSSNVLEHVPEPWTMAREMVRVTRPGGLVFISYTVWFGPWGGHETAPWHFLGGARARRRYARTHGHEPKNRYGESLFAVTVGAGLRWAREQAAGDGVELVDLGPRYNPWWSRWMLRVPVLREVVTWNLVIVLRKR
>NZ_CP015079.1|WP_068115265.1|3841754_3842906_+|glycosyltransferase-family-4-protein
MDERLAGRHVALLSWRDTANPEGGGAERYLEKMAAGLVARGCTVTVFCAAHAAAPPTETVDGVRFVRRGTKLSVYPQGMRALRRGDLDGPHGPPDVVVDVQNGLPFFSRLVTRRPVVVLVHHVHREQWPVVYPGRPGRVGWWIERRLAPWLYRRDQYVAVSSATRAELAELGVHRDRTAVVHNGTDPYVAVTPGKSPTPMVAVVGRLVPHKQVEHAIDAVLALRAGHPDLRLHVVGSGWWDAELHEYAAARGAGDSVVFEGHVDEEHKHEIYERAWVLALPSLKEGWGLVIGEAGMHTTPALAYRAAGGTQESIVDGVSGVLVDDQADFTATLGRLLGDGGLRERLGQGALEQSHRFTWTRAQQSFADVLVAVLSGRRVAGSD
>NZ_CP015079.1|WP_157520291.1|3842931_3843111_-|hypothetical-protein
MSAILSGGISAIAATIATTAVGGVVAAVTVVGLVSSQTGTQGESPASVNQPVVQYGTNG
>NZ_CP015079.1|WP_157520294.1|3843188_3844955_-|hypothetical-protein
MGDWWARVRGLPRGHAPSLVVPVWSIVLALLLLGPALAPGYVLSYDMVWVPDLALRADALGTGSGLPRAVPSDAVVAILDEVVPGMVLQKLVLLAALVVGGVGAARLAPPGRLLGALAAVTLWQWNPFVAERLGLGHWPVLLGYAALPWLVVAARRWRTEQRMPAVLPLLVVCASLSASAGLASAAVLLVLATRQEVAHLARVVAVVALANAPWLVAGLLHAGAALSDPAGAAVFALADEGTLPGPLAALGLGGAWNAEVLPGSRTGVAAWVATAVLLALAATGWRTWWQRVGAREGGGLLALWGVGWGLAVLTWAAPNAVGTLAGAVPGAGVVRDGARLLVLCAPLLVSLVAQGAVVLHDRVRRAWPGAAPLVPRVLLAAVLVLWPVTVLPDIAWGLDGPDGPRLQAVDYPTSFEQAHRAVGAAAPGDVLVLPLSSFRAPQWNNGHTVLDPLGRYLGRNHVASDELVVSRVVLAGEDPRVRAAREALARSGPQDRARALARIGIGVVVRDRTAPGGDDDLAVEVAGRRLLETGDLVVTEVLGASPRTSPPGWVAAMAAAWGAWVALLGSAGLVAAARVRRQRRGRSM

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP015079_5	5.1\|1965495\|39\|NZ_CP015079\|CRISPRCasFinder	1965495-1965533	39	NZ_CP015079.1	1101005-1101043	1	0.974
NZ_CP015079_2	2.1\|1002336\|37\|NZ_CP015079\|CRISPRCasFinder	1002336-1002372	37	NZ_CP015079.1	1982054-1982090	2	0.946
NZ_CP015079_7	7.1\|2297623\|37\|NZ_CP015079\|CRISPRCasFinder	2297623-2297659	37	NZ_CP015079.1	1581387-1581423	2	0.946

1. spacer 5.1|1965495|39|NZ_CP015079|CRISPRCasFinder matches to position: 1101005-1101043, mismatch: 1, identity: 0.974

ttccgtaggcgttggggtgttgcaacacccgaacgcctc	CRISPR spacer
ttccgtaggcgttggggtgttgcaacacccgaacgcatc	Protospacer
************************************ **

2. spacer 2.1|1002336|37|NZ_CP015079|CRISPRCasFinder matches to position: 1982054-1982090, mismatch: 2, identity: 0.946

gacgggtggccgatgaagtttcatcgtcccggcagga	CRISPR spacer
gacgggtggccgatgaagttttgtcgtcccggcagga	Protospacer
*********************..**************

3. spacer 7.1|2297623|37|NZ_CP015079|CRISPRCasFinder matches to position: 1581387-1581423, mismatch: 2, identity: 0.946

tgggtggacgacaaaacttcatcggccacccgtcagg	CRISPR spacer
tgggtggacgatgaaacttcatcggccacccgtcagg	Protospacer
***********..************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP015079_8	8.1\|2349679\|24\|NZ_CP015079\|CRT	2349679-2349702	24	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	1899087-1899110	2	0.917
NZ_CP015079_8	8.1\|2349679\|24\|NZ_CP015079\|CRT	2349679-2349702	24	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	2016263-2016286	3	0.875
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_KX443392	Rhodococcus hoagii strain PAM1340 plasmid pVAPA1340, complete sequence	24013-24039	3	0.889
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_KX443389	Rhodococcus hoagii strain PAM1357 plasmid pVAPA1357, complete sequence	44939-44965	3	0.889
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_KX443403	Rhodococcus hoagii strain PAM2288 plasmid pVAPA2288, complete sequence	44926-44952	3	0.889
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_KX443388	Rhodococcus hoagii strain PAM1216 plasmid pVAPA1216, complete sequence	18132-18158	3	0.889
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_KX443393	Rhodococcus hoagii strain PAM1637 plasmid pVAPA1637, complete sequence	44946-44972	3	0.889
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_KX443402	Rhodococcus hoagii strain PAM2285 plasmid pVAPA2285, complete sequence	23988-24014	3	0.889
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_KX443390	Rhodococcus hoagii strain PAM1422 plasmid pVAPA1422, complete sequence	17504-17530	3	0.889
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_KX443395	Rhodococcus hoagii strain PAM2282 plasmid pVAPA2282, complete sequence	44929-44955	3	0.889
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_KX443404	Rhodococcus hoagii strain PAM2287 plasmid pVAPA2287, complete sequence	43046-43072	3	0.889
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_KX443405	Rhodococcus hoagii strain PAM2279 plasmid pVAPA2279, complete sequence	44944-44970	3	0.889
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_KX443391	Rhodococcus hoagii strain PAM1600 plasmid pVAPA1600, complete sequence	17504-17530	3	0.889
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_KX443394	Rhodococcus hoagii strain PAM1643 plasmid pVAPA1643, complete sequence	23988-24014	3	0.889
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_KX443396	Rhodococcus hoagii strain PAM1271 plasmid pVAPA1271, complete sequence	17506-17532	3	0.889
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP027795	Rhodococcus hoagii strain DSSKP-R-001 plasmid plas2, complete sequence	75729-75755	3	0.889
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP041646	Rhodococcus hoagii strain WY plasmid pWY, complete sequence	18511-18537	3	0.889
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NC_014247	Rhodococcus equi plasmid pVAPAMBE116, complete sequence	18114-18140	3	0.889
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NC_002576	Rhodococcus equi 103 plasmid p103, complete sequence	41892-41918	3	0.889
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NC_011151	Rhodococcus equi plasmid pVAPA1037, complete sequence	17506-17532	3	0.889
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NC_004854	Rhodococcus equi ATCC33701 plasmid pREAT701, complete sequence	41893-41919	3	0.889
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	MK376956	Gordonia phage WilliamBoone, complete genome	32512-32538	3	0.889
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	611126-611152	4	0.852
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NC_021056	Streptomyces sp. PAMC 26508 plasmid pSP01, complete sequence	25294-25320	4	0.852
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NC_016624	Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence	312601-312627	4	0.852
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	10947-10973	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	605460-605486	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	742040-742066	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	749293-749319	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	1406182-1406208	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	1265670-1265696	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1205522-1205548	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	705568-705594	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	348394-348420	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	735173-735199	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	749293-749319	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	867529-867555	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	460512-460538	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	1334841-1334867	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	749300-749326	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	1047146-1047172	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	619086-619112	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	2002848-2002874	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1676957-1676983	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1647812-1647838	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	709164-709190	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	1034457-1034483	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	624244-624270	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	536970-536996	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	624517-624543	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP033583	Streptomyces sp. ADI95-16 plasmid pADI95-16b, complete sequence	127618-127644	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	822403-822429	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	442923-442949	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	626871-626897	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	1365214-1365240	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	709170-709196	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	822403-822429	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	685931-685957	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	711503-711529	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	822404-822430	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	735192-735218	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	632105-632131	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	685931-685957	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	711503-711529	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	766112-766138	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	822406-822432	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	685931-685957	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	730158-730184	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	632133-632159	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	685935-685961	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	711503-711529	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	711503-711529	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	711503-711529	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	822406-822432	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	1326836-1326862	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	822406-822432	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	632133-632159	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	637938-637964	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	637883-637909	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	674934-674960	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	710179-710205	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	1472440-1472466	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	822406-822432	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	632133-632159	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	685931-685957	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	770963-770989	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	822400-822426	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	632133-632159	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	632133-632159	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	822406-822432	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	711505-711531	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	1353690-1353716	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	822406-822432	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	822406-822432	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	1353690-1353716	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP015451	Dietzia lutea strain YIM 80766 plasmid unnamed2, complete sequence	2237-2263	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP015451	Dietzia lutea strain YIM 80766 plasmid unnamed2, complete sequence	8571-8597	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP015451	Dietzia lutea strain YIM 80766 plasmid unnamed2, complete sequence	14908-14934	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP015451	Dietzia lutea strain YIM 80766 plasmid unnamed2, complete sequence	21262-21288	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP015451	Dietzia lutea strain YIM 80766 plasmid unnamed2, complete sequence	27652-27678	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP015451	Dietzia lutea strain YIM 80766 plasmid unnamed2, complete sequence	33956-33982	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP015452	Dietzia lutea strain YIM 80766 plasmid unnamed3, complete sequence	2111-2137	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP015452	Dietzia lutea strain YIM 80766 plasmid unnamed3, complete sequence	8438-8464	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP015452	Dietzia lutea strain YIM 80766 plasmid unnamed3, complete sequence	14751-14777	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP015452	Dietzia lutea strain YIM 80766 plasmid unnamed3, complete sequence	21082-21108	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP015452	Dietzia lutea strain YIM 80766 plasmid unnamed3, complete sequence	27417-27443	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP015530	Rhodococcus sp. WB1 plasmid pWB1, complete sequence	88481-88507	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP021355	Rhodococcus sp. S2-17 plasmid pRB98, complete sequence	91774-91800	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP034186	Deinococcus sp. S14-83 strain S14-83T plasmid unnamed2, complete sequence	6826-6852	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	MH029512	Siphoviridae environmental samples clone NHS-Seq1, complete sequence	24882-24908	5	0.815
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	1364318-1364344	6	0.778
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	192788-192814	6	0.778
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_DQ996271	Burkholderia glumae BGR1 plasmid pBGF3, complete sequence	3017-3043	6	0.778
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	683301-683327	6	0.778
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	708488-708514	6	0.778
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	680787-680813	6	0.778
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	192805-192831	6	0.778
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	678975-679001	6	0.778
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	365309-365335	6	0.778
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	192804-192830	6	0.778
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NC_010879	Burkholderia glumae strain BGR1 plasmid pBGF2, complete sequence	20980-21006	6	0.778
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	192802-192828	6	0.778
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	MT684597	Mycobacterium phage Mandlovu, complete genome	43077-43103	6	0.778
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	MH371123	Mycobacterium phage Sandalphon, complete genome	45021-45047	6	0.778
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	KU935731	Mycobacterium phage Phrann, complete genome	39518-39544	6	0.778
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	MT024866	Mycobacterium phage Willsammy, complete genome	24634-24660	6	0.778
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	MN369755	Mycobacterium phage Minnie, complete genome	46043-46069	6	0.778
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	MN945900	Mycobacterium phage BodEinwohner17, complete genome	45160-45186	6	0.778
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	MT114164	Mycobacterium phage Veteran, complete genome	42830-42856	6	0.778
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	NC_041888	Mycobacterium phage Tortellini, complete genome	24970-24996	6	0.778
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	MH697593	Mycobacterium phage Tapioca, complete genome	37736-37762	6	0.778
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	MG099936	Mycobacterium phage Andies, complete genome	37297-37323	6	0.778
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	MN586004	Mycobacterium phage Strokeseat, complete genome	43134-43160	6	0.778
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	MT684601	Mycobacterium phage Hlubikazi, complete genome	43135-43161	6	0.778
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	KT281795	Mycobacterium phage XFactor, complete genome	42870-42896	6	0.778
NZ_CP015079_8	8.2\|2349721\|27\|NZ_CP015079\|CRT	2349721-2349747	27	JN256079	Mycobacterium phage Charlie, complete genome	36627-36653	6	0.778
NZ_CP015079_8	8.4\|2349802\|39\|NZ_CP015079\|CRT	2349802-2349840	39	NZ_CP029828	Burkholderia sp. JP2-270 plasmid p2, complete sequence	138541-138579	6	0.846
NZ_CP015079_9	9.3\|3830345\|33\|NZ_CP015079\|CRISPRCasFinder	3830345-3830377	33	NZ_CP027239	Dietzia sp. oral taxon 368 strain W5195 plasmid unnamed1, complete sequence	152136-152168	7	0.788
NZ_CP015079_9	9.1\|3830207\|33\|NZ_CP015079\|CRISPRCasFinder	3830207-3830239	33	MN234199	Mycobacterium phage Ekdilam, complete genome	31484-31516	8	0.758
NZ_CP015079_8	8.4\|2349802\|39\|NZ_CP015079\|CRT	2349802-2349840	39	NZ_CP047963	Aeromonas media strain MC64 plasmid pMC64A, complete sequence	29622-29660	9	0.769
NZ_CP015079_9	9.3\|3830345\|33\|NZ_CP015079\|CRISPRCasFinder	3830345-3830377	33	NZ_CP034811	Paracoccus sp. Arc7-R13 plasmid unnamed1, complete sequence	45369-45401	9	0.727
NZ_CP015079_9	9.4\|3830414\|33\|NZ_CP015079\|CRISPRCasFinder	3830414-3830446	33	MT771341	Gordonia phage DirtyBoi, complete genome	8534-8566	9	0.727
NZ_CP015079_9	9.4\|3830414\|33\|NZ_CP015079\|CRISPRCasFinder	3830414-3830446	33	KX557279	Gordonia phage Hedwig, complete genome	8534-8566	9	0.727

1. spacer 8.1|2349679|24|NZ_CP015079|CRT matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 2, identity: 0.917

gccgggcgccaacagtgccggcgg	CRISPR spacer
gccgggtgccagcagtgccggcgg	Protospacer
******.****.************

2. spacer 8.1|2349679|24|NZ_CP015079|CRT matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 3, identity: 0.875

gccgggcgccaacagtgccggcgg	CRISPR spacer
gccgggcgccaaaactgccggcga	Protospacer
************ * ********.

3. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_KX443392 (Rhodococcus hoagii strain PAM1340 plasmid pVAPA1340, complete sequence) position: , mismatch: 3, identity: 0.889

caacggcaacgccaccggccccggcgc	CRISPR spacer
caacggcaccgtcaccggccccggcgt	Protospacer
******** **.**************.

4. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_KX443389 (Rhodococcus hoagii strain PAM1357 plasmid pVAPA1357, complete sequence) position: , mismatch: 3, identity: 0.889

caacggcaacgccaccggccccggcgc	CRISPR spacer
caacggcaccgtcaccggccccggcgt	Protospacer
******** **.**************.

5. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_KX443403 (Rhodococcus hoagii strain PAM2288 plasmid pVAPA2288, complete sequence) position: , mismatch: 3, identity: 0.889

caacggcaacgccaccggccccggcgc	CRISPR spacer
caacggcaccgtcaccggccccggcgt	Protospacer
******** **.**************.

6. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_KX443388 (Rhodococcus hoagii strain PAM1216 plasmid pVAPA1216, complete sequence) position: , mismatch: 3, identity: 0.889

caacggcaacgccaccggccccggcgc	CRISPR spacer
caacggcaccgtcaccggccccggcgt	Protospacer
******** **.**************.

7. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_KX443393 (Rhodococcus hoagii strain PAM1637 plasmid pVAPA1637, complete sequence) position: , mismatch: 3, identity: 0.889

caacggcaacgccaccggccccggcgc	CRISPR spacer
caacggcaccgtcaccggccccggcgt	Protospacer
******** **.**************.

8. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_KX443402 (Rhodococcus hoagii strain PAM2285 plasmid pVAPA2285, complete sequence) position: , mismatch: 3, identity: 0.889

caacggcaacgccaccggccccggcgc	CRISPR spacer
caacggcaccgtcaccggccccggcgt	Protospacer
******** **.**************.

9. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_KX443390 (Rhodococcus hoagii strain PAM1422 plasmid pVAPA1422, complete sequence) position: , mismatch: 3, identity: 0.889

caacggcaacgccaccggccccggcgc	CRISPR spacer
caacggcaccgtcaccggccccggcgt	Protospacer
******** **.**************.

10. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_KX443395 (Rhodococcus hoagii strain PAM2282 plasmid pVAPA2282, complete sequence) position: , mismatch: 3, identity: 0.889

caacggcaacgccaccggccccggcgc	CRISPR spacer
caacggcaccgtcaccggccccggcgt	Protospacer
******** **.**************.

11. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_KX443404 (Rhodococcus hoagii strain PAM2287 plasmid pVAPA2287, complete sequence) position: , mismatch: 3, identity: 0.889

caacggcaacgccaccggccccggcgc	CRISPR spacer
caacggcaccgtcaccggccccggcgt	Protospacer
******** **.**************.

12. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_KX443405 (Rhodococcus hoagii strain PAM2279 plasmid pVAPA2279, complete sequence) position: , mismatch: 3, identity: 0.889

caacggcaacgccaccggccccggcgc	CRISPR spacer
caacggcaccgtcaccggccccggcgt	Protospacer
******** **.**************.

13. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_KX443391 (Rhodococcus hoagii strain PAM1600 plasmid pVAPA1600, complete sequence) position: , mismatch: 3, identity: 0.889

caacggcaacgccaccggccccggcgc	CRISPR spacer
caacggcaccgtcaccggccccggcgt	Protospacer
******** **.**************.

14. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_KX443394 (Rhodococcus hoagii strain PAM1643 plasmid pVAPA1643, complete sequence) position: , mismatch: 3, identity: 0.889

caacggcaacgccaccggccccggcgc	CRISPR spacer
caacggcaccgtcaccggccccggcgt	Protospacer
******** **.**************.

15. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_KX443396 (Rhodococcus hoagii strain PAM1271 plasmid pVAPA1271, complete sequence) position: , mismatch: 3, identity: 0.889

caacggcaacgccaccggccccggcgc	CRISPR spacer
caacggcaccgtcaccggccccggcgt	Protospacer
******** **.**************.

16. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP027795 (Rhodococcus hoagii strain DSSKP-R-001 plasmid plas2, complete sequence) position: , mismatch: 3, identity: 0.889

caacggcaacgccaccggccccggcgc	CRISPR spacer
caacggcaccgtcaccggccccggcgt	Protospacer
******** **.**************.

17. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP041646 (Rhodococcus hoagii strain WY plasmid pWY, complete sequence) position: , mismatch: 3, identity: 0.889

caacggcaacgccaccggccccggcgc	CRISPR spacer
caacggcaccgtcaccggccccggcgt	Protospacer
******** **.**************.

18. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NC_014247 (Rhodococcus equi plasmid pVAPAMBE116, complete sequence) position: , mismatch: 3, identity: 0.889

caacggcaacgccaccggccccggcgc	CRISPR spacer
caacggcaccgtcaccggccccggcgt	Protospacer
******** **.**************.

19. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NC_002576 (Rhodococcus equi 103 plasmid p103, complete sequence) position: , mismatch: 3, identity: 0.889

caacggcaacgccaccggccccggcgc	CRISPR spacer
caacggcaccgtcaccggccccggcgt	Protospacer
******** **.**************.

20. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NC_011151 (Rhodococcus equi plasmid pVAPA1037, complete sequence) position: , mismatch: 3, identity: 0.889

caacggcaacgccaccggccccggcgc	CRISPR spacer
caacggcaccgtcaccggccccggcgt	Protospacer
******** **.**************.

21. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NC_004854 (Rhodococcus equi ATCC33701 plasmid pREAT701, complete sequence) position: , mismatch: 3, identity: 0.889

caacggcaacgccaccggccccggcgc	CRISPR spacer
caacggcaccgtcaccggccccggcgt	Protospacer
******** **.**************.

22. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to MK376956 (Gordonia phage WilliamBoone, complete genome) position: , mismatch: 3, identity: 0.889

caacggcaacgccaccggccccggcgc	CRISPR spacer
cgaccgccacgccaccggccccggcgc	Protospacer
*.** ** *******************

23. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.852

caacggcaacgccaccggccccggcgc	CRISPR spacer
caacggcaaccccatcggccccgggcc	Protospacer
********** ***.*********  *

24. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NC_021056 (Streptomyces sp. PAMC 26508 plasmid pSP01, complete sequence) position: , mismatch: 4, identity: 0.852

caacggcaacgccaccggccccggcgc	CRISPR spacer
cgacggcaacgccaccggcaccgtcga	Protospacer
*.***************** *** **

25. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NC_016624 (Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence) position: , mismatch: 4, identity: 0.852

caacggcaacgccaccggccccggcgc	CRISPR spacer
cgagggcagcgtcaccggccccggcgc	Protospacer
*.* ****.**.***************

26. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

27. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

28. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

29. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

30. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

31. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

32. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

33. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

34. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

35. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

36. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

37. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

38. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

39. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

40. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

41. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

42. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

43. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

44. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

45. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

46. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

47. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

48. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

49. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

50. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

51. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP033583 (Streptomyces sp. ADI95-16 plasmid pADI95-16b, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
cctcggcaaggccaccggccccggccg	Protospacer
*  ****** ***************

52. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

53. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

54. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

55. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

56. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

57. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

58. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

59. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

60. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

61. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

62. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

63. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

64. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

65. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

66. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

67. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

68. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

69. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

70. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

71. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

72. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

73. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

74. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

75. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

76. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

77. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

78. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

79. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

80. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

81. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

82. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

83. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

84. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

85. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

86. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

87. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

88. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

89. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

90. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

91. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

92. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

93. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

94. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

95. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
ccgcgacaacgccaccggccccggctt	Protospacer
* .**.******************* .

96. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP015451 (Dietzia lutea strain YIM 80766 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
cggcatcaacgccaccggccccgccgc	Protospacer
*..*. ***************** ***

97. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP015451 (Dietzia lutea strain YIM 80766 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
cggcatcaacgccaccggccccgccgc	Protospacer
*..*. ***************** ***

98. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP015451 (Dietzia lutea strain YIM 80766 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
cggcatcaacgccaccggccccgccgc	Protospacer
*..*. ***************** ***

99. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP015451 (Dietzia lutea strain YIM 80766 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
cggcatcaacgccaccggccccgccgc	Protospacer
*..*. ***************** ***

100. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP015451 (Dietzia lutea strain YIM 80766 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
cggcatcaacgccaccggccccgccgc	Protospacer
*..*. ***************** ***

101. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP015451 (Dietzia lutea strain YIM 80766 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
cggcatcaacgccaccggccccgccgc	Protospacer
*..*. ***************** ***

102. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP015452 (Dietzia lutea strain YIM 80766 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
cggcatcaacgccaccggccccgccgc	Protospacer
*..*. ***************** ***

103. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP015452 (Dietzia lutea strain YIM 80766 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
cggcatcaacgccaccggccccgccgc	Protospacer
*..*. ***************** ***

104. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP015452 (Dietzia lutea strain YIM 80766 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
cggcatcaacgccaccggccccgccgc	Protospacer
*..*. ***************** ***

105. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP015452 (Dietzia lutea strain YIM 80766 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
cggcatcaacgccaccggccccgccgc	Protospacer
*..*. ***************** ***

106. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP015452 (Dietzia lutea strain YIM 80766 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
cggcatcaacgccaccggccccgccgc	Protospacer
*..*. ***************** ***

107. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP015530 (Rhodococcus sp. WB1 plasmid pWB1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
aagcggcaccgtcaccggccccggcgt	Protospacer
 *.***** **.**************.

108. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP021355 (Rhodococcus sp. S2-17 plasmid pRB98, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
cgtgggcgacaccaccggccccggcgc	Protospacer
*.  ***.**.****************

109. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP034186 (Deinococcus sp. S14-83 strain S14-83T plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
tatcggcgacaccaccggccccggcgg	Protospacer
.* ****.**.***************

110. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to MH029512 (Siphoviridae environmental samples clone NHS-Seq1, complete sequence) position: , mismatch: 5, identity: 0.815

caacggcaacgccaccggccccggcgc	CRISPR spacer
cacgggcaacgccaccggcaccggcag	Protospacer
**  *************** *****.

111. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 6, identity: 0.778

caacggcaacgccaccggccccggcgc	CRISPR spacer
gggcgacatcgccaccggccccggcgt	Protospacer
 ..**.** *****************.

112. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

caacggcaacgccaccggccccggcgc	CRISPR spacer
gcatctcaacgccaccggccccggccc	Protospacer
  *.  ******************* *

113. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_DQ996271 (Burkholderia glumae BGR1 plasmid pBGF3, complete sequence) position: , mismatch: 6, identity: 0.778

caacggcaacgccaccggccccggcgc	CRISPR spacer
ggcaggcagcgccaccggcgccggcgc	Protospacer
 .  ****.********** *******

114. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 6, identity: 0.778

caacggcaacgccaccggccccggcgc	CRISPR spacer
cgcaaccatcgccaccggccccggcgc	Protospacer
*.  . ** ******************

115. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.778

caacggcaacgccaccggccccggcgc	CRISPR spacer
gaccggcaacgccaccggcccccacct	Protospacer
 * ******************* .* .

116. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 6, identity: 0.778

caacggcaacgccaccggccccggcgc	CRISPR spacer
cgcaaccatcgccaccggccccggcgc	Protospacer
*.  . ** ******************

117. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

caacggcaacgccaccggccccggcgc	CRISPR spacer
gcatctcaacgccaccggccccggccc	Protospacer
  *.  ******************* *

118. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 6, identity: 0.778

caacggcaacgccaccggccccggcgc	CRISPR spacer
cgcaaccatcgccaccggccccggcgc	Protospacer
*.  . ** ******************

119. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 6, identity: 0.778

caacggcaacgccaccggccccggcgc	CRISPR spacer
cgcaaccatcgccaccggccccggcgc	Protospacer
*.  . ** ******************

120. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

caacggcaacgccaccggccccggcgc	CRISPR spacer
gcatctcaacgccaccggccccggccc	Protospacer
  *.  ******************* *

121. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NC_010879 (Burkholderia glumae strain BGR1 plasmid pBGF2, complete sequence) position: , mismatch: 6, identity: 0.778

caacggcaacgccaccggccccggcgc	CRISPR spacer
ggcaggcagcgccaccggcgccggcgc	Protospacer
 .  ****.********** *******

122. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

caacggcaacgccaccggccccggcgc	CRISPR spacer
gcatctcaacgccaccggccccggccc	Protospacer
  *.  ******************* *

123. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to MT684597 (Mycobacterium phage Mandlovu, complete genome) position: , mismatch: 6, identity: 0.778

caacggcaacgccaccggccccggcgc	CRISPR spacer
gttcggcaacgtcaccggcgccggcgt	Protospacer
   ********.******* ******.

124. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to MH371123 (Mycobacterium phage Sandalphon, complete genome) position: , mismatch: 6, identity: 0.778

caacggcaacgccaccggccccggcgc	CRISPR spacer
gttcggcaacgtcaccggcgccggcgt	Protospacer
   ********.******* ******.

125. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to KU935731 (Mycobacterium phage Phrann, complete genome) position: , mismatch: 6, identity: 0.778

caacggcaacgccaccggccccggcgc	CRISPR spacer
gttcggcaacgtcaccggcgccggcgt	Protospacer
   ********.******* ******.

126. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to MT024866 (Mycobacterium phage Willsammy, complete genome) position: , mismatch: 6, identity: 0.778

caacggcaacgccaccggccccggcgc	CRISPR spacer
gtacggcaacgccaccggcccggtcaa	Protospacer
  ******************* * *.

127. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to MN369755 (Mycobacterium phage Minnie, complete genome) position: , mismatch: 6, identity: 0.778

caacggcaacgccaccggccccggcgc	CRISPR spacer
gttcggcaacgtcaccggcgccggcgt	Protospacer
   ********.******* ******.

128. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to MN945900 (Mycobacterium phage BodEinwohner17, complete genome) position: , mismatch: 6, identity: 0.778

caacggcaacgccaccggccccggcgc	CRISPR spacer
gttcggcaacgtcaccggcgccggcgt	Protospacer
   ********.******* ******.

129. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to MT114164 (Mycobacterium phage Veteran, complete genome) position: , mismatch: 6, identity: 0.778

caacggcaacgccaccggccccggcgc	CRISPR spacer
gttcggcaacgtcaccggcgccggcgt	Protospacer
   ********.******* ******.

130. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to NC_041888 (Mycobacterium phage Tortellini, complete genome) position: , mismatch: 6, identity: 0.778

caacggcaacgccaccggccccggcgc	CRISPR spacer
gtacggcaacgccaccggcccggtcaa	Protospacer
  ******************* * *.

131. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to MH697593 (Mycobacterium phage Tapioca, complete genome) position: , mismatch: 6, identity: 0.778

caacggcaacgccaccggccccggcgc	CRISPR spacer
gttcggcaacgtcaccggcgccggcgt	Protospacer
   ********.******* ******.

132. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to MG099936 (Mycobacterium phage Andies, complete genome) position: , mismatch: 6, identity: 0.778

caacggcaacgccaccggccccggcgc	CRISPR spacer
gttcggcaacgtcaccggcgccggcgt	Protospacer
   ********.******* ******.

133. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to MN586004 (Mycobacterium phage Strokeseat, complete genome) position: , mismatch: 6, identity: 0.778

caacggcaacgccaccggccccggcgc	CRISPR spacer
gttcggcaacgtcaccggcgccggcgt	Protospacer
   ********.******* ******.

134. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to MT684601 (Mycobacterium phage Hlubikazi, complete genome) position: , mismatch: 6, identity: 0.778

caacggcaacgccaccggccccggcgc	CRISPR spacer
gttcggcaacgtcaccggcgccggcgt	Protospacer
   ********.******* ******.

135. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to KT281795 (Mycobacterium phage XFactor, complete genome) position: , mismatch: 6, identity: 0.778

caacggcaacgccaccggccccggcgc	CRISPR spacer
gttcggcaacgtcaccggcgccggcgt	Protospacer
   ********.******* ******.

136. spacer 8.2|2349721|27|NZ_CP015079|CRT matches to JN256079 (Mycobacterium phage Charlie, complete genome) position: , mismatch: 6, identity: 0.778

caacggcaacgccaccggccccggcgc	CRISPR spacer
gttcggcaacgtcaccggcgccggcgt	Protospacer
   ********.******* ******.

137. spacer 8.4|2349802|39|NZ_CP015079|CRT matches to NZ_CP029828 (Burkholderia sp. JP2-270 plasmid p2, complete sequence) position: , mismatch: 6, identity: 0.846

caacagcaacagcaacagcaacgacggc-gccaccggccc	CRISPR spacer
caacagcaacagcaacagcaacgccggcagccactcgag-	Protospacer
*********************** **** *****. *

138. spacer 9.3|3830345|33|NZ_CP015079|CRISPRCasFinder matches to NZ_CP027239 (Dietzia sp. oral taxon 368 strain W5195 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.788

aaggacggccgcgaggtgcacgagaccaaggcc	CRISPR spacer
gcgctgggccgcgaggtggacgaggccaaggcc	Protospacer
. *   ************ *****.********

139. spacer 9.1|3830207|33|NZ_CP015079|CRISPRCasFinder matches to MN234199 (Mycobacterium phage Ekdilam, complete genome) position: , mismatch: 8, identity: 0.758

ctcgacggcgccgaggtcaacacccacgacacg	CRISPR spacer
cgggacggcgccgaggtcgacacccgcggcgtc	Protospacer
*  ***************.******.**.*..

140. spacer 8.4|2349802|39|NZ_CP015079|CRT matches to NZ_CP047963 (Aeromonas media strain MC64 plasmid pMC64A, complete sequence) position: , mismatch: 9, identity: 0.769

caacagcaacagcaacagcaacgacggcgccaccggccc-	CRISPR spacer
caacagcaacagcaacagcaacaacagcagt-ctgactct	Protospacer
**********************.**.**. . *.*.*.*

141. spacer 9.3|3830345|33|NZ_CP015079|CRISPRCasFinder matches to NZ_CP034811 (Paracoccus sp. Arc7-R13 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.727

aaggacggccgcgaggtgcacgagaccaaggcc	CRISPR spacer
caggacggccgcgaggtgaccgagacccgcctg	Protospacer
 *****************  ******* .  .

142. spacer 9.4|3830414|33|NZ_CP015079|CRISPRCasFinder matches to MT771341 (Gordonia phage DirtyBoi, complete genome) position: , mismatch: 9, identity: 0.727

agcgacgggcgcgaggtcaagaagttcaagacc	CRISPR spacer
acacccgagggcgaggtcaagaagttcaacggc	Protospacer
*    **.* ******************* . *

143. spacer 9.4|3830414|33|NZ_CP015079|CRISPRCasFinder matches to KX557279 (Gordonia phage Hedwig, complete genome) position: , mismatch: 9, identity: 0.727

agcgacgggcgcgaggtcaagaagttcaagacc	CRISPR spacer
acacccgagggcgaggtcaagaagttcaacggc	Protospacer
*    **.* ******************* . *

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage