CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP015989	Sphingobium sp. EP60837 plasmid pEP2, complete sequence	1 crisprs	csa3,RT	1	2
NZ_CP015986	Sphingobium sp. EP60837 chromosome 1, complete sequence	0 crisprs	csa3,DEDDh,cas3,WYL,DinG	0	212
NZ_CP015987	Sphingobium sp. EP60837 chromosome 2, complete sequence	0 crisprs	DEDDh	0	1
NZ_CP015988	Sphingobium sp. EP60837 plasmid pEP1, complete sequence	0 crisprs	NA	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP015989_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015989_1

169547-169635

Orphan

Consensus_repeat	Method
AAAGTGAGTGTTGGGGTCGAGTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015989_1

>merge|NZ_CP015989|1|169547-169635|CRISPRCasFinder
AAAGTGAGTGTTGGGGTCGAGTCGCGTGAGTTTTCGGGTAGCCTTCGGTGAGCTTTGGGGTCGGTAAAGGTGAGTGTTGGGGTCGAGTC

>NZ_CP015989|1|1|169547-169635|CRISPRCasFinder
AAAGTGAGTGTTGGGGTCGAGTC	GCGTGAGTTTTCGGGTAGCCTTCGGTGAGCTTTGGGGTCGGTA
AAGGTGAGTGTTGGGGTCGAGTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015989.1\|WP_013039114.1\|172178_172772_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NZ_CP015989.1\|WP_020817758.1\|179380_179800_+\|putative-toxin-antitoxin-system-toxin-component,-PIN-family	unknown	unknown	gnl\|CDD\|379205
NZ_CP015989.1\|WP_020817748.1\|161002_161662_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379522
NZ_CP015989.1\|WP_006964370.1\|156524_156851_-\|XRE-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|372700
NZ_CP015989.1\|WP_020817759.1\|178242_178878_-\|transcription-elongation-protein-SprT	unknown	unknown	gnl\|CDD\|370932
NZ_CP015989.1\|WP_006949122.1\|181106_181871_-\|IS6-family-transposase	unknown	unknown	gnl\|CDD\|225853
NZ_CP015989.1\|WP_156518816.1\|159523_160993_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP015989.1\|WP_066532666.1\|162449_165503_-\|Ti-type-conjugative-transfer-relaxase-TraA	unknown	unknown	gnl\|CDD\|237546
NZ_CP015989.1\|WP_015063474.1\|180087_180708_+\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366010
NZ_CP015989.1\|WP_007686150.1\|176639_177170_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP015989.1\|WP_020817760.1\|177234_177501_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015989.1\|WP_020817757.1\|179802_180081_+\|toxin-antitoxin-system-HicB-family-antitoxin	unknown	unknown	gnl\|CDD\|310261
NZ_CP015989.1\|WP_013041565.1\|156847_157222_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227024
NZ_CP015989.1\|WP_020817742.1\|167163_168831_+\|type-IV-secretory-system-conjugative-DNA-transfer-family-protein	unknown	unknown	gnl\|CDD\|226036
NZ_CP015989.1\|WP_008829513.1\|172911_175869_+\|Tn3-family-transposase	unknown	unknown	gnl\|CDD\|376561
NZ_CP015989.1\|WP_020817744.1\|166019_166247_+\|conjugal-transfer-protein-TraD	unknown	unknown	gnl\|CDD\|368890
NZ_CP015989.1\|WP_020817745.1\|165676_165982_+\|conjugal-transfer-protein-TraD	unknown	unknown	gnl\|CDD\|368890
NZ_CP015989.1\|WP_015063478.1\|177526_178162_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|222854
NZ_CP015989.1\|WP_020817747.1\|161734_162436_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015989.1\|WP_006949122.1\|158295_159060_-\|IS6-family-transposase	unknown	unknown	gnl\|CDD\|225853

Protein	Function_ID	Function_description	E-value
NZ_CP015989.1\|WP_013039114.1\|172178_172772_-\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	4.07358e-62
NZ_CP015989.1\|WP_020817758.1\|179380_179800_+\|putative-toxin-antitoxin-system-toxin-component,-PIN-family	gnl\|CDD\|379205	pfam13470, PIN_3, PIN domain. Members of this family of bacterial domains are predicted to be RNases (from similarities to 5'-exonucleases).	3.39164e-23
NZ_CP015989.1\|WP_020817748.1\|161002_161662_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|379522	pfam14246, TetR_C_7, AefR-like transcriptional repressor, C-terminal region. This family comprises the C-terminal domain of transcriptional regulators of the TetR family. It includes the AefR transcriptional regulator from P. syringae. It is found in association with pfam00440.	8.57767e-22
NZ_CP015989.1\|WP_006964370.1\|156524_156851_-\|XRE-family-transcriptional-regulator	gnl\|CDD\|372700	pfam13744, HTH_37, Helix-turn-helix domain. Members of this family contains a DNA-binding helix-turn-helix domain.	5.57887e-23
NZ_CP015989.1\|WP_020817759.1\|178242_178878_-\|transcription-elongation-protein-SprT	gnl\|CDD\|370932	pfam10263, SprT-like, SprT-like family. This family represents a domain found in eukaryotes and prokaryotes. The domain contains a characteristic motif of the zinc metallopeptidases. This family includes the bacterial SprT protein.	0.00124626
NZ_CP015989.1\|WP_006949122.1\|181106_181871_-\|IS6-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	7.05873e-69
NZ_CP015989.1\|WP_156518816.1\|159523_160993_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	4.46223e-133
NZ_CP015989.1\|WP_008829513.1\|172911_175869_+\|Tn3-family-transposase	gnl\|CDD\|376561	pfam01526, DDE_Tnp_Tn3, Tn3 transposase DDE domain. This family includes transposases of Tn3, Tn21, Tn1721, Tn2501, Tn3926 transposons from E-coli. The specific binding of the Tn3 transposase to DNA has been demonstrated. Sequence analysis has suggested that the invariant triad of Asp689, Asp765, Glu895 (numbering as in Tn3) may correspond to the D-D-35-E motif previously implicated in the catalysis of numerous transposases.	2.11171e-170
NZ_CP015989.1\|WP_007686150.1\|176639_177170_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	2.4341e-12
NZ_CP015989.1\|WP_015063474.1\|180087_180708_+\|histidine-phosphatase-family-protein	gnl\|CDD\|366010	pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members.	1.16273e-23
NZ_CP015989.1\|WP_020817757.1\|179802_180081_+\|toxin-antitoxin-system-HicB-family-antitoxin	gnl\|CDD\|310261	pfam05534, HicB, HicB family. This family consists of several bacterial HicB related proteins. The function of HicB is unknown although it is thought to be involved in pilus formation. It has been speculated that HicB performs a function antagonistic to that of pili and yet is necessary for invasion of certain niches.	0.0013652
NZ_CP015989.1\|WP_013041565.1\|156847_157222_-\|hypothetical-protein	gnl\|CDD\|227024	COG4679, COG4679, Phage-related protein [Function unknown].	1.0372e-31
NZ_CP015989.1\|WP_020817742.1\|167163_168831_+\|type-IV-secretory-system-conjugative-DNA-transfer-family-protein	gnl\|CDD\|226036	COG3505, VirD4, Type IV secretory pathway, VirD4 components [Intracellular trafficking and secretion].	2.44856e-117
NZ_CP015989.1\|WP_066532666.1\|162449_165503_-\|Ti-type-conjugative-transfer-relaxase-TraA	gnl\|CDD\|237546	PRK13889, PRK13889, conjugal transfer relaxase TraA; Provisional.	0
NZ_CP015989.1\|WP_020817744.1\|166019_166247_+\|conjugal-transfer-protein-TraD	gnl\|CDD\|368890	pfam06412, TraD, Conjugal transfer protein TraD. This family contains bacterial TraD conjugal transfer proteins. Mutations in the TraD gene result in loss of transfer.	9.86341e-16
NZ_CP015989.1\|WP_020817745.1\|165676_165982_+\|conjugal-transfer-protein-TraD	gnl\|CDD\|368890	pfam06412, TraD, Conjugal transfer protein TraD. This family contains bacterial TraD conjugal transfer proteins. Mutations in the TraD gene result in loss of transfer.	1.14464e-11
NZ_CP015989.1\|WP_015063478.1\|177526_178162_-\|AAA-family-ATPase	gnl\|CDD\|222854	PHA02518, PHA02518, ParA-like protein; Provisional.	3.73073e-47
NZ_CP015989.1\|WP_006949122.1\|158295_159060_-\|IS6-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	7.05873e-69

>NZ_CP015989.1|WP_020817742.1|167163_168831_+|type-IV-secretory-system-conjugative-DNA-transfer-family-protein
MEWFRQLGRALRNVARLSRRNPIWAITALTLSPIALIRHLLRVAALFLIVALVLGLGMPLIAEKLLGLPRDSLIYQALMMLTGLVVILIVLRALFQPLILRYGGLDGDDTHGSARFATANETRALARADTGLLIGRDMKTRKLLRYPGPAHLLTIAPTRTGKGVGTIIPNLIDYPGPVVCIDPKGENAIVTARERARFGPVHILDPFGITGLPSAAFNPLDRIDPAGLDLADDAMTLADALVYDAPGEAGEAHWNDEAKALIAGLILHIVASEPPATRTLATLRDHLTLAPQAFAALLSDMQGCGGLVARAANRHLGKSDKEASGVLSAAQRHTHFLDSPRMGRVLGRSDFAFADMKASPATIFLVLPPDRIAAYARWLRLMIAQALTDLSRGAVPARPVLFLLDEFAALGRLDPVERAMGLMAGYGVQLWPICQDIHQLRTLYRERAGTFFSNAGALQIFGVNDHDSAKLVSDLLGQETVMFETMSRALDADETGISFGVQHVGRPLLTPDEVRTLRPDLQLLFLAGQRPIVATKLAYYVDREFAGRFDPVQPV
>NZ_CP015989.1|WP_020817744.1|166019_166247_+|conjugal-transfer-protein-TraD
MARRERTRHLIELGGLVQKAGLVDLTDDDRATLYGAMLDLAARVQGDDASNMLALWKRRGKRAFDAEANAGAGPT
>NZ_CP015989.1|WP_020817745.1|165676_165982_+|conjugal-transfer-protein-TraD
MRKVRDYDAELRALNDKARALKAKKVQQLGELVTSTGADALDPDTLAGALLAATESANADEREAWRVKGAAFFQGRGRKASRRAGGNTQGGHETGAGETPR
>NZ_CP015989.1|WP_066532666.1|162449_165503_-|Ti-type-conjugative-transfer-relaxase-TraA
MAIYHFSAKVISRANGSSAVASAAYRAAERLHDDRLGRDHDFSNKAGVVHSEIMLPEGAPERLNDRATLWNEVEAGEKRKDAQLAREIEFSIPRELNQAQGVALACEFVEKQFVERGMVADMNVHWDRGKDGQPKPHAHVMLSMREVGPEGFGQKVREWNSTQLLQEWREAWADHVNERLAELDIDARIDHRTLAAQGIDLEPQHKIGPAASRMPEQGLEAERVEDHARIARENGEKIIASPEIALDAITRQQATFTRRDLAQFAFRHSDGKDQFDQVMSAVRSSPELVALGPDGKGEDRFTSRDMIAAEQRLERAAEGLAIDRGHGVADAHVTRALASAEGRGLDLSAEQRGALAHITGDKGLASVVGYAGSGKSAMLGVAREAWEAQGYTVRGAALSGIAAENLEGGSAIASRTIASLEYQWEQGRELLGPRDVLVIDEAGMIGTRQMERVLSHAEQAGAKVVLVGDPEQLQAIEAGAAFRAVTERHGWAEITEIRRQREDWQRDATRALATGRAGEAIHAYEAHGMVQAAETRSQARADLVDRWDAERIAAPDQSRIILTHTNAEVRDLNLAARDRLRDGGELGPDVRVSAERGARAFANGDRIMFLKNERGLGVKNGTLGKVEQVSPERMAVRLDDGRSVAFDLKDYAHVDHGYAATIHKSQGVTVDRAHVLATPGMDRHSAYVALSRHRDGVQLHYGRDDFADYRRLVRTLSRERAKDMASDYGRAPDSRDRDAEARAFADRRGLSGEIRLPDAPREAGRDPRAEISPTERGSSAAPERGMFAGFTPRPIERTPAAEQTPRRGMFDGLKLSAEPAKPAPARADRGEDRAFTRAVERASRSAEAVLQARASGGPVLEHQKVALERATEALDQIRPGASRDMASAFQRDPALLREAAAGRSGPMVEAMRHEARVRADPALRADRFVERWQALRQDRDRLYRAGDMTGREKAGKEMAGMAKSLERDPQVESILRGRVRELGLEIGMNRSRDMGRGDLGRQLTQDLGIGRDRGLSR
>NZ_CP015989.1|WP_020817747.1|161734_162436_-|hypothetical-protein
MDEDSQERDDPALAFERLRGEVSLLRHAVEALTTARESIDIPDYEPTLERTEKVLGILVQQIDGVRKSPAMTLTPENMGGRLNASVAEATRELQHQVQSTKSALSSATFDLQKMVASARRGDVQNRWLAIAGGGGLVLGLLLYALLAGPIARMMPASWLWPESMATRALGEKSAWDAGQRLMQTAAPESWGLIVAAAPLADGNREAVQACREQAEKAKKPVRCTIEVRPATAQ
>NZ_CP015989.1|WP_020817748.1|161002_161662_+|TetR/AcrR-family-transcriptional-regulator
MPRNLDGEAPRRGIKREERRCAIVTIAQRHFAEHGFGGASMSAIAAEIGGSKATLWAYFQSKEDLFAAALSAWLDEIEPRSVAPSQGDARQRLIDYCTAFMSAMLTPVAETIFRLIVAEGQRFPELGRAYYRRVLLAHHLMLSELLEGQLRAGRLLPRSRAPSSLRAAEQLLEICMCRLLVRRVCGLELDSSADAIAREAAEAVDMFLHGYGSRPRRAR
>NZ_CP015989.1|WP_156518816.1|159523_160993_+|DHA2-family-efflux-MFS-transporter-permease-subunit
MAAAALSFGNFVVVLDTTIANVAMPTISGDLGVSTTEGTWIITAYAVAEAITVPLTGWLSRRFGEVRLFTACVIAFVICSILCGLSGSLGFLVLFRILQGFAGGPIIPLSATLLISVFPKDKSNIALAIWGMTTVVAPIFGPILGGYISDNYHWGWIFYINIFFGLAVSGVAWWLLHNRETPISRSRIDIVGLLLLVVFVSAFQTMIDKGRELDWFSSSFIVWMAIVAAIALGALILWELTDDDPVIDLSVFKNRTWLISTLSLGLMFGLFFGNIVLTPLWLQQMMGYTATWAGFATAPMGILAVVTAPIVGRLMGKIDPRLIVTYGMVVLAISFFMRALLNAQADFMSVAIPMFVLGAGVPACLVTLTSLGVSELPPEKIVNGSGLQNFIRIMATAVGASLTSTYWENATKGNRAELVAIIDPTMAPASLPGLQPGSGLAAFSRMVDMQAVMLATNDFYAMATILILVFAGVIWLAKRPKGPLQQVSH
>NZ_CP015989.1|WP_006949122.1|158295_159060_-|IS6-family-transposase
MNDFKGRHFTGEVILWAVRWYCRYGISYRDLEEMLSERGIDVDHTTIYRWVQRYAPEMEKRLRWFWRRGFDPSWRLDETYVKVRGKWTYLYRAVDKRGDTIDFYLSSTRSAKAAKRFLGKALRGLKDWEKPAKLNTDKAPSYGAAIAELKREGKLAAETEHRQVKYLNNVLEADHGKLKMLIKPVRGFKSMPTAYATIKGFEVMRALRKGQAQAWCLQPGIMGEVRLVERAFGIGPSALTETMIMLNKHFANAA
>NZ_CP015989.1|WP_013041565.1|156847_157222_-|hypothetical-protein
MDTERPVRWVASSKRDFREFPDDVQDVMGYALHLAQQGGQHASTKPLKGFGGAGVVEIIDDHQGDTFRTVYTVKFAEAVYVLHAFQKKSKQGKATPQADMDLIRTRLKSAEEHHRQHQTPRGTA
>NZ_CP015989.1|WP_006964370.1|156524_156851_-|XRE-family-transcriptional-regulator
MSAQDEIIEEGSGNVFADLGFADPDTHLLKAQLVTRVAEAMQERKLTQIAAAKVTGSTQPELSRILRGQFRSVSVERLLAMLTRLGCKVDIVVRPQGRTTESAVIHFA
>NZ_CP015989.1|WP_013039114.1|172178_172772_-|recombinase-family-protein
MALIGYARVSTADQKLSLQLDALNAAGCDRIFDDHASGAKADRPGLAEALAYLRSGDTLVVWKLDRLGRSMSHLIEKVGELATRGIGFRSLTENIDTTTSGGMLVFNIFGSLAQFERDLIRERTHAGLKAARERGRPGGRRPVVTPDKLRKAREHIASGLTVREAAARLKIGKTALYKALEATEKNTKSQRSRSVRS
>NZ_CP015989.1|WP_008829513.1|172911_175869_+|Tn3-family-transposase
MARRRLVSLEIWARHYGAPLDEREIARHYTLTSDDLEIVGRRRGDATRLGYAMLMLYMRWPGRALEAGEVPPAPVLAYVAQQLGVAPAAFADYAHRDQTRREHLVEIRRSHGFRIFDRNAFREVVAFSVPIAQTIIHPGQMADVIVDELRRLQILLPSPSILEAVLRRARQQAEQLTYEVLTNGLLPDTLQGLDDLLARRPGQVATWLSWMRNAPQSPAARNILRLIERLAYIRALGLDRARADMIPALTFDRLADEGSRITPQHLGELNALRRHATLAATGIRLEESLTDATLTMFDKLLGSMARRAENRTRDKALKTVRELQGHLRTLTGSCRLLIDARSKGVDSLAQIEALDWQHFAVAVEQAEVLGRPETVDRTAELIERHRTVKLFVGAFLNAFEFRGAGAVQGLLSALAIIAELYRTGKRRLPDRVPLRFVPPAWRPFVLRDGIVDRAAYELCALSQLRERLRAGDIWVAGSRQFRDFDSYLIPPATFAALREKGPLPLAIETDFERHIEERRTRLDTAIEQVTVLARQGELPQVKLDENGLIISPLKAATPPATEIARRAAYDRLPRVKITDLLLEVDAWTGFSECFIHRRSGREADDRNALLTVILADGINLGLTRMAETCRGASLRQLAHLHDWHISEAAYGEALGRLIDAHRAMPLAALWGDGTTSSSDGQQFHAGGRGAAIGDINARSGNEPGVAFYTHVSDRYDPFASRVIAATAGEAPYVLDGLLYHQTGLTIEEHYTDTGGASDHVFGLMPFFGYRFAPRLRDIKERRLHLLPGQESGPLLPGMTAEPIALGHVAAHWDELLRFATSIRTGTVTASAMLRRLSAYPRQNGLALALRELGRLERSIFMLDWLRDIDLRRRTQAGLNKGEARNALARALFFNQLGELRDRRFENQTYRASGLNLLVAAIILWNTRYLEMALADIGTADEIARHIAPLGWEHISLTGDYSWNVEDQPDPDALRPLRAVNSLLAA
>NZ_CP015989.1|WP_007686150.1|176639_177170_+|GNAT-family-N-acetyltransferase
MMMTGAPIKLTQADAADVADLYNRCSDYFLLQDGAAPTLDDARELFSDVPPEKSAHNQAVLGWKGPGGLYAIAAILRDYPRDGTWYLGFMIVDAAQRGRGVGRSIYSTVESWAAARGATEIRLAVLEANEAAERFWRSLGFIEYRRVGPDTFKMRSHRRIELSRRLSGATVEGSNK
>NZ_CP015989.1|WP_020817760.1|177234_177501_-|hypothetical-protein
MAIARKPNSKPKPPVTDDAADAFIAGAAKPTAPAITEAAEDGPRKSPVMLRFDRALLAKVDAAAKRRGISRSAWIQFTVSRALDAGEG
>NZ_CP015989.1|WP_015063478.1|177526_178162_-|AAA-family-ATPase
MILAVGNTKGGVGKTTLAVNLAVARALAGRDLLLVDGDEQGTALTFTELRAERLGEAGYTAVALTGAALRSQVRQLAPKYDDIIIDVGGRDTGSLRAALTVADTLLVPVQPRSFDVWALDQVAALVAEAREINEGLRAVAVLNGADPQGGDNEAALQMIGDIEGIEVLPTSIVRRKAFPNAAAEGRAVVEQSPRDAKAIDELAALVSAVFV
>NZ_CP015989.1|WP_020817759.1|178242_178878_-|transcription-elongation-protein-SprT
MTQDNRESWLNAVAAGMAPLFEALDAPLPAHIRVAIGFTSTGRKGKAIGECWDNRLSADGHFEIFIRPDLAHAADAMPAQIAAILAHELVHAAVGIPAGHGKAFKRVALGLGLVGPMRATTPGEAFLVAIAPILKAVGPLPHARLDTDGESTAPKKQKTRMLKCECATCGYTVRTARKWLELAGAPLCPIEDHGQMEHEPLDDEDEGEGGE
>NZ_CP015989.1|WP_020817758.1|179380_179800_+|putative-toxin-antitoxin-system-toxin-component,-PIN-family
MQRVVLDTSVIATALRSQTGASFALLRAVEYGRLKILATPSLFLEYEDVLKRPEQRQVSGLTLEAVDELLGELAALIEPVEVHLLWRPQLRDPDDEMVLEAAINGRADALVTYNIRDFRGAAPRFGIRLMQPADLLKEL
>NZ_CP015989.1|WP_020817757.1|179802_180081_+|toxin-antitoxin-system-HicB-family-antitoxin
MSKATYPLKLPTSIKAAAARLAKEDGVSLNQWIATAVAQKIGAVETAAEFFTRRAKGHTGSGLGRILDKVPNRPPEAGDELPEGWTLDRLRQ
>NZ_CP015989.1|WP_015063474.1|180087_180708_+|histidine-phosphatase-family-protein
MRAIFIRHGESTGNAGVPCHDLATIELTERGQEQARAVAASWTEAPALIVTSPYTRTRQTAAPTIARFPGVPVETWPIEEFTYLQPSRWNGTRSAERMPHLERYWSAADPDYCDGEGAESFGTLLRRCEAALARLAAMPADSLAYVFGHGQFIQAARAIVADAHMDDRAKMRAFWRKGEPPAIGNAQRVGFHWQGDRWACGPAVAA
>NZ_CP015989.1|WP_006949122.1|181106_181871_-|IS6-family-transposase
MNDFKGRHFTGEVILWAVRWYCRYGISYRDLEEMLSERGIDVDHTTIYRWVQRYAPEMEKRLRWFWRRGFDPSWRLDETYVKVRGKWTYLYRAVDKRGDTIDFYLSSTRSAKAAKRFLGKALRGLKDWEKPAKLNTDKAPSYGAAIAELKREGKLAAETEHRQVKYLNNVLEADHGKLKMLIKPVRGFKSMPTAYATIKGFEVMRALRKGQAQAWCLQPGIMGEVRLVERAFGIGPSALTETMIMLNKHFANAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP015989_1	1.1\|169570\|43\|NZ_CP015989\|CRISPRCasFinder	169570-169612	43	NZ_CP041020	Sphingobium fuliginis ATCC 27551 plasmid pSF3, complete sequence	43053-43095	0	1.0
NZ_CP015989_1	1.1\|169570\|43\|NZ_CP015989\|CRISPRCasFinder	169570-169612	43	NZ_CP041021	Sphingobium fuliginis ATCC 27551 plasmid pSF4, complete sequence	5424-5466	0	1.0
NZ_CP015989_1	1.1\|169570\|43\|NZ_CP015989\|CRISPRCasFinder	169570-169612	43	NZ_CP041021	Sphingobium fuliginis ATCC 27551 plasmid pSF4, complete sequence	24899-24941	0	1.0
NZ_CP015989_1	1.1\|169570\|43\|NZ_CP015989\|CRISPRCasFinder	169570-169612	43	NZ_CP015989	Sphingobium sp. EP60837 plasmid pEP2, complete sequence	169570-169612	0	1.0
NZ_CP015989_1	1.1\|169570\|43\|NZ_CP015989\|CRISPRCasFinder	169570-169612	43	NC_019376	Sphingobium fuliginis ATCC 27551 plasmid pPDL2, complete sequence	34846-34888	0	1.0
NZ_CP015989_1	1.1\|169570\|43\|NZ_CP015989\|CRISPRCasFinder	169570-169612	43	NZ_AP017658	Sphingobium cloacae strain JCM 10874 plasmid pSCLO_4, complete sequence	34772-34814	2	0.953
NZ_CP015989_1	1.1\|169570\|43\|NZ_CP015989\|CRISPRCasFinder	169570-169612	43	NZ_CP047220	Sphingobium yanoikuyae strain YC-JY1 plasmid unnamed3, complete sequence	56937-56979	2	0.953

1. spacer 1.1|169570|43|NZ_CP015989|CRISPRCasFinder matches to NZ_CP041020 (Sphingobium fuliginis ATCC 27551 plasmid pSF3, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtgagttttcgggtagccttcggtgagctttggggtcggta	CRISPR spacer
gcgtgagttttcgggtagccttcggtgagctttggggtcggta	Protospacer
*******************************************

2. spacer 1.1|169570|43|NZ_CP015989|CRISPRCasFinder matches to NZ_CP041021 (Sphingobium fuliginis ATCC 27551 plasmid pSF4, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtgagttttcgggtagccttcggtgagctttggggtcggta	CRISPR spacer
gcgtgagttttcgggtagccttcggtgagctttggggtcggta	Protospacer
*******************************************

3. spacer 1.1|169570|43|NZ_CP015989|CRISPRCasFinder matches to NZ_CP041021 (Sphingobium fuliginis ATCC 27551 plasmid pSF4, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtgagttttcgggtagccttcggtgagctttggggtcggta	CRISPR spacer
gcgtgagttttcgggtagccttcggtgagctttggggtcggta	Protospacer
*******************************************

4. spacer 1.1|169570|43|NZ_CP015989|CRISPRCasFinder matches to NZ_CP015989 (Sphingobium sp. EP60837 plasmid pEP2, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtgagttttcgggtagccttcggtgagctttggggtcggta	CRISPR spacer
gcgtgagttttcgggtagccttcggtgagctttggggtcggta	Protospacer
*******************************************

5. spacer 1.1|169570|43|NZ_CP015989|CRISPRCasFinder matches to NC_019376 (Sphingobium fuliginis ATCC 27551 plasmid pPDL2, complete sequence) position: , mismatch: 0, identity: 1.0

gcgtgagttttcgggtagccttcggtgagctttggggtcggta	CRISPR spacer
gcgtgagttttcgggtagccttcggtgagctttggggtcggta	Protospacer
*******************************************

6. spacer 1.1|169570|43|NZ_CP015989|CRISPRCasFinder matches to NZ_AP017658 (Sphingobium cloacae strain JCM 10874 plasmid pSCLO_4, complete sequence) position: , mismatch: 2, identity: 0.953

gcgtgagttttcgggtagccttcggtgagctttggggtcggta	CRISPR spacer
gcgtgagttttggggtagccttcggtgagttttggggtcggta	Protospacer
*********** *****************.*************

7. spacer 1.1|169570|43|NZ_CP015989|CRISPRCasFinder matches to NZ_CP047220 (Sphingobium yanoikuyae strain YC-JY1 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.953

gcgtgagttttcgggtagccttcggtgagctttggggtcggta	CRISPR spacer
gcgtgagttttagggtagccttcggtgagttttggggtcggta	Protospacer
*********** *****************.*************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1976 : 51494

Lactococcus_phage(16.67%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961814.1\|1976_4886_-\|transposase	Tn3 family transposase	NA	NA	NA	NA
WP_156518801.1\|4925_5204_+	hypothetical protein	NA	NA	NA	NA
WP_066532444.1\|5258_5825_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_066532446.1\|5821_6316_+	hypothetical protein	NA	NA	NA	NA
WP_066532447.1\|6809_8330_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_082919880.1\|8679_8991_-	hypothetical protein	NA	NA	NA	NA
WP_156518811.1\|9061_10582_-	GMC family oxidoreductase	NA	NA	NA	NA
WP_001389365.1\|10669_11434_-\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
WP_156518803.1\|11466_13350_-	hypothetical protein	NA	NA	NA	NA
WP_156518813.1\|13438_14719_-	serine/threonine protein phosphatase	NA	NA	NA	NA
WP_006955904.1\|14911_15691_-	Mobile element protein	A0A059NT77	Lactococcus_phage	7.6e-30	34.8
WP_032490240.1\|15680_17201_-\|transposase	IS21-like element ISRsp3 family transposase	U5N3F9	Enterobacteria_phage	1.5e-21	27.7
WP_082919880.1\|17453_17765_-	hypothetical protein	NA	NA	NA	NA
WP_066532457.1\|17835_18300_-	hypothetical protein	NA	NA	NA	NA
WP_006955904.1\|18434_19214_-	Mobile element protein	A0A059NT77	Lactococcus_phage	7.6e-30	34.8
WP_032490240.1\|19203_20724_-\|transposase	IS21-like element ISRsp3 family transposase	U5N3F9	Enterobacteria_phage	1.5e-21	27.7
WP_066532463.1\|20864_21116_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_066532670.1\|21223_21538_-	single-stranded DNA-binding protein	F8TUL2	EBPR_podovirus	4.4e-05	32.4
WP_066532672.1\|21931_22615_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_081215339.1\|22741_22999_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_004213289.1\|23112_23292_+	hypothetical protein	NA	NA	NA	NA
WP_006953912.1\|23309_23549_-	hypothetical protein	NA	NA	NA	NA
WP_004213291.1\|23611_23833_-	hypothetical protein	NA	NA	NA	NA
WP_006953908.1\|24130_24448_-	hypothetical protein	NA	NA	NA	NA
WP_006953903.1\|24669_24927_-	hypothetical protein	NA	NA	NA	NA
WP_006953901.1\|25183_25666_-	hypothetical protein	A0A1X9SGN6	Bradyrhizobium_phage	3.9e-24	45.5
WP_006953899.1\|25815_26625_-	hypothetical protein	NA	NA	NA	NA
WP_006953897.1\|26621_26870_-	hypothetical protein	NA	NA	NA	NA
WP_006953895.1\|27366_27627_-	hypothetical protein	A0A2I7S8R6	Vibrio_phage	1.5e-06	51.0
WP_006953891.1\|28026_28263_-	hypothetical protein	NA	NA	NA	NA
WP_006953889.1\|28728_29019_+	hypothetical protein	NA	NA	NA	NA
WP_007016089.1\|29060_29594_-	hypothetical protein	NA	NA	NA	NA
WP_004213310.1\|29590_29800_-	hypothetical protein	NA	NA	NA	NA
WP_004213311.1\|29812_30079_-	hypothetical protein	NA	NA	NA	NA
WP_006953883.1\|30075_30363_-	hypothetical protein	NA	NA	NA	NA
WP_013054018.1\|30374_30764_-	DUF3768 domain-containing protein	NA	NA	NA	NA
WP_006968049.1\|31091_32372_-	cell filamentation protein Fic	NA	NA	NA	NA
WP_006968047.1\|32375_32636_-	hypothetical protein	NA	NA	NA	NA
WP_004213405.1\|32783_33656_-	DUF1738 domain-containing protein	A0A1V0EEV1	Caulobacter_phage	3.0e-51	39.9
WP_021319980.1\|34139_35915_-	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
WP_066532466.1\|36393_39363_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.7e-202	40.4
WP_011607925.1\|39503_40073_+	recombinase family protein	A0A219Y9V9	Aeromonas_phage	1.2e-32	45.0
WP_066532468.1\|40148_40367_+	hypothetical protein	NA	NA	NA	NA
WP_066532470.1\|40453_40831_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_156518805.1\|40830_41502_-	redoxin domain-containing protein	NA	NA	NA	NA
WP_066532674.1\|41606_42515_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_066532677.1\|42514_42946_+	YeeE/YedE family protein	NA	NA	NA	NA
WP_066532472.1\|42942_43383_+	hypothetical protein	NA	NA	NA	NA
WP_066532474.1\|43404_45090_+	TIGR01244 family phosphatase	NA	NA	NA	NA
WP_066532679.1\|45095_45872_+	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_066532476.1\|46029_47433_+	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_066532479.1\|47438_48446_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_082919883.1\|48445_48559_+	DUF2474 domain-containing protein	NA	NA	NA	NA
WP_066532482.1\|48820_49825_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.1e-41	33.5
WP_066532485.1\|50075_51494_-\|transposase	ISNCY family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

121758 : 153851

Escherichia_phage(33.33%)

integrase,transposase

attL 111467:111484|attR 140131:140148

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
111467:111484	attL	NA	NA	NA	NA
WP_066532636.1\|121758_122997_+\|integrase	integrase	NA	NA	NA	NA
WP_066532640.1\|123316_124258_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_066532643.1\|124467_125397_+	MCE family protein	NA	NA	NA	NA
WP_066532645.1\|125441_126092_+	hypothetical protein	NA	NA	NA	NA
WP_139114818.1\|126507_127071_+	DUF4142 domain-containing protein	NA	NA	NA	NA
WP_082919886.1\|127217_127694_+	hypothetical protein	NA	NA	NA	NA
WP_066532650.1\|128270_129419_+	HlyD family secretion protein	NA	NA	NA	NA
WP_006949122.1\|130415_131180_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	3.8e-90	67.8
WP_017501681.1\|131915_132347_+	hypothetical protein	NA	NA	NA	NA
WP_004213366.1\|133331_134435_+	replication initiator protein A	A0A0K1Y6J9	Rhodobacter_phage	2.8e-62	40.5
WP_017501683.1\|134479_134764_-	hypothetical protein	NA	NA	NA	NA
WP_017501684.1\|134763_135399_-	AAA family ATPase	A2I303	Vibrio_virus	1.1e-10	35.9
WP_017501687.1\|136567_136849_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_026109291.1\|136817_137138_+	type II toxin-antitoxin system YafQ family toxin	NA	NA	NA	NA
WP_017501689.1\|137140_137761_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_038292857.1\|137794_138340_-	recombinase family protein	K7PJT4	Enterobacteria_phage	7.4e-24	40.3
WP_082594594.1\|139047_139701_-	hypothetical protein	NA	NA	NA	NA
WP_006961816.1\|139663_140530_-	recombinase family protein	E5FFF9	Burkholderia_phage	4.8e-25	40.0
140131:140148	attR	NA	NA	NA	NA
WP_001389365.1\|142756_143521_-\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
WP_066532720.1\|143819_145541_-	hypothetical protein	NA	NA	NA	NA
WP_066532655.1\|146197_148333_-	TonB-dependent receptor	NA	NA	NA	NA
WP_001389365.1\|148533_149298_+\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
WP_066532656.1\|149733_150285_-	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
WP_066532658.1\|150475_151498_-	ParB/RepB/Spo0J family partition protein	S5WII0	Leptospira_phage	1.2e-06	30.6
WP_007686288.1\|151593_152361_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	2.9e-42	39.2
WP_011950768.1\|152357_153851_-\|transposase	IS21 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP015986

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 8980

Salmonella_virus(33.33%)

integrase

attL 2753:2766|attR 10221:10234

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_156518328.1\|750_900_+	hypothetical protein	NA	NA	NA	NA
WP_066523516.1\|896_1115_+	single-stranded DNA-binding protein	NA	NA	NA	NA
WP_066523517.1\|1309_1666_+	DUF968 domain-containing protein	NA	NA	NA	NA
WP_066523518.1\|1720_2059_+	hypothetical protein	A0A1R3Y605	Salmonella_virus	8.4e-10	37.3
WP_066523519.1\|2233_3043_+	hypothetical protein	NA	NA	NA	NA
2753:2766	attL	NA	NA	NA	NA
WP_156518330.1\|3042_3195_+	hypothetical protein	NA	NA	NA	NA
WP_066523523.1\|3191_4085_+	hypothetical protein	NA	NA	NA	NA
WP_156518332.1\|4106_4634_+	hypothetical protein	NA	NA	NA	NA
WP_082919508.1\|4946_6017_+\|integrase	tyrosine-type recombinase/integrase	A0A291AUQ3	Sinorhizobium_phage	1.1e-31	32.5
WP_156518506.1\|6237_6573_-	hypothetical protein	NA	NA	NA	NA
WP_066523530.1\|6729_7389_-	endonuclease III	NA	NA	NA	NA
WP_066528375.1\|7396_8161_-	4-hydroxy-tetrahydrodipicolinate reductase	NA	NA	NA	NA
WP_066523531.1\|8281_8980_+	NAD-dependent deacylase	A0A2I7S9Y2	Vibrio_phage	2.5e-24	37.1
10221:10234	attR	NA	NA	NA	NA

DBSCAN-SWA_2

13939 : 15976

Agrobacterium_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066523546.1\|13939_14575_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	1.4e-58	58.8
WP_066523548.1\|14707_15976_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.3e-127	57.3

DBSCAN-SWA_3

43898 : 52063

Acinetobacter_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066523591.1\|43898_46904_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	1.8e-23	23.6
WP_066523592.1\|47214_48558_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	9.0e-79	40.4
WP_066528383.1\|48921_50067_+	family 16 glycosylhydrolase	NA	NA	NA	NA
WP_066523594.1\|50051_50981_-	glycosyltransferase	NA	NA	NA	NA
WP_066523595.1\|50977_52063_-	acyltransferase	G9L6E5	Escherichia_phage	3.1e-13	25.1

DBSCAN-SWA_4

73831 : 75924

Enterobacteria_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_156518339.1\|73831_74632_-	AAA family ATPase	U5N3V8	Enterobacteria_phage	2.3e-58	47.3
WP_156518341.1\|74628_75924_-\|transposase	IS21 family transposase	U5N3F9	Enterobacteria_phage	2.2e-34	30.7

DBSCAN-SWA_5

83770 : 85555

Wolbachia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066523655.1\|83770_85555_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	1.7e-93	35.8

DBSCAN-SWA_6

97678 : 100378

Stenotrophomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066523673.1\|97678_100378_+	pyruvate, phosphate dikinase	A0A2D2W2B1	Stenotrophomonas_phage	4.6e-90	42.9

DBSCAN-SWA_7

116867 : 118613

Pithovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082919512.1\|116867_118613_-	type I secretion system permease/ATPase	W5SAS9	Pithovirus	2.1e-19	32.9

DBSCAN-SWA_8

124706 : 129673

Hokovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066523710.1\|124706_126083_+	deoxyribodipyrimidine photo-lyase	A0A1V0SGL1	Hokovirus	6.9e-42	29.3
WP_066523712.1\|126116_127382_+	class I SAM-dependent methyltransferase	A0A2I2L5L3	Orpheovirus	2.7e-32	34.2
WP_066523714.1\|127385_128096_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_066523716.1\|128194_129673_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.0e-48	33.4

DBSCAN-SWA_9

134840 : 148638

Paramecium_bursaria_Chlorella_virus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066523728.1\|134840_136769_+	potassium transporter Kup	A7J6G4	Paramecium_bursaria_Chlorella_virus	6.2e-73	30.6
WP_066528420.1\|136830_137295_-	Hsp20 family protein	R9S5E2	Prochlorococcus_phage	4.4e-17	37.6
WP_066523733.1\|137750_139001_+	lipoprotein-releasing ABC transporter permease subunit	NA	NA	NA	NA
WP_066523735.1\|138993_139683_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.9e-32	35.2
WP_066523736.1\|139668_141477_-	diguanylate cyclase	NA	NA	NA	NA
WP_066523737.1\|141667_145210_+	DNA polymerase III subunit alpha	A0A291AVG1	Streptomyces_phage	3.7e-172	35.4
WP_066523739.1\|145211_146279_-	PA0069 family radical SAM protein	NA	NA	NA	NA
WP_066523741.1\|146323_146851_-	molybdenum cofactor biosynthesis protein B	NA	NA	NA	NA
WP_066523743.1\|146850_148638_-	lytic transglycosylase domain-containing protein	A0A0S2SXN2	Bacillus_phage	1.2e-06	33.1

DBSCAN-SWA_10

157863 : 159072

Streptococcus_phi-m46.1-like_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066523761.1\|157863_159072_+	class I SAM-dependent RNA methyltransferase	F5CA72	Streptococcus_phi-m46.1-like_phage	1.4e-06	29.9

DBSCAN-SWA_11

165202 : 166786

Emiliania_huxleyi_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066523772.1\|165202_166786_-	cisplatin damage response ATP-dependent DNA ligase	V5LRQ9	Emiliania_huxleyi_virus	7.7e-13	25.0

DBSCAN-SWA_12

171604 : 177108

Thermus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066523783.1\|171604_172687_+	DNA-protecting protein DprA	S6BFL3	Thermus_phage	3.9e-24	40.8
WP_066523785.1\|172761_175311_+	type I DNA topoisomerase	A0A1V0SCS0	Indivirus	1.5e-98	32.2
WP_066523787.1\|175454_176363_-	GTPase Era	NA	NA	NA	NA
WP_082919517.1\|176436_177108_-	ribonuclease III	A0A2K9R4Y7	Dishui_lake_phycodnavirus	1.2e-18	31.9

DBSCAN-SWA_13

197967 : 200889

Tupanvirus(50.0%)

tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066523802.1\|197967_199494_+\|tRNA	proline--tRNA ligase	A0A2K9L3R9	Tupanvirus	1.7e-78	34.3
WP_066523803.1\|199587_200889_-\|protease	ATP-dependent protease ATPase subunit HslU	A0A2H5BJT2	Erwinia_phage	7.7e-43	30.2

DBSCAN-SWA_14

208738 : 214705

Pelagibacter_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066528444.1\|208738_209221_-	peroxiredoxin	M1I839	Pelagibacter_phage	1.0e-24	46.8
WP_066523811.1\|209356_209917_+	YqgE/AlgH family protein	NA	NA	NA	NA
WP_066523812.1\|210101_210638_+	hypothetical protein	NA	NA	NA	NA
WP_066523813.1\|210758_212168_+	adenosylhomocysteinase	S4W1G4	Pandoravirus	1.4e-45	31.2
WP_066523814.1\|212356_214705_+	histidine kinase	W8CYF6	Bacillus_phage	4.8e-19	27.4

DBSCAN-SWA_15

219794 : 223586

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066523818.1\|219794_223235_+	double-strand break repair helicase AddA	G3MA40	Bacillus_virus	3.4e-05	27.9
WP_066523819.1\|223265_223586_+	thioredoxin TrxA	A0A1J0GW78	Streptomyces_phage	1.7e-23	53.1

DBSCAN-SWA_16

231152 : 239020

Stx2-converting_phage(20.0%)

tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066523825.1\|231152_232316_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	3.9e-46	33.5
WP_066523826.1\|232312_232939_+	dTMP kinase	Q2Z0N0	Pseudomonas_phage	1.6e-17	36.8
WP_066523827.1\|232935_233907_+	AAA family ATPase	A0A1U9WR94	Streptococcus_virus	3.6e-05	27.7
WP_066523828.1\|233950_235513_+\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	3.5e-90	38.8
WP_066523829.1\|235517_236306_+	TatD family hydrolase	NA	NA	NA	NA
WP_066523830.1\|236302_237088_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_066523831.1\|237092_237722_+\|protease	TIGR02281 family clan AA aspartic protease	NA	NA	NA	NA
WP_066523832.1\|237718_239020_+	MFS transporter	Q6JIH2	Burkholderia_virus	4.2e-49	31.8

DBSCAN-SWA_17

246827 : 249080

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066523837.1\|246827_249080_-	HAMP domain-containing protein	W8CYF6	Bacillus_phage	1.1e-09	21.8

DBSCAN-SWA_18

254027 : 254540

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066523842.1\|254027_254540_+	CinA family protein	B5TK85	Pseudomonas_phage	6.8e-19	46.0

DBSCAN-SWA_19

257907 : 259593

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066523847.1\|257907_259593_-	energy-dependent translational throttle protein EttA	A0A2K9L0W2	Tupanvirus	1.3e-50	28.4

DBSCAN-SWA_20

270291 : 271095

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066528459.1\|270291_271095_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.0e-29	34.3

DBSCAN-SWA_21

281106 : 283836

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066523862.1\|281106_283836_+	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	1.2e-93	31.5

DBSCAN-SWA_22

299360 : 301637

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066523878.1\|299360_301637_+	AAA family ATPase	A7KV33	Bacillus_phage	1.2e-107	34.9

DBSCAN-SWA_23

310199 : 312854

Tupanvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066523887.1\|310199_312854_-\|tRNA	alanine--tRNA ligase	A0A2K9L1X7	Tupanvirus	1.4e-70	35.7

DBSCAN-SWA_24

317274 : 329897

Burkholderia_phage(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066523891.1\|317274_317547_-	HU family DNA-binding protein	B5TA87	Burkholderia_phage	1.3e-16	53.3
WP_066523892.1\|317728_320125_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	5.1e-202	48.6
WP_066523893.1\|320253_320577_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_066523894.1\|320573_322181_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	5.8e-40	41.7
WP_082919525.1\|322371_323289_-	SGM family class A beta-lactamase	A0A1B0VBP7	Salmonella_phage	1.2e-45	41.1
WP_066523896.1\|323313_323649_-	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_066523897.1\|323667_324759_-	cysteine desulfurase	H7BUW1	unidentified_phage	5.1e-32	39.0
WP_066523898.1\|324755_325793_-	aminotransferase class V-fold PLP-dependent enzyme	A0A1X6WFP1	Pacmanvirus	4.9e-24	28.5
WP_037463024.1\|325939_326596_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_066523899.1\|326741_327827_+	HPP family protein	NA	NA	NA	NA
WP_066528479.1\|327827_328025_-	hypothetical protein	NA	NA	NA	NA
WP_066523900.1\|328127_328565_+	ribose 5-phosphate isomerase B	NA	NA	NA	NA
WP_066523901.1\|328577_329897_+	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	3.3e-102	52.0

DBSCAN-SWA_25

334132 : 336330

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066523910.1\|334132_335119_+	agmatine deiminase family protein	A7IVE6	Paramecium_bursaria_Chlorella_virus	4.6e-48	35.2
WP_066528490.1\|335124_335469_+	DUF3147 family protein	NA	NA	NA	NA
WP_066523912.1\|335481_336330_+	N-carbamoylputrescine amidase	M1I0M9	Paramecium_bursaria_Chlorella_virus	2.0e-63	43.0

DBSCAN-SWA_26

372615 : 375081

Dickeya_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066523962.1\|372615_375081_-	glycogen/starch/alpha-glucan phosphorylase	A0A140XAG6	Dickeya_phage	1.0e-11	44.1

DBSCAN-SWA_27

392101 : 393850

Micromonas_pusilla_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066523986.1\|392101_393850_+	acetolactate synthase 3 large subunit	G8DDL3	Micromonas_pusilla_virus	1.3e-53	29.7

DBSCAN-SWA_28

408211 : 409486

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524006.1\|408211_409486_-	phosphopyruvate hydratase	W6LP63	Streptococcus_phage	1.7e-143	60.8

DBSCAN-SWA_29

418469 : 423374

Xanthomonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524024.1\|418469_418922_+	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	1.7e-18	41.8
WP_066524025.1\|418985_419396_+	endonuclease domain-containing protein	NA	NA	NA	NA
WP_066524026.1\|419392_421291_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	5.1e-88	36.9
WP_066524028.1\|421328_423374_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	8.4e-36	31.8

DBSCAN-SWA_30

427824 : 432951

uncultured_Caudovirales_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082919530.1\|427824_429204_-	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.2e-09	25.9
WP_066528521.1\|429335_430511_+	VWA domain-containing protein	NA	NA	NA	NA
WP_066524035.1\|430518_431607_-	anhydro-N-acetylmuramic acid kinase	NA	NA	NA	NA
WP_066524037.1\|431733_432951_+\|tRNA	tyrosine--tRNA ligase	A0A2C9CX69	Yersinia_phage	6.1e-58	36.5

DBSCAN-SWA_31

456525 : 457920

Microcystis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524064.1\|456525_457920_+	YdiU family protein	A0A075BSJ0	Microcystis_phage	1.3e-85	41.0

DBSCAN-SWA_32

464796 : 469381

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524079.1\|464796_466281_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	2.4e-77	39.1
WP_066528531.1\|466399_466882_+	UPF0262 family protein	NA	NA	NA	NA
WP_066524080.1\|466963_467581_+	glycoside hydrolase family 25	NA	NA	NA	NA
WP_066528534.1\|467577_468027_+	cytidine deaminase	NA	NA	NA	NA
WP_066524082.1\|468028_468583_+	dCTP deaminase	S5VM63	Pseudomonas_phage	8.8e-65	66.1
WP_066524084.1\|468628_469381_+	serine/threonine protein phosphatase	K4JNE2	Caulobacter_virus	1.7e-26	36.7

DBSCAN-SWA_33

473007 : 473715

Roseobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524089.1\|473007_473715_-	response regulator transcription factor	A0A0K0PVG9	Roseobacter_phage	1.4e-17	55.7

DBSCAN-SWA_34

493805 : 495701

Powai_lake_megavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524116.1\|493805_495701_-	amidotransferase 1, exosortase A system-associated	A0A167RC99	Powai_lake_megavirus	1.1e-18	26.2

DBSCAN-SWA_35

507659 : 511670

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524133.1\|507659_509192_-	acyl-CoA ligase (AMP-forming), exosortase A system-associated	A0A2K9KZV5	Tupanvirus	1.7e-25	25.2
WP_066524134.1\|509241_510249_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_066524135.1\|510278_510569_+	acyl carrier protein	NA	NA	NA	NA
WP_066528545.1\|510707_511670_-	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	8.1e-66	45.4

DBSCAN-SWA_36

517279 : 519178

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524144.1\|517279_519178_-	potassium transporter Kup	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	1.2e-76	34.3

DBSCAN-SWA_37

523366 : 524641

Ostreococcus_tauri_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524148.1\|523366_524641_+	ammonium transporter	H8ZJB2	Ostreococcus_tauri_virus	3.8e-18	25.6

DBSCAN-SWA_38

536292 : 537213

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524161.1\|536292_537213_+	alpha/beta hydrolase	A0A291AV30	Mycobacterium_phage	1.4e-06	29.5

DBSCAN-SWA_39

554538 : 560617

Klosneuvirus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524202.1\|554538_557424_-\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	2.3e-63	25.0
WP_066524205.1\|557583_558525_-	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
WP_066524206.1\|558568_559069_-	dihydrofolate reductase	G3MBI7	Bacillus_virus	1.7e-22	38.8
WP_066524207.1\|559065_560136_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_066524209.1\|560137_560617_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	7.0e-18	41.3

DBSCAN-SWA_40

564699 : 567815

Molluscum_contagiosum_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066528558.1\|564699_565245_-	glutathione peroxidase	A0A1S7DM81	Molluscum_contagiosum_virus	2.2e-12	34.8
WP_156518368.1\|565285_566014_-	VIT family protein	NA	NA	NA	NA
WP_066524219.1\|566033_567815_-	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	4.1e-39	26.4

DBSCAN-SWA_41

593749 : 595567

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524260.1\|593749_595567_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.6e-15	31.3

DBSCAN-SWA_42

603911 : 605297

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524280.1\|603911_605297_+	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	3.2e-15	24.9

DBSCAN-SWA_43

613243 : 616424

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524298.1\|613243_614242_-	D-glycerate dehydrogenase	M1I4S0	Paramecium_bursaria_Chlorella_virus	5.0e-18	26.6
WP_066524299.1\|614368_614839_+	hypothetical protein	NA	NA	NA	NA
WP_066524300.1\|614843_616424_-	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	3.6e-71	35.7

DBSCAN-SWA_44

622887 : 623550

Rhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524310.1\|622887_623550_-	sigma-70 family RNA polymerase sigma factor	A0A076YQ50	Rhizobium_phage	7.4e-10	29.7

DBSCAN-SWA_45

626945 : 628076

uncultured_Mediterranean_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524317.1\|626945_628076_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	2.9e-99	50.8

DBSCAN-SWA_46

631784 : 637429

uncultured_virus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524326.1\|631784_633431_-	chaperonin GroEL	A0A219YK78	uncultured_virus	3.9e-177	62.2
WP_025549259.1\|633532_633820_-	co-chaperone GroES	A0A221S4G8	uncultured_virus	7.4e-23	60.9
WP_066524328.1\|634195_635068_+	glutathione-dependent disulfide-bond oxidoreductase	NA	NA	NA	NA
WP_066528580.1\|635284_637429_-	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	3.6e-122	39.2

DBSCAN-SWA_47

645553 : 648148

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524339.1\|645553_648148_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	2.1e-23	24.6

DBSCAN-SWA_48

652987 : 654619

Only_Syngen_Nebraska_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524353.1\|652987_654619_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	4.1e-150	49.3

DBSCAN-SWA_49

664735 : 666337

Pike_perch_iridovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066528593.1\|664735_666337_-	methylcrotonoyl-CoA carboxylase	A0A1B2ITV7	Pike_perch_iridovirus	5.6e-19	63.9

DBSCAN-SWA_50

669899 : 675781

uncultured_Mediterranean_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524372.1\|669899_670652_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	6.6e-31	51.4
WP_066524374.1\|670748_671258_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	7.4e-34	47.3
WP_066524376.1\|671261_672170_-	farnesyl-diphosphate synthase	NA	NA	NA	NA
WP_066524378.1\|672181_672442_-	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_066524381.1\|672612_672996_+	hypothetical protein	NA	NA	NA	NA
WP_066524383.1\|673060_673495_-	DUF805 domain-containing protein	NA	NA	NA	NA
WP_066524385.1\|673603_675781_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.2e-152	41.6

DBSCAN-SWA_51

682385 : 683303

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524405.1\|682385_683303_-	tyrosine recombinase	A0A1B1SGM4	Mycobacterium_phage	1.3e-12	32.7

DBSCAN-SWA_52

694643 : 695387

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524424.1\|694643_695387_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	2.9e-18	38.5

DBSCAN-SWA_53

699938 : 700673

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066528596.1\|699938_700673_-	phosphatidylserine decarboxylase	A0A1V0SDU9	Indivirus	2.1e-13	39.1

DBSCAN-SWA_54

705464 : 707288

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524441.1\|705464_707288_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	3.8e-112	40.3

DBSCAN-SWA_55

710494 : 713129

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524449.1\|710494_711667_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	4.5e-10	36.7
WP_066524451.1\|711728_713129_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	5.0e-40	27.7

DBSCAN-SWA_56

732895 : 737270

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082919538.1\|732895_734509_-	M23 family metallopeptidase	G9BW84	Planktothrix_phage	1.7e-20	46.1
WP_066528598.1\|734642_737270_+	helicase	A0A248SJQ0	Salicola_phage	5.0e-25	31.9

DBSCAN-SWA_57

742381 : 745486

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524504.1\|742381_745486_-	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	3.2e-71	24.3

DBSCAN-SWA_58

753609 : 754320

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524515.1\|753609_754320_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.7e-31	34.3

DBSCAN-SWA_59

772147 : 772405

Rhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524549.1\|772147_772405_-	glutaredoxin 3	V9QKN6	Rhizobium_phage	2.5e-14	51.9

DBSCAN-SWA_60

780631 : 785008

Catovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066528616.1\|780631_781522_-	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	9.7e-05	29.8
WP_066524559.1\|781594_782476_+	metallophosphoesterase	NA	NA	NA	NA
WP_066524560.1\|782480_782990_-	DUF2239 family protein	NA	NA	NA	NA
WP_066524562.1\|783056_783830_-	exodeoxyribonuclease III	NA	NA	NA	NA
WP_066524564.1\|783895_784222_-	iron-sulfur cluster insertion protein ErpA	NA	NA	NA	NA
WP_066524565.1\|784303_785008_-	M23 family metallopeptidase	A8ATH6	Listeria_phage	1.3e-23	50.5

DBSCAN-SWA_61

789787 : 790663

Rhodococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066528619.1\|789787_790663_-	zinc metallopeptidase	A0A1I9SA48	Rhodococcus_phage	2.0e-34	39.8

DBSCAN-SWA_62

794751 : 810834

uncultured_Caudovirales_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_156518382.1\|794751_795330_+	GNAT family N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	2.4e-41	47.7
WP_066524585.1\|795399_796386_-	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_066524587.1\|796382_797246_-	HprK-related kinase A	NA	NA	NA	NA
WP_066524588.1\|797242_797527_-	HPr-rel-A system PqqD family peptide chaperone	NA	NA	NA	NA
WP_156518519.1\|797586_798009_-	hypothetical protein	NA	NA	NA	NA
WP_066524591.1\|798119_799373_+	PAS domain-containing protein	W8CYF6	Bacillus_phage	1.1e-33	35.7
WP_066524592.1\|799526_800585_+	phosphate ABC transporter substrate-binding protein	A0A1B1IWY0	uncultured_Mediterranean_phage	2.6e-81	48.8
WP_066524594.1\|800594_801989_+	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_066524595.1\|801985_803230_+	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_066528620.1\|803235_804024_+	phosphate ABC transporter ATP-binding protein	M1IC18	Acanthocystis_turfacea_Chlorella_virus	1.4e-07	25.5
WP_066524598.1\|804044_804740_+	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_066524599.1\|804742_805444_+	phosphate regulon transcriptional regulatory protein PhoB	W8CYM9	Bacillus_phage	4.6e-34	36.2
WP_066524602.1\|805652_806183_-	peptide deformylase	E3SLL2	Synechococcus_phage	5.5e-24	44.3
WP_066524604.1\|806214_806811_-	recombination protein RecR	NA	NA	NA	NA
WP_066524606.1\|806928_807837_+\|tRNA	methionyl-tRNA formyltransferase	NA	NA	NA	NA
WP_066524607.1\|807931_808675_+\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_066528622.1\|808747_809467_-	queuosine precursor transporter	A0A2H4J2N7	uncultured_Caudovirales_phage	5.8e-16	29.1
WP_066524611.1\|809720_810071_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_066524612.1\|810180_810834_-	fructose-6-phosphate aldolase	M1PR54	Cyanophage	1.8e-48	48.4

DBSCAN-SWA_63

814358 : 817072

Moumouvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524619.1\|814358_815420_-	bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada	A0A2P1EL10	Moumouvirus	4.1e-18	53.4
WP_066528625.1\|815524_817072_+	trypsin-like peptidase domain-containing protein	A0A1B1IRH0	uncultured_Mediterranean_phage	4.0e-06	31.8

DBSCAN-SWA_64

830634 : 831507

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524639.1\|830634_831507_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0P0BXC9	Ostreococcus_lucimarinus_virus	1.0e-35	35.7

DBSCAN-SWA_65

841369 : 844069

Klosneuvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524649.1\|841369_844069_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	4.0e-134	36.8

DBSCAN-SWA_66

848895 : 851291

Moumouvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524658.1\|848895_849318_-	nucleoside-diphosphate kinase	M1PH31	Moumouvirus	1.3e-12	38.5
WP_066524660.1\|849408_849846_-	DNA polymerase III subunit chi	NA	NA	NA	NA
WP_066524662.1\|849845_851291_-	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	3.6e-49	38.3

DBSCAN-SWA_67

859049 : 864110

Klosneuvirus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524674.1\|859049_860507_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	1.0e-96	41.5
WP_066528657.1\|860802_862752_-	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	C7U047	Ostreococcus_tauri_virus	3.5e-116	43.1
WP_066524676.1\|862827_863019_-	hypothetical protein	NA	NA	NA	NA
WP_066524678.1\|863162_864110_-\|tRNA	tRNA lysidine(34) synthetase TilS	A7K9Y8	Acanthocystis_turfacea_chlorella_virus	6.5e-07	24.0

DBSCAN-SWA_68

868612 : 869779

Faustovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524684.1\|868612_869779_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A1X7BZP2	Faustovirus	2.3e-14	33.1

DBSCAN-SWA_69

885070 : 886666

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524702.1\|885070_886666_-	phosphoenolpyruvate carboxykinase	A0A2H4PQN1	Staphylococcus_phage	1.8e-150	51.7

DBSCAN-SWA_70

889747 : 890686

Thermobifida_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524706.1\|889747_890686_+	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	1.5e-11	32.6

DBSCAN-SWA_71

900211 : 906003

uncultured_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524727.1\|900211_901153_+	signal recognition particle-docking protein FtsY	D6PHS7	uncultured_phage	8.4e-15	40.0
WP_066524730.1\|901256_901904_+	septation protein IspZ	NA	NA	NA	NA
WP_066524734.1\|901982_902546_-	hypothetical protein	A0A1B1IVR4	uncultured_Mediterranean_phage	5.7e-43	59.9
WP_066524738.1\|902755_903367_+	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	4.4e-33	38.9
WP_066524741.1\|903491_903926_+	cation-binding protein	NA	NA	NA	NA
WP_066524742.1\|903909_904263_-	hypothetical protein	NA	NA	NA	NA
WP_066524747.1\|904235_904784_-	J domain-containing protein	NA	NA	NA	NA
WP_066528679.1\|905304_906003_-	N-acetylmuramoyl-L-alanine amidase	A0A076YN96	Rhizobium_phage	3.1e-06	31.0

DBSCAN-SWA_72

923732 : 925031

Aeropyrum_coil-shaped_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524781.1\|923732_925031_-	glycosyltransferase family 4 protein	J7Q7I8	Aeropyrum_coil-shaped_virus	5.2e-07	44.6

DBSCAN-SWA_73

930514 : 939490

uncultured_Caudovirales_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524800.1\|930514_930901_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	2.1e-12	38.1
WP_066524803.1\|930992_931745_-	hypothetical protein	NA	NA	NA	NA
WP_066524804.1\|931784_932075_-	hypothetical protein	NA	NA	NA	NA
WP_066524805.1\|932207_934994_+	DNA polymerase I	A0A142F1Q9	Bacillus_phage	2.1e-61	32.6
WP_066524806.1\|935099_936557_-	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	2.0e-55	29.8
WP_066528694.1\|936651_936942_-	hypothetical protein	NA	NA	NA	NA
WP_066528696.1\|936944_937655_-	Bax inhibitor-1/YccA family protein	NA	NA	NA	NA
WP_066524817.1\|937972_939490_+\|tRNA	cysteine--tRNA ligase	A0A0G2Y4Q1	Acanthamoeba_polyphaga_mimivirus	1.3e-28	27.7

DBSCAN-SWA_74

942508 : 948756

Lactococcus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524824.1\|942508_943258_+	ParA family protein	A0A1X9IGI7	Lactococcus_phage	1.8e-07	28.3
WP_066528702.1\|943429_945190_-	fatty acyl-AMP ligase	NA	NA	NA	NA
WP_066524826.1\|945351_945873_+	regulatory protein RecX	NA	NA	NA	NA
WP_066524830.1\|945956_946484_+	DUF192 domain-containing protein	A0A1B1IUW8	uncultured_Mediterranean_phage	1.5e-08	37.6
WP_066524833.1\|946534_946933_+	NADH:ubiquinone oxidoreductase subunit NDUFA12	NA	NA	NA	NA
WP_066524835.1\|947384_948137_-\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_066524838.1\|948345_948756_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	3.6e-31	54.3

DBSCAN-SWA_75

953203 : 954535

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524856.1\|953203_954535_+	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.6e-11	60.9

DBSCAN-SWA_76

961477 : 961720

Azospirillum_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524871.1\|961477_961720_+	DUF2312 domain-containing protein	B0VK10	Azospirillum_phage	3.8e-20	65.8

DBSCAN-SWA_77

967882 : 969064

Ugandan_cassava_brown_streak_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524892.1\|967882_968512_+	RdgB/HAM1 family non-canonical purine NTP pyrophosphatase	A0A2H4V901	Ugandan_cassava_brown_streak_virus	2.1e-14	35.2
WP_082919545.1\|968530_969064_-	Fis family transcriptional regulator	A0A2K9L4K0	Tupanvirus	1.4e-06	26.0

DBSCAN-SWA_78

981445 : 988609

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066528713.1\|981445_982321_-	MBL fold metallo-hydrolase	A0A1X9I5D3	Streptococcus_phage	1.3e-06	27.5
WP_066524922.1\|982494_983382_+	tyrosine recombinase XerC	A0A2K9VF00	Mycobacterium_phage	4.3e-13	35.5
WP_066524924.1\|983525_984125_-	DedA family protein	NA	NA	NA	NA
WP_066524926.1\|984213_985188_-	glutathione synthase	NA	NA	NA	NA
WP_066524928.1\|985680_986523_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	4.8e-38	38.9
WP_156518527.1\|986567_987734_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_066524932.1\|987829_988609_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	3.8e-13	27.5

DBSCAN-SWA_79

1003526 : 1005107

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524955.1\|1003526_1005107_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2I4R674	Erysipelothrix_phage	2.4e-22	31.2

DBSCAN-SWA_80

1016177 : 1020605

Acinetobacter_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524980.1\|1016177_1018796_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	3.1e-11	32.7
WP_082919548.1\|1018900_1019074_-	Trm112 family protein	NA	NA	NA	NA
WP_082919549.1\|1019070_1019682_-\|protease	ATP-dependent protease	NA	NA	NA	NA
WP_066524982.1\|1019693_1020605_-	tetratricopeptide repeat protein	A0A1J0GW78	Streptomyces_phage	3.5e-10	38.1

DBSCAN-SWA_81

1029056 : 1029950

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066524994.1\|1029056_1029950_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	6.3e-28	37.1

DBSCAN-SWA_82

1037560 : 1040750

Synechococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066528744.1\|1037560_1038655_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D8KLC2	Synechococcus_phage	6.9e-61	43.0
WP_066525012.1\|1038797_1039748_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	6.9e-25	38.3
WP_066525013.1\|1039823_1040750_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.7e-20	33.0

DBSCAN-SWA_83

1047836 : 1048883

Dickeya_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525021.1\|1047836_1048883_-	5-methyltetrahydrofolate--homocysteine methyltransferase	A0A140XBC7	Dickeya_phage	1.6e-11	47.6

DBSCAN-SWA_84

1054096 : 1054555

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525036.1\|1054096_1054555_+	nucleoside deaminase	S4VYT2	Pandoravirus	1.5e-09	47.9

DBSCAN-SWA_85

1057686 : 1065743

Enterobacteria_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525054.1\|1057686_1058793_-	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	9.2e-21	29.6
WP_066525060.1\|1058853_1059336_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_066525061.1\|1059448_1061554_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2I2L310	Orpheovirus	9.6e-11	36.1
WP_066528753.1\|1062271_1062787_+	50S ribosomal protein L10	NA	NA	NA	NA
WP_066525063.1\|1062868_1063243_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_066525064.1\|1063434_1063737_-	Hpt domain-containing protein	NA	NA	NA	NA
WP_066525067.1\|1063736_1064102_-	response regulator	W8CYM9	Bacillus_phage	4.2e-07	35.3
WP_066525069.1\|1064117_1065743_-	GAF domain-containing protein	A0A2K9L5I4	Tupanvirus	5.0e-15	25.2

DBSCAN-SWA_86

1076399 : 1079541

Catovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066528758.1\|1076399_1077533_-	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	4.1e-24	26.8
WP_066528763.1\|1077639_1079541_-	molecular chaperone DnaK	A0A2P1EIW2	Megavirus	7.8e-153	48.8

DBSCAN-SWA_87

1083739 : 1085416

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525129.1\|1083739_1085416_-	EAL domain-containing protein	G3MA91	Bacillus_virus	8.7e-15	30.5

DBSCAN-SWA_88

1095179 : 1100958

Bacillus_virus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525155.1\|1095179_1095992_-	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	G3MA33	Bacillus_virus	1.1e-28	32.2
WP_066525158.1\|1096132_1096864_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_066525161.1\|1096954_1098496_+	2-polyprenylphenol 6-hydroxylase	A0A2N9QVT9	Dishui_lake_phycodnavirus	5.0e-33	28.4
WP_066525164.1\|1098492_1099740_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	4.0e-41	32.9
WP_066525167.1\|1099714_1100179_+	dUTP diphosphatase	K4JSC8	Caulobacter_phage	6.1e-35	53.0
WP_066528769.1\|1100190_1100958_+	HesA/MoeB/ThiF family protein	A0A1V0SAV8	Catovirus	8.3e-05	27.1

DBSCAN-SWA_89

1104141 : 1106794

Tupanvirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525180.1\|1104141_1106133_+\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	4.2e-117	37.1
WP_037464624.1\|1106260_1106794_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	4.3e-16	33.6

DBSCAN-SWA_90

1111718 : 1112921

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525192.1\|1111718_1112921_-	aminodeoxychorismate synthase component I	S4VNU7	Pandoravirus	4.3e-40	40.4

DBSCAN-SWA_91

1122467 : 1125981

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525209.1\|1122467_1123154_+	response regulator transcription factor	W8CYM9	Bacillus_phage	7.4e-29	36.6
WP_082919650.1\|1123233_1124535_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_082919552.1\|1124571_1125981_-	FkbM family methyltransferase	A0A291AUV0	Sinorhizobium_phage	1.8e-08	31.7

DBSCAN-SWA_92

1140559 : 1143729

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082919651.1\|1140559_1141795_-	DegT/DnrJ/EryC1/StrS family aminotransferase	A0A2K9L470	Tupanvirus	4.7e-74	40.6
WP_156518529.1\|1141809_1143729_-	NAD-dependent epimerase/dehydratase family protein	A0A1V0SAI8	Catovirus	4.1e-16	26.2

DBSCAN-SWA_93

1152863 : 1154582

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525254.1\|1152863_1154582_+	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	2.9e-29	46.9

DBSCAN-SWA_94

1161440 : 1162259

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525274.1\|1161440_1162259_+	alpha/beta hydrolase	A0A286MQU8	Mycobacterium_phage	9.2e-10	24.7

DBSCAN-SWA_95

1180433 : 1184270

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525315.1\|1180433_1183043_-	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	3.7e-12	38.7
WP_066525317.1\|1183157_1184270_-	DNA polymerase III subunit beta	B4UTW9	Rhizobium_phage	3.8e-75	43.0

DBSCAN-SWA_96

1188758 : 1190525

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525332.1\|1188758_1190525_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	7.2e-52	32.1

DBSCAN-SWA_97

1197535 : 1201147

Streptomyces_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525344.1\|1197535_1201147_-	DNA polymerase III subunit alpha	R4TPF1	Streptomyces_phage	9.8e-72	27.2

DBSCAN-SWA_98

1205106 : 1217406

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525351.1\|1205106_1206180_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	4.2e-119	64.6
WP_066525352.1\|1206281_1206638_-	response regulator	NA	NA	NA	NA
WP_066525353.1\|1206719_1209146_-	PAS domain-containing sensor histidine kinase	W8CYM9	Bacillus_phage	1.4e-05	31.8
WP_066525355.1\|1209191_1209785_-	DUF2062 domain-containing protein	NA	NA	NA	NA
WP_066525357.1\|1209784_1210267_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	1.3e-32	50.7
WP_066525358.1\|1210312_1211191_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_066528816.1\|1211297_1213382_+	lytic transglycosylase domain-containing protein	K4NWI2	Pseudomonas_phage	3.4e-24	30.0
WP_066528822.1\|1213470_1213953_+	transcription elongation factor GreB	NA	NA	NA	NA
WP_066525359.1\|1214365_1215715_-	S41 family peptidase	A0A0R6PIZ1	Moraxella_phage	5.2e-26	28.3
WP_066525361.1\|1215823_1216009_-	hypothetical protein	NA	NA	NA	NA
WP_066525364.1\|1216086_1217406_-	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.3e-09	35.2

DBSCAN-SWA_99

1223722 : 1228979

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525383.1\|1223722_1225528_-	elongation factor 4	A0A2K9L6L3	Tupanvirus	1.8e-21	42.2
WP_082919561.1\|1225693_1226506_+	penicillin-binding protein activator LpoB	NA	NA	NA	NA
WP_156518535.1\|1226597_1227602_-	acyltransferase family protein	NA	NA	NA	NA
WP_066525389.1\|1227736_1228279_-	SRPBCC domain-containing protein	NA	NA	NA	NA
WP_066525391.1\|1228322_1228979_-	adenylate kinase	A0A2K9L833	Tupanvirus	1.9e-05	36.5

DBSCAN-SWA_100

1240849 : 1244270

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525434.1\|1240849_1242040_-	elongation factor Tu	A0A2K9L516	Tupanvirus	2.5e-16	27.8
WP_066525438.1\|1242176_1244270_-	elongation factor G	E4ZFJ7	Streptococcus_phage	5.9e-61	28.0

DBSCAN-SWA_101

1248077 : 1252090

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082919563.1\|1248077_1249268_+	M23 family metallopeptidase	G9BW84	Planktothrix_phage	2.4e-19	41.7
WP_066525443.1\|1249206_1249635_+	polymer-forming cytoskeletal protein	NA	NA	NA	NA
WP_156518408.1\|1250356_1250845_+	hypothetical protein	NA	NA	NA	NA
WP_066525448.1\|1250977_1251214_-	hypothetical protein	NA	NA	NA	NA
WP_066525451.1\|1251514_1252090_+	recombinase family protein	A0A219Y912	Aeromonas_phage	1.9e-22	37.7

DBSCAN-SWA_102

1260410 : 1263358

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525472.1\|1260410_1261397_-	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.7e-50	42.2
WP_066525474.1\|1261416_1263015_-	protein translocase subunit SecD	NA	NA	NA	NA
WP_066525477.1\|1263022_1263358_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	1.3e-15	47.8

DBSCAN-SWA_103

1271744 : 1276035

Ostreococcus_tauri_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066528841.1\|1271744_1273043_+	ammonium transporter	H8ZJB2	Ostreococcus_tauri_virus	1.1e-30	29.5
WP_066525492.1\|1273121_1274354_+	TCR/Tet family MFS transporter	A0A2H4UVM2	Bodo_saltans_virus	2.4e-06	24.0
WP_066525497.1\|1274475_1276035_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	6.0e-18	31.8

DBSCAN-SWA_104

1294063 : 1296214

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525526.1\|1294063_1296214_-	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	8.8e-44	29.5

DBSCAN-SWA_105

1309237 : 1313878

Agrobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525550.1\|1309237_1310116_-	DNA polymerase III subunit epsilon	A0A223W0B0	Agrobacterium_phage	7.3e-29	35.3
WP_066525555.1\|1310135_1310855_-	RES family NAD+ phosphorylase	NA	NA	NA	NA
WP_066525558.1\|1310851_1311265_-	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_066528848.1\|1311864_1312182_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_066528851.1\|1312171_1313878_+	STAS domain-containing protein	A0A2H4J153	uncultured_Caudovirales_phage	1.8e-36	26.8

DBSCAN-SWA_106

1318924 : 1320946

Cafeteria_roenbergensis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525572.1\|1318924_1320946_-	M13 family peptidase	E3T4I7	Cafeteria_roenbergensis_virus	1.4e-72	29.8

DBSCAN-SWA_107

1339675 : 1342082

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525615.1\|1339675_1340098_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2I2L4Y7	Orpheovirus	1.2e-08	33.8
WP_066525617.1\|1340112_1341396_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	1.2e-51	40.3
WP_066525624.1\|1341470_1342082_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	7.8e-22	34.5

DBSCAN-SWA_108

1347386 : 1348951

Paracoccus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525633.1\|1347386_1347938_+	single-stranded DNA-binding protein	A0A0U2C0X4	Paracoccus_phage	2.8e-47	76.7
WP_066525636.1\|1348051_1348951_-	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	1.1e-61	45.3

DBSCAN-SWA_109

1355386 : 1356976

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525650.1\|1355386_1356976_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	2.2e-68	47.4

DBSCAN-SWA_110

1363028 : 1363991

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066528873.1\|1363028_1363991_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	2.0e-16	25.7

DBSCAN-SWA_111

1369932 : 1370967

Moraxella_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525678.1\|1369932_1370967_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	4.6e-67	45.1

DBSCAN-SWA_112

1375894 : 1380745

Agrobacterium_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525689.1\|1375894_1377550_-	NAD+ synthase	A0A2L0UZF5	Agrobacterium_phage	1.8e-105	41.0
WP_066525693.1\|1377668_1378604_+	ribose-phosphate pyrophosphokinase	A0A1V0SHF7	Hokovirus	4.5e-45	35.2
WP_066525696.1\|1378628_1378868_-	hypothetical protein	NA	NA	NA	NA
WP_066528879.1\|1378920_1379349_-	glyoxalase	NA	NA	NA	NA
WP_066525698.1\|1379425_1380211_+	histidinol-phosphatase	NA	NA	NA	NA
WP_066525701.1\|1380214_1380745_-	O-acetyl-ADP-ribose deacetylase	F1SVT2	Red_sea_bream_iridovirus	4.8e-36	49.4

DBSCAN-SWA_113

1384701 : 1385793

Orpheovirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525712.1\|1384701_1385793_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2I2L4E3	Orpheovirus	2.5e-26	32.1

DBSCAN-SWA_114

1389389 : 1390955

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525717.1\|1389389_1390955_+	peptide chain release factor 3	A0A1S5SF82	Streptococcus_phage	4.4e-37	26.6

DBSCAN-SWA_115

1394384 : 1395482

Pacmanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525728.1\|1394384_1395482_+	histidinol-phosphate transaminase	A0A1X6WGT4	Pacmanvirus	5.7e-15	28.1

DBSCAN-SWA_116

1398617 : 1399334

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525739.1\|1398617_1399334_-	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	1.5e-24	34.0

DBSCAN-SWA_117

1402453 : 1406493

Rhizobium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525747.1\|1402453_1403461_+	cobaltochelatase subunit CobS	L7TKP0	Rhizobium_phage	3.6e-40	31.5
WP_066525749.1\|1403465_1403885_+	OsmC family protein	NA	NA	NA	NA
WP_066525752.1\|1403881_1404667_+	tyrosine-protein phosphatase	NA	NA	NA	NA
WP_066525754.1\|1404666_1406493_+	cobaltochelatase subunit CobT	J9Q7G6	Salmonella_phage	2.4e-18	30.5

DBSCAN-SWA_118

1412991 : 1413726

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_156518417.1\|1412991_1413726_+	glycerophosphodiester phosphodiesterase	M1HJV8	Acanthocystis_turfacea_Chlorella_virus	1.3e-10	30.0

DBSCAN-SWA_119

1435889 : 1441303

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525809.1\|1435889_1436432_+	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	8.1e-47	50.6
WP_066525810.1\|1436644_1438108_-	PLP-dependent aminotransferase family protein	A0A291LID1	Streptomyces_phage	6.5e-06	40.0
WP_066525812.1\|1438251_1438710_-	hypothetical protein	NA	NA	NA	NA
WP_066528899.1\|1438795_1441303_+	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	5.7e-111	32.6

DBSCAN-SWA_120

1446820 : 1451844

Pandoravirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525828.1\|1446820_1448146_+	cystathionine gamma-synthase family protein	A0A0B5JD48	Pandoravirus	1.1e-20	34.1
WP_066525830.1\|1448142_1449087_+	2-hydroxyacid dehydrogenase	A0A2R8FDS8	Brazilian_cedratvirus	6.8e-25	35.4
WP_066525832.1\|1449089_1449764_-	HAD-IB family phosphatase	NA	NA	NA	NA
WP_066525834.1\|1449862_1450972_+	ABC transporter permease	NA	NA	NA	NA
WP_066528902.1\|1450971_1451844_+	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	2.1e-12	27.5

DBSCAN-SWA_121

1456143 : 1457849

Bifidobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525845.1\|1456143_1457070_-	ParB/RepB/Spo0J family partition protein	I3NLC2	Bifidobacterium_phage	6.3e-15	34.7
WP_066525848.1\|1457066_1457849_-	ParA family protein	Q8JL10	Natrialba_phage	2.7e-27	34.2

DBSCAN-SWA_122

1464832 : 1465555

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525855.1\|1464832_1465555_-	YjbE family putative metal transport protein	W8EBD0	Pseudomonas_phage	1.1e-11	31.2

DBSCAN-SWA_123

1472393 : 1474910

Staphylococcus_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525878.1\|1472393_1474910_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	7.8e-177	41.4

DBSCAN-SWA_124

1486190 : 1490359

Anoxybacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525902.1\|1486190_1486697_-	MmcB family DNA repair protein	A0A2P1JTY9	Anoxybacillus_phage	5.5e-05	49.1
WP_066525904.1\|1486789_1487437_-	cell wall hydrolase	A0A1L6Z548	Klebsiella_phage	9.5e-18	37.4
WP_082919656.1\|1487618_1487930_-	DUF1491 family protein	NA	NA	NA	NA
WP_066528927.1\|1487946_1488408_-	PaaI family thioesterase	NA	NA	NA	NA
WP_066528924.1\|1488397_1488865_-	PTS transporter subunit EIIA	NA	NA	NA	NA
WP_066525910.1\|1488990_1489584_-	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_066528930.1\|1489666_1490359_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	1.7e-52	48.9

DBSCAN-SWA_125

1497334 : 1498702

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525934.1\|1497334_1498702_+	phosphomannomutase/phosphoglucomutase	A0A127AWJ1	Bacillus_phage	1.1e-50	28.4

DBSCAN-SWA_126

1502918 : 1508392

Mycobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525945.1\|1502918_1505240_+	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	1.2e-78	43.8
WP_066525947.1\|1505517_1506156_+	outer membrane lipoprotein carrier protein LolA	NA	NA	NA	NA
WP_066525950.1\|1506522_1507320_+	exodeoxyribonuclease III	NA	NA	NA	NA
WP_066525952.1\|1507333_1508392_+	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	6.0e-38	52.4

DBSCAN-SWA_127

1511671 : 1514323

Cafeteria_roenbergensis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066525960.1\|1511671_1514323_-	DNA mismatch repair protein MutS	E3T5Q7	Cafeteria_roenbergensis_virus	1.7e-17	28.4

DBSCAN-SWA_128

1535679 : 1538247

Vaccinia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526008.1\|1535679_1538247_-	DUF4982 domain-containing protein	B9U1V4	Vaccinia_virus	1.1e-21	29.0

DBSCAN-SWA_129

1543793 : 1545886

Enterobacteria_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_156518418.1\|1543793_1545089_+\|transposase	IS21 family transposase	U5N3F9	Enterobacteria_phage	4.5e-35	31.0
WP_156518339.1\|1545085_1545886_+	AAA family ATPase	U5N3V8	Enterobacteria_phage	2.3e-58	47.3

DBSCAN-SWA_130

1553680 : 1556569

Catovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066528951.1\|1553680_1555423_-	long-chain fatty acid--CoA ligase	A0A1V0SBX8	Catovirus	9.0e-39	22.8
WP_066526035.1\|1555549_1556569_-	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	6.5e-05	29.3

DBSCAN-SWA_131

1576470 : 1577976

Gordonia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526079.1\|1576470_1577976_+	exodeoxyribonuclease VII large subunit	A0A1B3AYB4	Gordonia_phage	1.9e-37	35.4

DBSCAN-SWA_132

1581846 : 1589168

Cronobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526088.1\|1581846_1584426_-	ATP-dependent chaperone ClpB	K4FB40	Cronobacter_phage	2.5e-122	36.4
WP_066526089.1\|1584519_1586157_-	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_066526092.1\|1586306_1589168_+	insulinase family protein	M1NN74	Moumouvirus	1.1e-09	22.1

DBSCAN-SWA_133

1608551 : 1610568

environmental_halophage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526139.1\|1608551_1609760_+	cysteine desulfurase	Q2XUY6	environmental_halophage	5.0e-89	40.9
WP_066526145.1\|1609756_1610209_+	SUF system Fe-S cluster assembly protein	NA	NA	NA	NA
WP_066526146.1\|1610208_1610568_+	iron-sulfur cluster assembly accessory protein	A0A0P0CQC4	Ostreococcus_lucimarinus_virus	3.8e-16	40.0

DBSCAN-SWA_134

1616897 : 1618841

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526156.1\|1616897_1618841_-	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	4.6e-84	39.2

DBSCAN-SWA_135

1622191 : 1630363

Bathycoccus_sp._RCC1105_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526168.1\|1622191_1624492_+	CDC48 family AAA ATPase	E5ESM9	Bathycoccus_sp._RCC1105_virus	5.7e-49	39.4
WP_066526169.1\|1624641_1625268_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_066528965.1\|1625397_1626663_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.0e-84	45.4
WP_066526171.1\|1626722_1627544_-	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	1.0e-48	43.7
WP_066526174.1\|1627549_1627843_-	hypothetical protein	NA	NA	NA	NA
WP_066526176.1\|1627865_1628993_+	hypothetical protein	NA	NA	NA	NA
WP_156518430.1\|1628989_1630363_+	cytochrome P450	I6WI04	Cotesia_sesamiae_Mombasa_bracovirus	9.0e-18	23.0

DBSCAN-SWA_136

1635284 : 1637501

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526189.1\|1635284_1637501_+	xanthine dehydrogenase family protein molybdopterin-binding subunit	A0A0P0I429	Acinetobacter_phage	1.0e-34	25.8

DBSCAN-SWA_137

1640851 : 1642633

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066528977.1\|1640851_1642633_-	aminopeptidase P family protein	A0A0P0I8D7	Acinetobacter_phage	9.4e-92	36.4

DBSCAN-SWA_138

1646354 : 1648205

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526207.1\|1646354_1648205_-	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	9.6e-47	28.5

DBSCAN-SWA_139

1653089 : 1657373

Cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526225.1\|1653089_1654670_+	phosphoglycerate dehydrogenase	A0A2R8FCS0	Cedratvirus	3.5e-42	36.8
WP_066528982.1\|1654819_1655950_+	ATP phosphoribosyltransferase regulatory subunit	NA	NA	NA	NA
WP_066526233.1\|1656083_1657373_+	adenylosuccinate synthase	W5S5V7	Pithovirus	2.4e-60	33.0

DBSCAN-SWA_140

1661995 : 1670899

Yellowstone_lake_phycodnavirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066528984.1\|1661995_1662925_+	DnaJ domain-containing protein	A0A0P0YNN4	Yellowstone_lake_phycodnavirus	1.9e-11	25.7
WP_066526251.1\|1662951_1663923_+	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_066526254.1\|1663919_1664729_+	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_066526260.1\|1664756_1664990_+	DUF4160 domain-containing protein	NA	NA	NA	NA
WP_066526263.1\|1664982_1665390_+	DUF2442 domain-containing protein	NA	NA	NA	NA
WP_066526264.1\|1665386_1666463_+	chorismate synthase	A0A291AU41	Pandoravirus	7.4e-84	46.7
WP_066526265.1\|1666856_1667645_+	PhzF family phenazine biosynthesis protein	NA	NA	NA	NA
WP_066526268.1\|1667641_1668766_-	serine hydrolase	NA	NA	NA	NA
WP_066526272.1\|1668804_1669125_+	hypothetical protein	NA	NA	NA	NA
WP_066526273.1\|1669126_1670899_+	DNA helicase RecQ	F2NZ48	Diadromus_pulchellus_ascovirus	1.1e-73	43.4

DBSCAN-SWA_141

1679000 : 1683192

Orpheovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526286.1\|1679000_1679582_+	TIGR00730 family Rossman fold protein	A0A2I2L3F0	Orpheovirus	1.2e-06	25.7
WP_082919574.1\|1679619_1680579_+	phytoene/squalene synthase family protein	NA	NA	NA	NA
WP_066526287.1\|1680680_1682105_-	ammonium transporter	H8ZJB2	Ostreococcus_tauri_virus	6.3e-30	31.4
WP_037462870.1\|1682118_1682457_-	P-II family nitrogen regulator	NA	NA	NA	NA
WP_066526288.1\|1682616_1683192_-	DUF924 domain-containing protein	E3T4R4	Cafeteria_roenbergensis_virus	1.7e-18	30.7

DBSCAN-SWA_142

1687359 : 1688757

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526300.1\|1687359_1688757_-	UdgX family uracil-DNA binding protein	A0A127AW33	Bacillus_phage	1.7e-11	31.1

DBSCAN-SWA_143

1692022 : 1692229

Pelagibacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004208618.1\|1692022_1692229_+	30S ribosomal protein S21	M1HLV7	Pelagibacter_phage	4.5e-06	50.8

DBSCAN-SWA_144

1697972 : 1699640

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526319.1\|1697972_1699640_+	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	1.8e-12	42.9

DBSCAN-SWA_145

1713409 : 1717107

Pneumococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526352.1\|1713409_1713877_+	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	E7DN65	Pneumococcus_phage	8.3e-24	51.4
WP_066526355.1\|1714014_1714386_+	DUF559 domain-containing protein	NA	NA	NA	NA
WP_066526358.1\|1714476_1717107_+	M1 family metallopeptidase	A0A0P0IY26	Acinetobacter_phage	5.5e-72	27.1

DBSCAN-SWA_146

1720697 : 1727676

Sinorhizobium_phage(33.33%)

integrase

attL 1718287:1718301|attR 1726193:1726207

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1718287:1718301	attL	NA	NA	NA	NA
WP_066526368.1\|1720697_1722020_+\|integrase	integrase arm-type DNA-binding domain-containing protein	Q8W6M6	Sinorhizobium_phage	1.7e-106	47.1
WP_066526369.1\|1722566_1723214_+	restriction endonuclease subunit M	NA	NA	NA	NA
WP_066526372.1\|1723206_1724751_+	restriction endonuclease	A0A1V0SII8	Klosneuvirus	5.7e-37	26.1
WP_066526375.1\|1724743_1727227_+	restriction endonuclease	NA	NA	NA	NA
1726193:1726207	attR	NA	NA	NA	NA
WP_082919575.1\|1727263_1727488_+	hypothetical protein	NA	NA	NA	NA
WP_082919576.1\|1727484_1727676_-	AlpA family phage regulatory protein	B7SYF9	Stenotrophomonas_phage	3.6e-10	54.2

DBSCAN-SWA_147

1735493 : 1737683

Acidithiobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082919658.1\|1735493_1737683_+	AAA domain-containing protein	K4I1H4	Acidithiobacillus_phage	1.0e-39	46.3

DBSCAN-SWA_148

1746776 : 1749458

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082919577.1\|1746776_1749458_+	DEAD/DEAH box helicase	A0A1B1IUI1	uncultured_Mediterranean_phage	2.5e-32	26.4

DBSCAN-SWA_149

1757388 : 1758873

Serratia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526416.1\|1757388_1758873_-	hypothetical protein	A0A1S6UB21	Serratia_phage	7.9e-60	46.3

DBSCAN-SWA_150

1771822 : 1776617

Stx2-converting_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_156518539.1\|1771822_1773334_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	1.9e-125	48.3
WP_006957496.1\|1773435_1773783_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	1.1e-33	58.2
WP_066526457.1\|1773779_1774163_-\|transposase	transposase	NA	NA	NA	NA
WP_082919583.1\|1774232_1774658_+\|transposase	transposase	NA	NA	NA	NA
WP_066526460.1\|1774654_1775011_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_066526465.1\|1775042_1776617_+\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	4.7e-95	38.9

DBSCAN-SWA_151

1795799 : 1802094

Streptomyces_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526496.1\|1795799_1799063_-	DNA polymerase III subunit alpha	A0A1C9LWS4	Streptomyces_phage	7.0e-85	26.9
WP_082919585.1\|1799062_1800874_-	DNA polymerase Y family protein	NA	NA	NA	NA
WP_082919586.1\|1800791_1801571_-	protein ImuA	NA	NA	NA	NA
WP_066526497.1\|1801671_1802094_-	DUF1810 domain-containing protein	A0A2H4UVK5	Bodo_saltans_virus	1.1e-14	42.2

DBSCAN-SWA_152

1821599 : 1822772

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526530.1\|1821599_1822772_+	hypothetical protein	A0A1J0MA51	Mycobacterium_phage	2.6e-29	33.7

DBSCAN-SWA_153

1842303 : 1845543

Gordonia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_156518456.1\|1842303_1845543_+	ATP-dependent helicase	A0A160DHD3	Gordonia_phage	7.0e-37	27.5

DBSCAN-SWA_154

1855117 : 1856359

Orpheovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526585.1\|1855117_1856359_-	class I SAM-dependent methyltransferase	A0A2I2L5L3	Orpheovirus	7.3e-51	34.0

DBSCAN-SWA_155

1863227 : 1866618

Caulobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526598.1\|1863227_1865156_+	ribonucleoside-diphosphate reductase subunit alpha	A0A0K1LMZ5	Caulobacter_phage	9.1e-242	68.7
WP_066529065.1\|1865220_1865475_-	DUF2171 domain-containing protein	NA	NA	NA	NA
WP_066526600.1\|1865562_1866618_+	ribonucleotide-diphosphate reductase subunit beta	A0A0K1LM33	Caulobacter_phage	2.2e-117	62.5

DBSCAN-SWA_156

1870208 : 1870865

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066529076.1\|1870208_1870865_+	MBL fold metallo-hydrolase	A0A1X9I5D3	Streptococcus_phage	3.1e-16	27.9

DBSCAN-SWA_157

1873869 : 1874166

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526619.1\|1873869_1874166_+	integration host factor subunit alpha	A0A1P8CWT5	Bacillus_phage	8.2e-09	30.8

DBSCAN-SWA_158

1892227 : 1894491

uncultured_Mediterranean_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526657.1\|1892227_1892635_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	1.2e-15	50.0
WP_066526660.1\|1892709_1894491_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	2.9e-16	36.7

DBSCAN-SWA_159

1902184 : 1903972

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526679.1\|1902184_1903972_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	1.0e-53	33.3

DBSCAN-SWA_160

1908071 : 1909079

Acanthamoeba_polyphaga_mimivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526690.1\|1908071_1909079_-	DNA topoisomerase IB	A0A0G2Y4T8	Acanthamoeba_polyphaga_mimivirus	5.0e-34	31.0

DBSCAN-SWA_161

1914179 : 1914851

Aeromonas_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526701.1\|1914179_1914851_+	peptidase S24	A5X9F5	Aeromonas_virus	5.8e-18	43.0

DBSCAN-SWA_162

1928718 : 1929603

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082919597.1\|1928718_1929603_+	N-acetylmuramoyl-L-alanine amidase	A0A0N6W8I1	Bacillus_phage	1.8e-11	48.8

DBSCAN-SWA_163

1937067 : 1938888

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526744.1\|1937067_1938888_+	translational GTPase TypA	A0A1B0RXH7	Streptococcus_phage	1.8e-21	39.6

DBSCAN-SWA_164

1944260 : 1944827

Salicola_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526759.1\|1944260_1944827_+	HNH endonuclease	A0A248SKR4	Salicola_phage	7.2e-14	44.3

DBSCAN-SWA_165

1954984 : 1959260

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526789.1\|1954984_1956853_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	1.1e-66	29.5
WP_066526794.1\|1956895_1957348_+	MaoC family dehydratase	NA	NA	NA	NA
WP_156518458.1\|1957421_1957868_-	DUF4440 domain-containing protein	NA	NA	NA	NA
WP_082919665.1\|1958216_1959260_+	GGDEF domain-containing protein	G3MA91	Bacillus_virus	5.8e-25	35.2

DBSCAN-SWA_166

1970913 : 1973004

Caulobacter_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526816.1\|1970913_1971360_-	hypothetical protein	K4JMX3	Caulobacter_virus	4.3e-30	49.0
WP_066526819.1\|1971493_1972165_+	spermidine synthase	NA	NA	NA	NA
WP_066526822.1\|1972296_1973004_-	uracil-DNA glycosylase	S4VZ65	Pandoravirus	1.5e-53	48.1

DBSCAN-SWA_167

1977765 : 1980067

Catovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526835.1\|1977765_1978764_+	NAD-dependent epimerase/dehydratase family protein	A0A1V0SAI6	Catovirus	5.0e-26	28.6
WP_066529115.1\|1979059_1980067_+	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	4.1e-36	34.7

DBSCAN-SWA_168

1983860 : 1994773

uncultured_virus(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526849.1\|1983860_1984478_-	ribonuclease D	U3REX2	uncultured_virus	1.5e-12	30.5
WP_066526852.1\|1984715_1985531_+	cold-shock protein	Q9AZD3	Lactococcus_phage	1.0e-08	48.4
WP_066526855.1\|1985778_1986375_+	hypothetical protein	NA	NA	NA	NA
WP_066526857.1\|1986431_1987751_-	cell wall hydrolase	NA	NA	NA	NA
WP_066526867.1\|1987769_1988699_-	cysteine synthase A	A0A1X9I5K7	Streptococcus_phage	8.7e-81	54.2
WP_066526869.1\|1988695_1990000_-	MFS transporter	NA	NA	NA	NA
WP_066526875.1\|1990106_1990511_-	hypothetical protein	NA	NA	NA	NA
WP_066526877.1\|1990528_1992157_-	DUF853 family protein	A0A248XCZ8	Klebsiella_phage	1.1e-83	44.1
WP_066526878.1\|1992271_1993783_-	Do family serine endopeptidase	A0A1B1IT49	uncultured_Mediterranean_phage	1.5e-21	27.4
WP_066526880.1\|1993924_1994773_-\|protease	protease modulator HflC	A0A2P1EMF1	Moumouvirus	1.2e-07	26.3

DBSCAN-SWA_169

2004325 : 2005009

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526898.1\|2004325_2005009_+	Fe2+-dependent dioxygenase	A0A127KMW2	Cyanophage	6.5e-17	26.6

DBSCAN-SWA_170

2015533 : 2025415

Vibrio_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526914.1\|2015533_2019790_-	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	1.5e-66	27.1
WP_066526915.1\|2019865_2024029_-	DNA-directed RNA polymerase subunit beta	A0A2P0VMZ3	Tetraselmis_virus	1.3e-19	27.7
WP_066526917.1\|2024413_2025415_-	inorganic phosphate transporter	E5ESL8	Bathycoccus_sp._RCC1105_virus	4.0e-15	29.8

DBSCAN-SWA_171

2033792 : 2035852

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066526927.1\|2033792_2034512_+	response regulator	W8CYM9	Bacillus_phage	7.5e-32	35.1
WP_066526929.1\|2034508_2035852_+	HAMP domain-containing protein	W8CYF6	Bacillus_phage	1.1e-12	23.9

DBSCAN-SWA_172

2051108 : 2051930

Erwinia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066529141.1\|2051108_2051930_+	flagellar biosynthesis protein FlgJ	A0A1B2ICX1	Erwinia_phage	3.1e-21	31.3

DBSCAN-SWA_173

2077833 : 2081147

Only_Syngen_Nebraska_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066527017.1\|2077833_2078763_+	ornithine carbamoyltransferase	A0A1J0F9B8	Only_Syngen_Nebraska_virus	2.3e-17	27.4
WP_066527020.1\|2078928_2079849_+	molecular chaperone Hsp33	NA	NA	NA	NA
WP_066529154.1\|2079999_2080410_+	DUF3617 family protein	NA	NA	NA	NA
WP_066527025.1\|2080454_2081147_+	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	3.0e-22	35.8

DBSCAN-SWA_174

2086156 : 2162371

Enterobacteria_phage(16.67%)

transposase,integrase,tRNA

attL 2090940:2090971|attR 2160468:2160499

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066527045.1\|2086156_2086615_-\|tRNA	tRNA (cytidine(34)-2'-O)-methyltransferase	NA	NA	NA	NA
WP_066527047.1\|2086824_2087391_+	ubiquinol-cytochrome c reductase iron-sulfur subunit	NA	NA	NA	NA
WP_066527049.1\|2087402_2088722_+	cytochrome b/b6	NA	NA	NA	NA
WP_066527052.1\|2088739_2089588_+	cytochrome c1	NA	NA	NA	NA
WP_066527057.1\|2089671_2090208_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	6.0e-26	45.7
WP_066527059.1\|2090219_2090864_+	5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase	NA	NA	NA	NA
2090940:2090971	attL	NA	NA	NA	NA
WP_082919601.1\|2091615_2091774_+\|transposase	transposase	NA	NA	NA	NA
WP_066529157.1\|2093279_2094905_+	glycosyltransferase	NA	NA	NA	NA
WP_066527069.1\|2094901_2095735_+	hypothetical protein	A0A0P0YLT6	Yellowstone_lake_mimivirus	4.5e-12	35.0
WP_066527071.1\|2095741_2096698_+	phytanoyl-CoA dioxygenase	NA	NA	NA	NA
WP_156518464.1\|2096865_2100501_+	glycosyltransferase	NA	NA	NA	NA
WP_066527079.1\|2100716_2101631_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_048578800.1\|2101939_2102161_-	hypothetical protein	NA	NA	NA	NA
WP_082919603.1\|2102160_2103786_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	1.1e-99	41.9
WP_030541462.1\|2103845_2104193_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	8.3e-29	50.9
WP_066527080.1\|2104189_2104519_-\|transposase	transposase	NA	NA	NA	NA
WP_082919604.1\|2105892_2106705_-	FkbM family methyltransferase	M1H1X5	Paramecium_bursaria_Chlorella_virus	1.8e-13	37.3
WP_066529164.1\|2107045_2108416_+	3-deoxy-7-phosphoheptulonate synthase class II	NA	NA	NA	NA
WP_066527083.1\|2108712_2109777_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_082919605.1\|2109793_2110945_+	hypothetical protein	NA	NA	NA	NA
WP_066527086.1\|2111012_2112149_+	DegT/DnrJ/EryC1/StrS family aminotransferase	A0A2K9L0G1	Tupanvirus	1.7e-30	30.1
WP_066529169.1\|2112163_2112772_-\|transposase	transposase	NA	NA	NA	NA
WP_082919606.1\|2115493_2116015_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_156518466.1\|2116097_2118158_-	hypothetical protein	NA	NA	NA	NA
WP_156518468.1\|2119200_2119302_-	hypothetical protein	NA	NA	NA	NA
WP_066527112.1\|2122473_2123121_-	ABC transporter ATP-binding protein	M1H3A1	Paramecium_bursaria_Chlorella_virus	2.6e-07	27.5
WP_066527116.1\|2123117_2123915_-	ABC transporter permease	NA	NA	NA	NA
WP_066527121.1\|2123917_2125081_-	capsule biosynthesis protein	NA	NA	NA	NA
WP_066527123.1\|2125260_2126403_+	polysaccharide export protein	NA	NA	NA	NA
WP_066527125.1\|2126458_2127022_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A218MN57	uncultured_virus	1.5e-32	45.0
WP_066527126.1\|2127026_2128094_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.0e-93	50.7
WP_066527127.1\|2128090_2128984_+	dTDP-4-dehydrorhamnose reductase	NA	NA	NA	NA
WP_066527133.1\|2129005_2129875_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	3.1e-88	55.8
WP_066527138.1\|2130627_2130942_-	hypothetical protein	NA	NA	NA	NA
WP_066527141.1\|2131157_2131436_+	hypothetical protein	NA	NA	NA	NA
WP_066527144.1\|2131536_2132574_-\|integrase	site-specific integrase	D6PF86	uncultured_phage	6.4e-24	26.2
WP_156518469.1\|2132859_2133447_-	hypothetical protein	NA	NA	NA	NA
WP_066527147.1\|2134035_2134953_+	DUF1738 domain-containing protein	A0A1V0EEV1	Caulobacter_phage	4.0e-54	41.2
WP_156518471.1\|2134829_2135168_+	hypothetical protein	NA	NA	NA	NA
WP_066527152.1\|2135251_2136166_+	HEPN domain-containing protein	NA	NA	NA	NA
WP_066527154.1\|2136162_2136558_-	polyketide cyclase	NA	NA	NA	NA
WP_066527158.1\|2137024_2137375_+	hypothetical protein	NA	NA	NA	NA
WP_066527160.1\|2137371_2139342_+	type IV secretion system DNA-binding domain-containing protein	NA	NA	NA	NA
WP_066529172.1\|2139443_2139617_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_066527162.1\|2140656_2141490_-	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
WP_066529174.1\|2142329_2143424_+	GDP-mannose 4,6-dehydratase	M1IBC3	Acanthocystis_turfacea_Chlorella_virus	4.2e-135	67.8
WP_082919608.1\|2143392_2144949_+	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_082919609.1\|2144915_2146007_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_066527169.1\|2146014_2146986_+	GDP-mannose 4,6-dehydratase	A0A1C9C5B8	Heterosigma_akashiwo_virus	9.7e-67	42.5
WP_066527175.1\|2146989_2148231_+	methyltransferase domain-containing protein	A0A1V0SJ83	Klosneuvirus	2.1e-82	43.5
WP_082919610.1\|2148406_2149708_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_082919611.1\|2149685_2150636_+	hypothetical protein	NA	NA	NA	NA
WP_066527181.1\|2150710_2152489_-	hypothetical protein	NA	NA	NA	NA
WP_082919668.1\|2153035_2154337_+	hypothetical protein	NA	NA	NA	NA
WP_066527183.1\|2154310_2155036_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_066527185.1\|2155008_2156025_-	glycosyltransferase family 2 protein	A0A075B8F6	Enterobacteria_phage	7.8e-75	46.8
WP_066527188.1\|2156142_2157672_+	YfhO family protein	NA	NA	NA	NA
WP_066527191.1\|2158203_2158575_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_082919612.1\|2158571_2158769_-	type II toxin-antitoxin system VapB family antitoxin	NA	NA	NA	NA
WP_066527196.1\|2158908_2159946_-\|integrase	site-specific integrase	D6PF86	uncultured_phage	1.7e-24	26.0
WP_066527200.1\|2160653_2161988_+	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
2160468:2160499	attR	NA	NA	NA	NA
WP_066527203.1\|2161993_2162371_-	response regulator	W8CYM9	Bacillus_phage	9.1e-05	25.6

DBSCAN-SWA_175

2166910 : 2168831

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066529189.1\|2166910_2167900_-	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.9e-34	33.6
WP_066529194.1\|2168171_2168831_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.9e-26	42.4

DBSCAN-SWA_176

2185191 : 2195623

Emiliania_huxleyi_virus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066527236.1\|2185191_2185791_+	ribonuclease HII	D2TEQ2	Emiliania_huxleyi_virus	3.7e-24	38.7
WP_082919669.1\|2185888_2186560_+	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_066527241.1\|2187225_2188809_-	alkyl hydroperoxide reductase subunit F	A0A249XZT7	Enterococcus_phage	4.1e-38	31.8
WP_066527243.1\|2188975_2189539_-	peroxiredoxin	NA	NA	NA	NA
WP_156518476.1\|2189645_2190386_-	transcriptional regulator BetI	NA	NA	NA	NA
WP_066527250.1\|2190456_2190801_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_066527253.1\|2191088_2192213_+	site-specific DNA-methyltransferase	A0A1W6JJW1	Lactococcus_phage	7.6e-31	30.8
WP_066527257.1\|2192309_2193437_+	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	1.4e-24	30.6
WP_066529207.1\|2193456_2194086_-	hypothetical protein	NA	NA	NA	NA
WP_066527259.1\|2194174_2195623_-	sigma-54-dependent Fis family transcriptional regulator	W8CYM9	Bacillus_phage	2.4e-08	27.5

DBSCAN-SWA_177

2208814 : 2209261

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066527292.1\|2208814_2209261_-	ribonuclease HI	J9Q745	Salmonella_phage	3.8e-42	56.6

DBSCAN-SWA_178

2215833 : 2221329

uncultured_Mediterranean_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066527317.1\|2215833_2216616_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.9e-33	34.5
WP_066527319.1\|2216612_2217206_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	8.9e-39	43.9
WP_066527325.1\|2217235_2217475_+	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	4.0e-06	75.0
WP_066527332.1\|2217505_2217937_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_066527334.1\|2217933_2218719_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	1.3e-45	42.2
WP_066527336.1\|2218772_2218901_-	entericidin A/B family lipoprotein	NA	NA	NA	NA
WP_066529214.1\|2219242_2220172_-	cell wall hydrolase	A0A0S1WEP8	Vibrio_phage	1.8e-06	27.8
WP_066529219.1\|2220333_2221329_+	cysteine synthase A	A0A1X9I5K7	Streptococcus_phage	5.0e-50	41.3

DBSCAN-SWA_179

2247151 : 2258367

Prochlorococcus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066527397.1\|2247151_2248510_+	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	E3SN07	Prochlorococcus_phage	2.6e-41	33.7
WP_066527399.1\|2248506_2250078_+	glycine dehydrogenase subunit 2	E3ST28	Prochlorococcus_phage	3.9e-73	37.6
WP_066527401.1\|2250074_2250722_+	DUF938 domain-containing protein	NA	NA	NA	NA
WP_066527403.1\|2250853_2251729_+	hypothetical protein	NA	NA	NA	NA
WP_082919671.1\|2251685_2253659_-	response regulator	B5LWN8	Feldmannia_species_virus	5.1e-06	25.6
WP_066529231.1\|2253800_2255063_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	G9E4Q1	Emiliania_huxleyi_virus	3.8e-31	28.0
WP_066527414.1\|2255199_2255442_-	acyl carrier protein	NA	NA	NA	NA
WP_066527417.1\|2255560_2255839_-	ETC complex I subunit	NA	NA	NA	NA
WP_066529234.1\|2255898_2258367_-	ATP-dependent helicase HrpB	A0A2H4UU36	Bodo_saltans_virus	1.4e-29	26.4

DBSCAN-SWA_180

2270343 : 2271474

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066529250.1\|2270343_2271474_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	6.9e-48	37.2

DBSCAN-SWA_181

2276660 : 2283330

Chrysochromulina_ericina_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066529254.1\|2276660_2278409_-	DEAD/DEAH box helicase	A0A0N9Q9J4	Chrysochromulina_ericina_virus	6.1e-35	29.1
WP_037464035.1\|2278661_2279360_-	50S ribosomal protein L1	NA	NA	NA	NA
WP_037464038.1\|2279364_2279796_-	50S ribosomal protein L11	NA	NA	NA	NA
WP_062117774.1\|2280048_2280585_-	transcription termination/antitermination factor NusG	A0A068C9G5	Rhizobium_phage	1.7e-09	27.3
WP_066529257.1\|2280606_2280813_-	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_066527451.1\|2281114_2282338_-	amidohydrolase family protein	NA	NA	NA	NA
WP_066527456.1\|2282334_2283330_-	aspartate carbamoyltransferase catalytic subunit	A0A1J0F9B8	Only_Syngen_Nebraska_virus	4.5e-27	36.8

DBSCAN-SWA_182

2288511 : 2288910

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066527472.1\|2288511_2288910_-	low affinity iron permease family protein	Q19XG2	Mycobacterium_phage	1.2e-07	34.7

DBSCAN-SWA_183

2293774 : 2293987

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066527489.1\|2293774_2293987_-	cold-shock protein	Q9AZD3	Lactococcus_phage	7.6e-09	47.7

DBSCAN-SWA_184

2297504 : 2300420

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066527502.1\|2297504_2300420_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	60.3

DBSCAN-SWA_185

2305642 : 2306497

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066527531.1\|2305642_2306497_-	glucose 1-dehydrogenase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	5.6e-50	42.5

DBSCAN-SWA_186

2310529 : 2311453

Orpheovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066529276.1\|2310529_2311453_+	NAD(P)/FAD-dependent oxidoreductase	A0A2I2L5E1	Orpheovirus	1.7e-15	29.0

DBSCAN-SWA_187

2315462 : 2335293

Staphylococcus_phage(12.5%)

capsid,head,portal,tail,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066527540.1\|2315462_2316158_-\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_066527542.1\|2316336_2316516_-	hypothetical protein	NA	NA	NA	NA
WP_066527544.1\|2316733_2317939_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	4.7e-95	47.6
WP_066527547.1\|2317998_2319591_-	apolipoprotein N-acyltransferase	NA	NA	NA	NA
WP_066527549.1\|2319602_2320238_-	DedA family protein	NA	NA	NA	NA
WP_066527552.1\|2320356_2320599_+	hypothetical protein	NA	NA	NA	NA
WP_066527554.1\|2320727_2321441_+	hypothetical protein	NA	NA	NA	NA
WP_066527556.1\|2321505_2322153_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_066527558.1\|2322294_2322870_+	hypothetical protein	NA	NA	NA	NA
WP_082919620.1\|2323234_2323690_-	acetyltransferase	NA	NA	NA	NA
WP_066527562.1\|2323769_2325104_+	DNA-packaging protein	A0A1V0DY66	Dinoroseobacter_phage	3.4e-78	42.0
WP_066527570.1\|2325165_2325504_+	hypothetical protein	NA	NA	NA	NA
WP_066527578.1\|2325607_2326768_+\|portal	phage portal protein	W8ECU7	Geobacillus_phage	2.6e-50	34.3
WP_066527579.1\|2326757_2327078_+	hypothetical protein	K4I011	Acidithiobacillus_phage	1.2e-08	45.3
WP_066527580.1\|2327074_2327473_+\|head,protease	HK97 family phage prohead protease	A0A2H4JAI0	uncultured_Caudovirales_phage	3.3e-13	36.6
WP_066527583.1\|2327633_2328749_+\|capsid	phage major capsid protein	A0A2D1GNH4	Pseudomonas_phage	5.3e-77	42.9
WP_066527586.1\|2328866_2329412_+	hypothetical protein	NA	NA	NA	NA
WP_066527589.1\|2329601_2330000_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_066527591.1\|2330218_2330548_-	hypothetical protein	NA	NA	NA	NA
WP_066527592.1\|2330603_2331011_+\|tail	phage tail protein	NA	NA	NA	NA
WP_066527594.1\|2331007_2331322_+	gene transfer agent family protein	NA	NA	NA	NA
WP_066527603.1\|2331318_2331513_+\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_066527606.1\|2331602_2332154_+\|tail	tail tape measure protein	NA	NA	NA	NA
WP_066527608.1\|2332150_2334481_+	DUF2460 domain-containing protein	A0MZE6	Enterobacteria_phage	8.6e-37	31.9
WP_066527611.1\|2334477_2335293_+	DUF2163 domain-containing protein	K4JUH7	Caulobacter_phage	8.3e-11	41.4

DBSCAN-SWA_188

2339994 : 2353303

Spodoptera_exigua_multiple_nucleopolyhedrovirus(20.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_156518555.1\|2339994_2340471_+	superoxide dismutase family protein	Q9J887	Spodoptera_exigua_multiple_nucleopolyhedrovirus	3.7e-11	37.5
WP_066529289.1\|2340492_2341041_-	RNA 2',3'-cyclic phosphodiesterase	NA	NA	NA	NA
WP_066527619.1\|2341159_2341894_+	Bax inhibitor-1/YccA family protein	NA	NA	NA	NA
WP_066527620.1\|2341953_2342586_-	glutathione S-transferase	NA	NA	NA	NA
WP_066527623.1\|2342860_2345179_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	3.6e-176	43.6
WP_066527625.1\|2345335_2345533_-	DUF1192 domain-containing protein	NA	NA	NA	NA
WP_066527627.1\|2345634_2346654_+	NAD(P)H-quinone oxidoreductase	NA	NA	NA	NA
WP_066527628.1\|2346738_2347602_+	UDP-2,3-diacylglucosamine diphosphatase	A0A218MKA7	uncultured_virus	1.1e-64	48.1
WP_066527631.1\|2347601_2348630_+	glycosyltransferase family 1 protein	NA	NA	NA	NA
WP_066527633.1\|2348744_2349428_+	DUF1013 domain-containing protein	NA	NA	NA	NA
WP_066527636.1\|2349610_2351317_+	long-chain fatty acid--CoA ligase	A0A1V0SBX8	Catovirus	6.6e-26	24.9
WP_066527640.1\|2351360_2351894_+	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_066527642.1\|2352052_2352319_+	hypothetical protein	NA	NA	NA	NA
WP_066527644.1\|2352346_2353303_-	threonylcarbamoyl-AMP synthase	A0A291ATS8	Pandoravirus	3.9e-36	37.8

DBSCAN-SWA_189

2357310 : 2360046

Streptomyces_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066527651.1\|2357310_2358219_-	C40 family peptidase	A0A1J0GW44	Streptomyces_phage	5.1e-09	40.2
WP_066527653.1\|2358178_2358586_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_066527655.1\|2358648_2360046_-	leucyl aminopeptidase family protein	Q6GYZ8	Mycoplasma_phage	6.1e-30	31.4

DBSCAN-SWA_190

2363712 : 2365876

uncultured_Mediterranean_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066527661.1\|2363712_2364477_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.2e-35	37.4
WP_066527663.1\|2364598_2365876_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.2e-96	46.3

DBSCAN-SWA_191

2379102 : 2385681

Sinorhizobium_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066527704.1\|2379102_2381595_+	DNA ligase D	A0A291AUV6	Sinorhizobium_phage	8.0e-57	41.5
WP_066527706.1\|2381653_2381839_+	hypothetical protein	NA	NA	NA	NA
WP_066527708.1\|2381926_2382307_-	EF-hand domain-containing protein	NA	NA	NA	NA
WP_066527711.1\|2382579_2383896_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	1.5e-17	28.2
WP_066527714.1\|2384254_2384554_-	DNA repair protein RadC	NA	NA	NA	NA
WP_082919622.1\|2384676_2385681_+	thymidylate synthase	A6M9A2	Geobacillus_virus	1.5e-70	47.0

DBSCAN-SWA_192

2398213 : 2400307

Prochlorococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066527737.1\|2398213_2399110_+	fructose bisphosphate aldolase	A0A0K0KVJ8	Prochlorococcus_phage	1.9e-08	26.2
WP_066527739.1\|2399117_2399594_+	AAC(3)-I family aminoglycoside N-acetyltransferase	NA	NA	NA	NA
WP_066529330.1\|2399590_2400307_-	DUF72 domain-containing protein	A0A1V0CNL1	Kaumoebavirus	7.2e-27	32.8

DBSCAN-SWA_193

2441735 : 2443895

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066527815.1\|2441735_2443895_+	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	3.6e-21	23.4

DBSCAN-SWA_194

2447335 : 2455307

Bacillus_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066527820.1\|2447335_2449309_-	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	1.0e-99	37.4
WP_066527822.1\|2449426_2450107_-	GcrA cell cycle regulator	NA	NA	NA	NA
WP_066527823.1\|2450223_2451072_+	ABC transporter permease	NA	NA	NA	NA
WP_066527824.1\|2451235_2452552_-	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	1.8e-76	39.0
WP_066527826.1\|2452713_2453859_+	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A1V0SAG5	Catovirus	1.0e-22	26.0
WP_066527828.1\|2454011_2455307_+	UDP-N-acetyl-D-mannosamine dehydrogenase	M1HPJ2	Paramecium_bursaria_Chlorella_virus	7.2e-25	26.5

DBSCAN-SWA_195

2470459 : 2475604

Acinetobacter_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066527846.1\|2470459_2471131_-	transcriptional repressor LexA	Q38327	Lactococcus_phage	6.0e-07	27.5
WP_066527849.1\|2471488_2472673_-	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_066527850.1\|2472669_2473140_-	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
WP_066527851.1\|2473136_2473928_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	4.5e-54	47.2
WP_066529354.1\|2473924_2474917_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	5.5e-41	36.7
WP_066527853.1\|2475013_2475604_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	4.5e-43	47.7

DBSCAN-SWA_196

2495345 : 2496692

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066527906.1\|2495345_2496692_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.9e-52	33.1

DBSCAN-SWA_197

2527422 : 2528205

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066527959.1\|2527422_2528205_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A127KMU1	Cyanophage	1.6e-43	40.9

DBSCAN-SWA_198

2532696 : 2537996

Bacillus_virus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066527963.1\|2532696_2534985_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	3.0e-74	35.2
WP_066527968.1\|2535069_2536821_+	EAL domain-containing protein	NA	NA	NA	NA
WP_066527970.1\|2536784_2537996_-\|tRNA	CCA tRNA nucleotidyltransferase	A0A1B0V011	Roseobacter_phage	1.9e-48	35.4

DBSCAN-SWA_199

2542555 : 2544741

Pandoravirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066528004.1\|2542555_2543017_+	cupin domain-containing protein	A0A291ATU0	Pandoravirus	8.2e-32	48.3
WP_066528006.1\|2543115_2543745_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_066528007.1\|2543808_2544741_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	7.5e-24	28.4

DBSCAN-SWA_200

2554646 : 2555030

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066528037.1\|2554646_2555030_+	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	1.4e-05	39.8

DBSCAN-SWA_201

2560575 : 2561481

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066529395.1\|2560575_2561481_+	histone deacetylase	A0A2K9L2T7	Tupanvirus	1.4e-11	27.0

DBSCAN-SWA_202

2568341 : 2569007

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066528077.1\|2568341_2569007_+	guanylate kinase	V9VFN5	Lactococcus_phage	1.2e-10	34.1

DBSCAN-SWA_203

2576166 : 2576865

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066529410.1\|2576166_2576865_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.1e-35	39.4

DBSCAN-SWA_204

2581803 : 2582037

Yersinia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007689016.1\|2581803_2582037_+	acyl carrier protein	A0A2C9CX86	Yersinia_phage	7.3e-05	40.2

DBSCAN-SWA_205

2585292 : 2585832

Pelagibacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066529421.1\|2585292_2585832_+	peroxiredoxin	M1I839	Pelagibacter_phage	4.0e-46	54.9

DBSCAN-SWA_206

2592552 : 2594007

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066528127.1\|2592552_2594007_-	glucose-6-phosphate dehydrogenase	E3SJC5	Synechococcus_phage	9.1e-77	36.2

DBSCAN-SWA_207

2597155 : 2598160

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066528146.1\|2597155_2598160_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	5.5e-41	33.4

DBSCAN-SWA_208

2604642 : 2605251

Pneumococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066529427.1\|2604642_2605251_+	GTP cyclohydrolase I FolE	E7DN69	Pneumococcus_phage	1.4e-42	47.2

DBSCAN-SWA_209

2608826 : 2618622

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066528179.1\|2608826_2610143_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	8.2e-69	37.5
WP_066529433.1\|2610170_2611349_-	glycosyltransferase family 1 protein	NA	NA	NA	NA
WP_066529436.1\|2611467_2611686_+	DUF2945 domain-containing protein	NA	NA	NA	NA
WP_066528187.1\|2611730_2612381_+	MOSC domain-containing protein	NA	NA	NA	NA
WP_066528199.1\|2612448_2614788_+	ribonuclease R	Q0GXV6	Lactococcus_phage	9.9e-49	30.5
WP_066528202.1\|2614862_2615318_-	universal stress protein	NA	NA	NA	NA
WP_066528204.1\|2615525_2616806_+	pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase	NA	NA	NA	NA
WP_066528205.1\|2616805_2617222_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_066528211.1\|2617224_2618622_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	3.8e-40	26.8

DBSCAN-SWA_210

2623122 : 2631444

Pseudomonas_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066528230.1\|2623122_2624127_-	PhoH family protein	H6X2N1	Pseudomonas_phage	6.8e-47	44.7
WP_066528236.1\|2624249_2625599_-\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
WP_066528239.1\|2625608_2626367_-	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_066529439.1\|2626371_2626794_-	transcriptional repressor	NA	NA	NA	NA
WP_066528242.1\|2626914_2627337_-	transcriptional regulator	A0A1P8VVG0	Erythrobacter_phage	2.9e-28	55.2
WP_066528243.1\|2627449_2627929_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_066528244.1\|2627925_2628546_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_066528251.1\|2628636_2629209_-	NifU family protein	NA	NA	NA	NA
WP_066528253.1\|2629321_2629792_+	general stress protein	NA	NA	NA	NA
WP_066528255.1\|2630067_2631444_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.4e-55	33.4

DBSCAN-SWA_211

2634609 : 2640298

Streptococcus_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066528258.1\|2634609_2635158_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	7.7e-29	45.4
WP_066528261.1\|2635304_2635484_+	hypothetical protein	NA	NA	NA	NA
WP_066528265.1\|2635487_2635736_+	hypothetical protein	NA	NA	NA	NA
WP_156518567.1\|2635912_2636092_+	hypothetical protein	K4JSS2	Caulobacter_virus	7.8e-07	56.8
WP_066528267.1\|2636088_2636295_+	hypothetical protein	NA	NA	NA	NA
WP_066528269.1\|2636447_2636975_-	hypothetical protein	NA	NA	NA	NA
WP_066528271.1\|2636971_2637157_-	hypothetical protein	NA	NA	NA	NA
WP_082919632.1\|2637159_2637612_-	lysozyme	A0A088FRS5	Escherichia_phage	1.2e-35	49.3
WP_066528276.1\|2637592_2637808_-	hypothetical protein	R9TF71	Synechococcus_phage	6.1e-06	54.2
WP_156518493.1\|2637804_2637942_-	hypothetical protein	NA	NA	NA	NA
WP_066528278.1\|2637941_2639669_-	hypothetical protein	NA	NA	NA	NA
WP_066528282.1\|2639671_2640298_-	hypothetical protein	A0A2H4PCZ7	Mycobacterium_phage	2.3e-08	59.4

DBSCAN-SWA_212

2647834 : 2664375

Salicola_phage(23.08%)

terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_066528300.1\|2647834_2648488_-	hypothetical protein	A0A218MLY0	uncultured_virus	1.5e-18	28.6
WP_066528301.1\|2648497_2648827_-	hypothetical protein	A0A218MLW6	uncultured_virus	4.8e-10	38.4
WP_156518499.1\|2648816_2648981_-	hypothetical protein	NA	NA	NA	NA
WP_066529441.1\|2649033_2649876_-	hypothetical protein	A0A1Y0T0F4	Sinorhizobium_phage	4.3e-55	45.6
WP_066528303.1\|2650040_2651033_-	hypothetical protein	NA	NA	NA	NA
WP_066528305.1\|2651046_2651370_-	hypothetical protein	NA	NA	NA	NA
WP_066528308.1\|2651366_2653400_-	hypothetical protein	A0A1B1IQR4	uncultured_Mediterranean_phage	2.0e-66	32.5
WP_066528310.1\|2653399_2654695_-\|terminase	terminase	A0A088F6U9	Sulfitobacter_phage	2.0e-160	64.1
WP_066528312.1\|2654691_2654997_-	hypothetical protein	NA	NA	NA	NA
WP_066528314.1\|2655266_2655515_-	hypothetical protein	NA	NA	NA	NA
WP_156518501.1\|2655608_2655968_-	hypothetical protein	NA	NA	NA	NA
WP_066528318.1\|2655964_2656150_-	hypothetical protein	NA	NA	NA	NA
WP_066528320.1\|2656699_2657005_-	hypothetical protein	A6N3H4	Burkholderia_virus	8.7e-22	57.3
WP_066528322.1\|2657345_2659340_-	AAA family ATPase	M4QSC1	Salicola_phage	1.1e-205	54.3
WP_156518503.1\|2659343_2659505_-	hypothetical protein	NA	NA	NA	NA
WP_066528323.1\|2659629_2660307_+	ATP-binding protein	A0A1J0GWC4	Alteromonas_phage	8.8e-83	69.5
WP_066528325.1\|2660303_2660684_+	hypothetical protein	M4QTR6	Salicola_phage	1.0e-32	54.0
WP_066528328.1\|2660689_2661172_+	DUF669 domain-containing protein	A0A088F739	Idiomarinaceae_phage	4.7e-46	58.7
WP_066528330.1\|2661229_2662240_+	hypothetical protein	A0A1J0GWD5	Alteromonas_phage	7.2e-97	53.6
WP_066528333.1\|2662229_2663816_+	DEAD/DEAH box helicase	A0A088F773	Idiomarinaceae_phage	5.1e-190	60.6
WP_082919634.1\|2663988_2664375_-	hypothetical protein	M4R251	Salicola_phage	5.4e-29	57.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP015987

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

208797 : 285957

Streptococcus_phage(10.0%)

coat,holin,integrase,transposase

attL 236397:236412|attR 290078:290093

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082919705.1\|208797_209199_-\|integrase	tyrosine-type recombinase/integrase	A0A1S5SFD7	Streptococcus_phage	4.4e-05	30.8
WP_066529896.1\|209243_209600_+\|transposase	transposase	NA	NA	NA	NA
WP_066529904.1\|209596_209950_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_066529910.1\|212164_212419_-	hypothetical protein	NA	NA	NA	NA
WP_066529913.1\|212515_213694_-	acetyl-CoA C-acyltransferase family protein	NA	NA	NA	NA
WP_066529914.1\|213706_215779_-	hypothetical protein	NA	NA	NA	NA
WP_066529916.1\|215792_217526_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_066529919.1\|217763_220028_-	TonB-dependent receptor	NA	NA	NA	NA
WP_066531596.1\|220343_221750_+	NAD(P)-binding protein	NA	NA	NA	NA
WP_066529921.1\|221936_223220_+	acyl-CoA/acyl-ACP dehydrogenase	NA	NA	NA	NA
WP_066529923.1\|223254_224388_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_066529931.1\|224396_225956_+	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	2.8e-31	30.1
WP_066529940.1\|225974_227213_+	thiolase family protein	NA	NA	NA	NA
WP_066529942.1\|227276_228626_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_066529945.1\|228641_229889_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_066529948.1\|229885_230908_+	phosphotransferase family protein	NA	NA	NA	NA
WP_066529950.1\|230918_231695_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	4.0e-15	30.8
WP_066529956.1\|231774_232191_-	RidA family protein	NA	NA	NA	NA
WP_066531603.1\|232204_233047_-	phytanoyl-CoA dioxygenase	NA	NA	NA	NA
WP_066531604.1\|233159_233807_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_066529958.1\|234026_234488_+	hypothetical protein	NA	NA	NA	NA
WP_066529962.1\|235295_236174_+	DNA polymerase III subunit epsilon	U5Q053	Bacillus_virus	8.3e-09	30.9
WP_082919707.1\|236292_236832_+	thermonuclease family protein	NA	NA	NA	NA
236397:236412	attL	NA	NA	NA	NA
WP_066529965.1\|236869_238885_+	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_082919708.1\|238990_240121_+	DUF429 domain-containing protein	NA	NA	NA	NA
WP_066529967.1\|240334_241240_+\|integrase	tyrosine-type recombinase/integrase	A0A1P8DJJ6	Virus_Rctr41k	4.9e-28	30.2
WP_066529969.1\|241243_242437_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_066529971.1\|243010_243244_+	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
WP_066529978.1\|243240_243570_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_066529979.1\|243912_244596_+	DUF1211 domain-containing protein	NA	NA	NA	NA
WP_066529980.1\|244622_247163_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	1.9e-154	33.9
WP_066529981.1\|247216_248056_-	aldo/keto reductase	NA	NA	NA	NA
WP_066529983.1\|248360_248669_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_066529986.1\|248709_249123_-	heme-binding protein	NA	NA	NA	NA
WP_066531607.1\|249296_250466_-	glutathione-dependent formaldehyde dehydrogenase	E3SJ82	Synechococcus_phage	1.2e-07	25.4
WP_082919709.1\|250919_251594_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_082919710.1\|251781_253158_+	DUF1214 domain-containing protein	NA	NA	NA	NA
WP_066529995.1\|253179_255315_+	TonB-dependent receptor	NA	NA	NA	NA
WP_066531614.1\|256464_257541_+	alkene reductase	NA	NA	NA	NA
WP_066530001.1\|257823_258873_-	tyrosine-protein phosphatase	NA	NA	NA	NA
WP_066530004.1\|258980_261425_-	TonB-dependent receptor	NA	NA	NA	NA
WP_066530006.1\|261733_261919_-	hypothetical protein	NA	NA	NA	NA
WP_082919797.1\|261915_262107_-	hypothetical protein	NA	NA	NA	NA
WP_066530009.1\|262174_262513_-	hypothetical protein	NA	NA	NA	NA
WP_066530011.1\|262638_263010_-	hypothetical protein	NA	NA	NA	NA
WP_066530013.1\|263868_264159_+	PAS domain-containing protein	NA	NA	NA	NA
WP_082919711.1\|264164_264314_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_066530020.1\|264743_265073_+	hypothetical protein	NA	NA	NA	NA
WP_066530027.1\|265072_265810_+	ATPase	NA	NA	NA	NA
WP_066530035.1\|265809_270144_+	UDP-forming cellulose synthase catalytic subunit	M1I277	Paramecium_bursaria_Chlorella_virus	4.2e-37	34.8
WP_066530036.1\|270140_273530_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_066530040.1\|273529_274006_+	hypothetical protein	NA	NA	NA	NA
WP_066530042.1\|273995_275006_+	endoglucanase	NA	NA	NA	NA
WP_066530044.1\|276842_277967_+	DNA topoisomerase IB	A0A0U2TSJ7	Niemeyer_virus	1.1e-40	32.9
WP_066530045.1\|278838_279495_+	hypothetical protein	NA	NA	NA	NA
WP_066530047.1\|279891_280794_-	TauD/TfdA family dioxygenase	NA	NA	NA	NA
WP_066530051.1\|281071_282823_+	amidohydrolase family protein	NA	NA	NA	NA
WP_156518602.1\|282852_283773_-	hypothetical protein	NA	NA	NA	NA
WP_066530053.1\|284355_285957_-\|holin	choline dehydrogenase	A0A1V0SI18	Klosneuvirus	1.2e-58	33.8
290078:290093	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP015988

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

14186 : 74461

Saudi_moumouvirus(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_156518732.1\|14186_14946_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	3.2e-25	46.7
WP_082919829.1\|17432_18407_-	hypothetical protein	NA	NA	NA	NA
WP_066531887.1\|18579_19098_+	hypothetical protein	NA	NA	NA	NA
WP_066531889.1\|19990_20269_+	hypothetical protein	NA	NA	NA	NA
WP_066531893.1\|21783_23010_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	3.2e-06	32.4
WP_156518735.1\|23535_24147_-	hypothetical protein	NA	NA	NA	NA
WP_066531910.1\|24325_26386_-	PQQ-dependent dehydrogenase, methanol/ethanol family	NA	NA	NA	NA
WP_082919831.1\|26786_28559_-	carboxylesterase/lipase family protein	A0A1S5V000	Saudi_moumouvirus	2.9e-16	30.7
WP_156518737.1\|28482_29469_-	hypothetical protein	NA	NA	NA	NA
WP_156518739.1\|29516_31247_-	hypothetical protein	NA	NA	NA	NA
WP_082919832.1\|31216_32968_-	carboxylesterase family protein	S4VZJ7	Pandoravirus	5.0e-37	29.2
WP_066531920.1\|32964_34548_-	carboxylesterase family protein	A0A1S5V000	Saudi_moumouvirus	5.3e-30	38.0
WP_066531922.1\|35177_37676_+	TonB-dependent receptor plug domain-containing protein	NA	NA	NA	NA
WP_156518741.1\|37854_39219_+	MFS transporter	NA	NA	NA	NA
WP_066531925.1\|39263_39614_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_066531926.1\|39657_40578_+	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	7.9e-26	32.0
WP_156518743.1\|41185_42246_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_066531927.1\|42471_43836_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_156518745.1\|44770_44947_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_082919833.1\|45008_45233_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_066531929.1\|45661_46300_-	CoA transferase subunit B	NA	NA	NA	NA
WP_066531930.1\|46299_47010_-	CoA transferase subunit A	NA	NA	NA	NA
WP_066531932.1\|47278_48340_-\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	1.0e-08	36.3
WP_066531935.1\|48543_49434_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_066531936.1\|50675_50888_+	hypothetical protein	NA	NA	NA	NA
WP_066531937.1\|51104_52025_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_066531940.1\|53275_53854_+	hypothetical protein	NA	NA	NA	NA
WP_156518748.1\|54993_55383_+	hypothetical protein	NA	NA	NA	NA
WP_066531942.1\|55570_56527_-	NADP-dependent oxidoreductase	NA	NA	NA	NA
WP_082919834.1\|57518_59720_-	TonB-dependent receptor	NA	NA	NA	NA
WP_066531946.1\|59931_61410_-	aldehyde dehydrogenase	NA	NA	NA	NA
WP_082919835.1\|61813_63325_+	carboxylesterase family protein	J3IYU2	Acanthamoeba_polyphaga_lentillevirus	6.4e-33	28.8
WP_082919836.1\|63834_65646_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_066531956.1\|65669_66569_+	oxaloacetate decarboxylase	NA	NA	NA	NA
WP_066531957.1\|66587_67421_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_066531959.1\|67417_68473_+	amidohydrolase family protein	NA	NA	NA	NA
WP_066531962.1\|68533_69265_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_066531965.1\|69332_70298_-	aldo/keto reductase	NA	NA	NA	NA
WP_156518792.1\|70452_71835_-	MmgE/PrpD family protein	NA	NA	NA	NA
WP_156518750.1\|72394_73216_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_066531969.1\|73300_73897_+	hypothetical protein	NA	NA	NA	NA
WP_156518752.1\|74290_74461_-\|transposase	transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP015989

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP015986

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP015987

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP015988

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection