CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP015968	Lactiplantibacillus plantarum strain LZ206 plasmid LZ206p1	0 crisprs	NA	0	0
NZ_CP015969	Lactiplantibacillus plantarum strain LZ206 plasmid LZ206p3, complete sequence	0 crisprs	NA	0	0
NZ_CP015967	Lactiplantibacillus plantarum strain LZ206 plasmid LZ206p2, complete sequence	0 crisprs	NA	0	0
NZ_CP015966	Lactiplantibacillus plantarum strain LZ206 chromosome, complete genome	2 crisprs	cas3,DEDDh,DinG,csa3,csn2,cas2,cas1,cas9,WYL	3	7

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP015966_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015966_1

2416755-2417252

TypeII

Consensus_repeat	Method
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CRT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	PILER-CR
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CRISPRCasFinder

7 spacers

csa3,csn2,cas2,cas1,cas9

The CRISPR arrays of NZ_CP015966_1

>merge|NZ_CP015966|1|2416755-2417252|CRT,PILER-CR,CRISPRCasFinder
CGTGAAACTGTTTTTGATGTGGCCGCTATTCAAGACAAACGTTCTATGCTTCGTTTCCTCAGCATCGTTCTAAACCTGTTTGATATGACTACTATTCAAGACCGTAAATAGGTTGTAAACGTTCAGGTCTGAGTTCTAAACCTGTTTGATATGACTACTATTCAAGACTAATACGATCCATTGACTCCGCTAGTGACAGTTCTAAACCTGTTTGATATGACTACTATTCAAGACTATTCTCGTTTATCGCTTTTAGACGTGTTAGTTCTAAACCTGTTTGATATGACTACTATTCAAGACGTTTGGACTGGTTTATCAAGCAACAAGTTGGTTCTAAACCTGTTTGATATGACTACTATTCAAGACAAGCGCGGGATCACGTGCAACAGCACCATCGTTCTAAACCTGTTTGATATGACTACTATTCAAGACACGTCGGCAAACTGTTCCAATCCTTGACATGTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

>NZ_CP015966|1|1|2416755-2417252|CRT
CGTGAAACTGTTTTTGATGTGGCCGCTATTCAAGAC	AAACGTTCTATGCTTCGTTTCCTCAGCATC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CGTAAATAGGTTGTAAACGTTCAGGTCTGA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TAATACGATCCATTGACTCCGCTAGTGACA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TATTCTCGTTTATCGCTTTTAGACGTGTTA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GTTTGGACTGGTTTATCAAGCAACAAGTTG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AAGCGCGGGATCACGTGCAACAGCACCATC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	ACGTCGGCAAACTGTTCCAATCCTTGACAT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

>NZ_CP015966|1|1|2416821-2417252|PILER-CR
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CGTAAATAGGTTGTAAACGTTCAGGTCTGA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TAATACGATCCATTGACTCCGCTAGTGACA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TATTCTCGTTTATCGCTTTTAGACGTGTTA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GTTTGGACTGGTTTATCAAGCAACAAGTTG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AAGCGCGGGATCACGTGCAACAGCACCATC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	ACGTCGGCAAACTGTTCCAATCCTTGACAT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

>NZ_CP015966|1|1|2416821-2417252|CRISPRCasFinder
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CGTAAATAGGTTGTAAACGTTCAGGTCTGA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TAATACGATCCATTGACTCCGCTAGTGACA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TATTCTCGTTTATCGCTTTTAGACGTGTTA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GTTTGGACTGGTTTATCAAGCAACAAGTTG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AAGCGCGGGATCACGTGCAACAGCACCATC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	ACGTCGGCAAACTGTTCCAATCCTTGACAT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015966.1\|WP_003646321.1\|2411416_2411890_-\|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP015966.1\|WP_011100893.1\|2423697_2424480_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP015966.1\|WP_015379645.1\|2408103_2408403_-\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP015966.1\|WP_015379639.1\|2418233_2419139_-\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187851
NZ_CP015966.1\|WP_003641725.1\|2425311_2426676_-\|amino-acid-permease	unknown	unknown	gnl\|CDD\|182694
NZ_CP015966.1\|WP_003646323.1\|2410305_2410761_+\|DUF3021-domain-containing-protein	unknown	unknown	gnl\|CDD\|378668
NZ_CP015966.1\|WP_015379633.1\|2430151_2431351_-\|putative-hydroxymethylpyrimidine-transporter-CytX	unknown	unknown	gnl\|CDD\|274096
NZ_CP015966.1\|WP_003641722.1\|2429329_2430070_-\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|224982
NZ_CP015966.1\|WP_021357176.1\|2426908_2427379_+\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|240033
NZ_CP015966.1\|WP_003646319.1\|2412908_2413667_-\|nucleoside-phosphorylase	unknown	unknown	gnl\|CDD\|350158
NZ_CP015966.1\|WP_003643663.1\|2408493_2409726_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340949
NZ_CP015966.1\|WP_003641733.1\|2410848_2411271_-\|Hsp20/alpha-crystallin-family-protein	unknown	unknown	gnl\|CDD\|107228
NZ_CP015966.1\|WP_021357178.1\|2424504_2425212_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015966.1\|WP_064523473.1\|2413951_2416690_+\|cation-transporting-P-type-ATPase	unknown	unknown	gnl\|CDD\|319775
NZ_CP015966.1\|WP_015379641.1\|2417276_2417954_-\|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd12218_csn2_CAS-II-A	gnl\|CDD\|213411
NZ_CP015966.1\|WP_003641730.1\|2412671_2412866_+\|PspC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377200
NZ_CP015966.1\|WP_064523476.1\|2419332_2423409_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	mkCas0193_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|374653
NZ_CP015966.1\|WP_003646320.1\|2412003_2412606_+\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|377026
NZ_CP015966.1\|WP_071542797.1\|2410024_2410309_+\|LytTR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197918
NZ_CP015966.1\|WP_015379640.1\|2417950_2418256_-\|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|226043

Protein	Function_ID	Function_description	E-value
NZ_CP015966.1\|WP_003646321.1\|2411416_2411890_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	0.000122978
NZ_CP015966.1\|WP_011100893.1\|2423697_2424480_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	8.96404e-26
NZ_CP015966.1\|WP_015379645.1\|2408103_2408403_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	2.33489e-13
NZ_CP015966.1\|WP_015379639.1\|2418233_2419139_-\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	1.7681e-88
NZ_CP015966.1\|WP_003641725.1\|2425311_2426676_-\|amino-acid-permease	gnl\|CDD\|182694	PRK10746, PRK10746, putative transport protein YifK; Provisional.	0
NZ_CP015966.1\|WP_003646323.1\|2410305_2410761_+\|DUF3021-domain-containing-protein	gnl\|CDD\|378668	pfam11457, DUF3021, Protein of unknown function (DUF3021). This is a bacterial family of uncharacterized proteins.	7.07627e-26
NZ_CP015966.1\|WP_015379633.1\|2430151_2431351_-\|putative-hydroxymethylpyrimidine-transporter-CytX	gnl\|CDD\|274096	TIGR02358, purine-cytosine_transport_protein, putative hydroxymethylpyrimidine transporter CytX. On the basis of a phylogenomic study of thiamine biosythetic, salvage, and transporter genes and a highly conserved RNA element THI, this protein family has been identified as a probable transporter of hydroxymethylpyrimidine (HMP), the phosphorylated (by ThiD) form of which gets joined (by ThiE) to hydroxyethylthiazole phosphate to make thiamine phosphate. [Transport and binding proteins, Nucleosides, purines and pyrimidines, Biosynthesis of cofactors, prosthetic groups, and carriers, Thiamine].	1.14314e-146
NZ_CP015966.1\|WP_003641722.1\|2429329_2430070_-\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	gnl\|CDD\|224982	COG2071, COG2071, Predicted glutamine amidotransferases [General function prediction only].	4.48973e-88
NZ_CP015966.1\|WP_021357176.1\|2426908_2427379_+\|NUDIX-hydrolase	gnl\|CDD\|240033	cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	1.14377e-57
NZ_CP015966.1\|WP_003646319.1\|2412908_2413667_-\|nucleoside-phosphorylase	gnl\|CDD\|350158	cd09007, NP-I_spr0068, uncharacterized subfamily of the nucleoside phosphorylase-I family. This subfamily is composed of uncharacterized members including Streptococcus pneumoniae hypothetical protein spr0068. The nucleoside phosphorylase-I (NP-I) family members accept a range of purine nucleosides as well as the pyrimidine nucleoside uridine. The NP-1 family includes phosphorolytic nucleosidases such as purine nucleoside phosphorylase (PNP, EC. 2.4.2.1), uridine phosphorylase (UP, EC 2.4.2.3), and 5'-deoxy-5'-methylthioadenosine phosphorylase (MTAP, EC 2.4.2.28), and hydrolytic nucleosidases such as AMP nucleosidase (AMN, EC 3.2.2.4) and 5'-methylthioadenosine/S-adenosylhomocysteine (MTA/SAH) nucleosidase (MTAN, EC 3.2.2.16). Members of the NP-I family display different physiologically relevant quaternary structures: hexameric (trimer-of-dimers arrangement of Shewanella oneidensis MR-1 UP); homotrimeric (human PNP and Escherichia coli PNPII or XapA); hexameric (with some evidence for co-existence of a trimeric form) such as E. coli PNPI (DeoD); or homodimeric such as human and Trypanosoma brucei UP. The NP-I family is distinct from nucleoside phosphorylase-II, which belongs to a different structural family.	7.37287e-90
NZ_CP015966.1\|WP_003643663.1\|2408493_2409726_-\|MFS-transporter	gnl\|CDD\|340949	cd17391, MFS_MdtG_MDR_like, Multidrug resistance protein MdtG and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli multidrug resistance protein MdtG, Streptococcus pneumoniae multidrug resistance efflux pump PmrA, and similar multidrug resistance (MDR) transporters from bacteria. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtG confers resistance to fosfomycin and deoxycholate. PmrA serves as an efflux pump for various substrates and is associated with fluoroquinolone resistance. MdtG-like MDR transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.1962e-140
NZ_CP015966.1\|WP_003641733.1\|2410848_2411271_-\|Hsp20/alpha-crystallin-family-protein	gnl\|CDD\|107228	cd06471, ACD_LpsHSP_like, Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18.5, HSP 18.55 and HSP 19.3. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Transcription of the genes encoding Lp HSP 18.5, 18.55 and 19.3 is regulated by a variety of stresses including heat, cold and ethanol. Early growing L. plantarum cells contain elevated levels of these mRNAs which rapidly fall of as the cells enter stationary phase. Also belonging to this group is Bifidobacterium breve (Bb) HSP20 and Oenococcus oenis (syn. Leuconostoc oenos) (Oo) HSP18. Transcription of the gene encoding BbHSP20 is strongly induced following heat or osmotic shock, and that of the gene encoding OoHSP18 following heat, ethanol or acid shock. OoHSP18 is peripherally associated with the cytoplasmic membrane.	2.47416e-43
NZ_CP015966.1\|WP_064523473.1\|2413951_2416690_+\|cation-transporting-P-type-ATPase	gnl\|CDD\|319775	cd02080, P-type_ATPase_cation, P-type cation-transporting ATPase similar to Exiguobacterium aurantiacum Mna, an Na(+)-ATPase, and Synechocystis sp. PCC 6803 PMA1, a putative Ca(2+)-ATPase. This subfamily includes the P-type Na(+)-ATPase of an alkaliphilic bacterium Exiguobacterium aurantiacum Mna and cyanobacterium Synechocystis sp. PCC 6803 PMA1, a cation-transporting ATPase which may translocate calcium. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP015966.1\|WP_015379641.1\|2417276_2417954_-\|type-II-A-CRISPR-associated-protein-Csn2	gnl\|CDD\|213411	cd12218, Csn2, CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	4.14563e-81
NZ_CP015966.1\|WP_003641730.1\|2412671_2412866_+\|PspC-domain-containing-protein	gnl\|CDD\|377200	pfam04024, PspC, PspC domain. This family includes Phage shock protein C (PspC) that is thought to be a transcriptional regulator. The presumed domain is 60 amino acid residues in length.	2.12668e-17
NZ_CP015966.1\|WP_064523476.1\|2419332_2423409_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|374653	pfam16592, Cas9_REC, REC lobe of CRISPR-associated endonuclease Cas9. The REC lobe of Cas9 - the CRISPR-associated endonuclease Cas9 - includes the REC1 and REC2 domains. REC1 forms an elongated, alpha-helical structure consisting of 25 alpha helices and two beta-sheets, whereas REC2 inserted within REC1 adopts a six-helix bundle structure. The REC lobe and the NUC lobe of Cas9 fold to present a positively charged groove at their interface which accommodates the negatively charged sgRNA:target DNA heteroduplex. CRISPR (clustered regularly interspaced short palindromic repeat)-Cas system occurs naturally in bacteria as a defense against invasion by phages or other mobile genetic elements. Cas9 is targeted to specific genomic locations by sgRNAs or single guide RNAs, in order to complex with invading DNA in order to cleave it and render it inactive.	4.86297e-128
NZ_CP015966.1\|WP_003646320.1\|2412003_2412606_+\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|377026	pfam03358, FMN_red, NADPH-dependent FMN reductase.	3.18179e-31
NZ_CP015966.1\|WP_071542797.1\|2410024_2410309_+\|LytTR-family-transcriptional-regulator	gnl\|CDD\|197918	smart00850, LytTR, LytTr DNA-binding domain. This domain is found in a variety of bacterial transcriptional regulators. The domain binds to a specific DNA sequence pattern.	6.75435e-19
NZ_CP015966.1\|WP_015379640.1\|2417950_2418256_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	2.01798e-25

>NZ_CP015966.1|WP_064523473.1|2413951_2416690_+|cation-transporting-P-type-ATPase
MIKDDNQSLTSNEEQNDTQNPPDADNLWQLDESALAAKYATDPENGLSTAEAAERLQHNGRNELETKRTSRFVQFIKQFNNSIIYILAAAAVLTFFMHHYSDSIVIGLVIIANAIIGYVQERQAGNALERIREMLISKNFVIRDGKKLEIDARELVVGDLVNLEAGDAVPADMRLISADNFNVQESVLTGETNPVEKQEEPITETTPALADRKNMVYASTAVTSGSAVGIVTATAEDTEIGHIQQSVSDVKQTTTPLMRNLNSLGVDLSIAIVVAAVLLFLLGMVMDTYSLPTLLIAVITMVVGSMPEGLPASTSVVLAMGTRQMTKKNVIVKSLPAVETLGAVDIVNTDKTGTLTKNEMTVTKVVTPEHTFDVTGVGYDDNGGVNFDGHLKLNGNKVDWHQDNAMEWLVKIAGQTTDAELHFENNRWELTGEPTDGALTTLYRKMTGHDPEVEEVDSLPFDSAFRFSARLADLDGQRLLMVKGSPATVLRLTDQANQTAYWDDAMDDLTADGLRVVALAYQEVDDDVTTIDAQAIGGLHLAGLVGIIDPPREEAATAIAELRQAGVQVKMITGDHPDTAMAIANKLNLAANVKAITGPEIDAMDDQQLQAHIDDYNVFARATPNNKLRIVRAQQANNHVVSMTGDGVNDAPALKQADIGVAMGIKGTEVAKESADMVLADDDFADIVAAVREGRHVFDNIRKTIRFLLPTSFAEGLVVIISILMGHELPLYPTQLLWINMVSALTIQFAFIFEPPEAGIMARGPRNVKSGLLSKLDYFEIGYVSFLISGLGIFAYDYLTALGLPNVVGSTMSLNIIIFGKIFYLFNLRNDHPVISKYFFQNKMAFYIIGILILLQLGIIYLPFMQSVFHTTSINFWYGWGIPIICGIVVLIVTEVGKSIRFRWMGKDGVID
>NZ_CP015966.1|WP_003646319.1|2412908_2413667_-|nucleoside-phosphorylase
MTDKLTLLQYDPNPTAMVGPDVDGRFTVPAKLLYIFSGDDYFQQFVTRYHGHRLGQFNTITKVSWVYQIGYRGQKLAVAQAPLGSPAATMYLEMLIDFGARTVIAVGSCGALTALPEEQLLIPTVALRDEGTSFHYLAAADWVPLDPKVIQVLGTTLTKACLPWQMVKTWTTDAFFRETVSKVKAARQQGCQVVEMECSALAACSAFRQVSFGQLLYTADTLAQLEHYDPRHWGAGGVLVAIELATESLAAY
>NZ_CP015966.1|WP_003641730.1|2412671_2412866_+|PspC-domain-containing-protein
MKIDIHRSATDRVIAGVIGGIAEHFNWNTNVTRLLFVVLAITPMFPGIIAYLILWLLMKDPIKD
>NZ_CP015966.1|WP_003646320.1|2412003_2412606_+|NAD(P)H-dependent-oxidoreductase
MFKIAIILGSTRSQANGRALFNHLKLIIDQLPTHSTIHYQFLDLANYQLPLFDEPEPPMANPHRELPANQQQWLTDMASADGYIILTPEYNHAMPAGLKNAFDFLAFEGARKPAKIISYSDNMRGGQFGAAALVPVLQRLGMVVLPKPTPIGNVPQTLQSNGHFIDNAPLSKRYDHALHQALTEITYYTTVLTTTPFPTD
>NZ_CP015966.1|WP_003646321.1|2411416_2411890_-|winged-helix-turn-helix-transcriptional-regulator
MTTPLVSQLMTELNQFLTQDSVDDQEKRWAMQQTTDPQLQAALKQLSTTDIKIIAYLGRRGASRAKSLPAPTELSQATISRGLTKLSRLKLATKYRDLTNNKEILVRLTTLGEAVADLHTQLDAAIAAKAQAIADDYSDAELRRFVSLMRRIREIKI
>NZ_CP015966.1|WP_003641733.1|2410848_2411271_-|Hsp20/alpha-crystallin-family-protein
MANTLMNRNDFGMLDPFERMARSFWAPLENMDQVLKTDINETDDQYQVKVDVPGIDKQDVKLDYRDNVLSIKVQKDSFVDHEDQDQNIVMNERHTGTLQRQYMLPNVAADKITASQADGVLTITLPKTQPSANDGQIEIQ
>NZ_CP015966.1|WP_003646323.1|2410305_2410761_+|DUF3021-domain-containing-protein
MKRLWHTLLIGAIGGIVIGYLMALGFSTFFNTTYLFPSNPTFVSHWSSPLAATQLSTLLWILIGEVWAFSSWLFEIETWSITKQTIAHCLCSYLGMTPLAILCGWFPLNVRWFGFYTLVYTGAYIGLWLIEMALARIKVIQLNQQLTNHRS
>NZ_CP015966.1|WP_071542797.1|2410024_2410309_+|LytTR-family-transcriptional-regulator
MPLQSVSRFYTANKRLYCETTTGAYLVHSHLHTLMDQLPPHQFLRISSSEIVRIACVKNFTLTKWGSFQVNLTTGTTTYASRRYTQQIRKAAQL
>NZ_CP015966.1|WP_003643663.1|2408493_2409726_-|MFS-transporter
MDDAERERGPWHRNLIVLWFCTFVAGMAFSEIMPFLSLFVSQLGDFTKAQITFYSGLAFAADYAISAISAPLWGIIADKKGRKIMLLRASLGMAVAMGLMGFVTNVWQLVALRALQGVFAGFISNAQALVASQTPRKYSGRALSTLITGAVSGQLFGPVIGGLLAQLFSIRNTFFITAGLLMVAFLLSLFFVQEHFKPVAHHREPGDSRNPLAAFQNPRLIIVMLCSTAIVQFGNASIAPIISLYVRELMHYRGPITVVAGIIAALPGISNIFSAPRLGRYGDQHGSGKVLLFGYIFAVIMYFPQGIVTSVVALGILRFAIGISDGALYPEIQTVLTKNTPVHLTSTIFSYNQSFQAIGNMFGALLGGLVAGWFNYNAVFIMTALLLLINLGLILWLVPDIWKNGKRAVS
>NZ_CP015966.1|WP_015379645.1|2408103_2408403_-|winged-helix-turn-helix-transcriptional-regulator
MNIEISKQDQADQQRVAIFKALADANRLRIIRVLYQAQREMTCSEVGAQLNISKSTVSYHFKTLRLVGLTNTRRKAQTKYLSLQLATFDRFLPGFLATL
>NZ_CP015966.1|WP_015379641.1|2417276_2417954_-|type-II-A-CRISPR-associated-protein-Csn2
MNITYYPFPPFKIDAGKVNVLDLGNSNMYAEVCQGFRDRIDSVRISNDDLELQTISSQCNWYGDLMLSVDLNRLFLKKVQTQIIKLMADDRQVAVLDENRKVVSQVMEASFLLDLPLDVDESPSLEQILKFTGIHFPTALMNDPRAILEALVQTHVELGLKQKLVLTNVSHYLNQKQWASFEQLVHDLGATVIVIEYSEINRMEKFKNSCYYYVDEDLVDWRDMN
>NZ_CP015966.1|WP_015379640.1|2417950_2418256_-|CRISPR-associated-endonuclease-Cas2
MRLIVMFDVPMDTSEERRAYRHFHKALVREGFLMMQYSTYVRVCVNKKAAEFVEKRIAPLAPKGGKVQTMTVTEKQYQAMHYIQGTPSNDILNSAERTIVI
>NZ_CP015966.1|WP_015379639.1|2418233_2419139_-|type-II-CRISPR-associated-endonuclease-Cas1
MGWRNVIITQHAKVSYSMNRILVQTSSDKYAVPISDIQLLLVGTTQAVITSAALCALTEAHVKVIFTDHQGEPISETNDYYPTRRTADLVRQQVTWPEARIATLWTKNVGSKILNQIQVIDFVGGDTQTLVDELDKLELNDVTNREAVVANKYFSLLFGDQFYRRDFSPINAALNYGYAVLLSMVNREIVLNGYLTCIGIHHENNENEFNLGSDLMEPFRPIVDQWVSQQRFKDFTPDIKIGLVSLLDLEIGFNGHQTIVSHAITEYVAACLHYLSGETEELKIEVKLPNEVSSDAINSHV
>NZ_CP015966.1|WP_064523476.1|2419332_2423409_-|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MKEPYGVGLDIGTNSVGWTVVDASGHVRKIKGQTGIGVRLFKEGAAAADRRGFRTTRRRLKRVKWRLRLLREFFDQPISKVDINFFARRKYSDVSPRDPNYNGLEKTLFNDRSDQDFYHDYPTIYHLREALMTQHRKFDVREIYLAIHHIVKYRGNFLRNDAATAYRSGTLDLQQHFETLNHLFSQADLELNLNLTTDVALLDSIKQTLVRTDISRSDRQKLIMPLLAVLTGATTAEKKRQKAVVTEFAKALVGNKTKIDVLTLTDIDATEAKDWAFSLEENQDKLPGIEDRFSEVGQQIIDEVIRLYASVNLAQLIPEGKRFSQSMVEKYKRHGEDLKLLKAYIRSQSDAKRGRAIRATYDQYIDGVKSKQVTQEAFQKALGKFVDADVDLNSWAAQIKQAIDSEQFMPKLRTKQNGAIPYQVQQNELDQIISNQKEYYPWLGEENPVIKRRGKFPYKLDELVGFRVPYYVGPLITKEMQAATANAGFAWMVRKADGPITPWNFDDKVDRVASATAFIQRMQTTDTYLIGEEVLPARSLIYQRFMVLNELNNIRVDDGQLTPRQKQRLYNQVFKKHKRVTAKNIQDNLVAAREFPTAPRITGLADPKVFNSSLSTYHDLKQVLPEAMSDVRKQADIEKIILWSTIFEDSTIFKQKLTEISWLTAAQLKQLGQLRYRGWGQLSRKLLTGLKDDNNRSIMDGLWETNANFMQLRSQPAIENQIKSANQANLTTADLQDTINELYTSPQNKKAIREVMVVLADIKDAMHGQTPNWIFVEAARGGGVAGRRTQSRSKQIVAAYQGTAQAIVRDQVQRELKEKIKNKANFNTRLVLYFLQNGRDLYTGDAINIDRLSEYDIDHILPQSLVKDDSLDNRVLTNARINREKNDTFASEKFGKKMGAKWKEMHRMGLMTKRKLDHLLMRPDEISKYATGFINRQLVETRQVIKLVEELINAEYPSTAIVSVKANLTHQFRQTFDFPKIREVNDYHHAFDAALTAFIGTYLLKRYPKLERFFVYGKFAKQPVNLTRFNVIRKLAKTDTPITDIDTGEVLWDKLTDIKYFETLYDYKRLLVTREVSENYGAMFDQTLLKASDNGKRLIRKKQSFDTAIYGGYTGKTLAYMAIVKVSTKKDVQYQVVGVPTTMVTQIEQLEQQGMTNKQAVTKVIEPLIAANNKKMLTYEVLLPKVRFEQVVRDRIKGQTHRFALGTDTYYHNIQELYLPLTLQRAFLGKQNESEVQLNQNLLTVFDATLAQVNRYFPLYEMNKFKKILNSARDQIELLEAKNQFVKNKLVLGKQGILTNMFIGLHANASYGDLKVLGVKIDFGKLQVPGGIKLTGDAEIIYQSPTGLFERKIALKDL
>NZ_CP015966.1|WP_011100893.1|2423697_2424480_-|alpha/beta-hydrolase
MRFITSDHVQLDYTDEGQGQPIVILTGFGGAKDIWRAQIPVLIQAGYRVINLDGRCQGLSEHTAKGLRMSRRAVDAHELIEKLQLEQPILLGNSMGAATWFAYVSLYGDTGIKALIDVDQTPRMINTPHWQYGFKQVQWQDIPDYFRMPLGHSTFKHIDDATYARVKAVEAQAPFDAKLMFPLLVNHAVQDWRDVIRQLTVPFLIIAGAKSPFFNPDFAAVTAQMALRGQSVVIPEAGHIVMAEQSAAFNKALLEFLATC
>NZ_CP015966.1|WP_021357178.1|2424504_2425212_-|hypothetical-protein
MVKQGHYAKVSKQKRLRQLKQRRQAQEKRAIMPEMVSEFLQVRYHLTQAAKQRPVMRQMMQRFMAQWLAAGQAELSDNGQTTWSVVALTKQTLQTFNRQLPWQGYALVDQEMARWTAFLNKEVPAVPLSERITLTEALSPATWQACLSEQLAINALLALTGDSRQLGQITTEQVRQLQTSIQTATGIDWEKVAQLLDSTVIAQNTLSEAGLDDKTRQWLEKLKKLTPQDFNDHVE
>NZ_CP015966.1|WP_003641725.1|2425311_2426676_-|amino-acid-permease
MQRKLSTGQMQMIALGGTIGVGLFMGSSSTIKWTGPSVLIAYIVSGAFLYLIMRALGEMLYVDPNTGSFAKFASEYIHPVFGYLTAWSNIFQFVVVGMSEMIALGGYCRYWWPNLPDWIPGLIAIVFLCAANLISVKMFGTLETWFSLIKVVTIILMIIAGLGLIIFGIGNGGHPIGISNLWTHGGFFTGGVKGFVFALAIVLASYQGIELIGVTAGEAENPQSTIVKAIRSTVARILIFYVGAIFVIVSIYPWDKLSQIGSPFVQTFAKIGITAAASIINFVVITASLSGTNSGIYSASRMTYTLAESHQLPRKMTLLNRHGVPFYSVIAIATGILIGVVLNVVLPMFFKDASEIFVMVYSSSVLPGMVPWFVILVSQIAFRKQNAAKMANHPFKMPLSPYSNYLTLAFLALTLVFMFINPETRYSILVGVVFLVIMTLIYFRKYAGNKEETL
>NZ_CP015966.1|WP_021357176.1|2426908_2427379_+|NUDIX-hydrolase
MANYIKEIRALVGHKPIILNTAAGILVNDQQQILLNLRTDTHNWSLPGGYLEYGETYATACVREYKEDSGIDVEVVDRIGIFDKGETAYPNGDVAQTISALFLVKPIGGHVLTQATDETLKLDYFDFDNLPPLLNQQNADMIHAAQEYLQTHSATK
>NZ_CP015966.1|WP_003641722.1|2429329_2430070_-|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein
MVKPIIGIAPGVVTVNSQMFPGRVRDYVNRDYLKSVTDNGGVPLVLPVTTDATTIERYVGMIDGLLLCGGADVAPLTYGEEPQPKLGGVDPERDQYEIALIRATHAVGKPVLGICRGLQILNVCYGGNLYQDMSELPAGQGTLKHMQGQLAAYGMHHVKVVPGTTLAEYLGTTSDAITVNSFHHQAVKQVATGFQVVAQSADQVVEAIEATAGGLQLGVQWHPEMMQQVNSVQARLFAAFMRACVA
>NZ_CP015966.1|WP_015379633.1|2430151_2431351_-|putative-hydroxymethylpyrimidine-transporter-CytX
MKHDGIFRSQFLLWLGAAISIAEILTGTLMAPLGLTRGLAAIVLGHMIGCGLFLVPAGYLGAKLHQSALASAQLAFGRGGVLLASGLNALQLVGWTAVMIVNAQLAMNSISGKLFGFRSPLLMATIVAILIIAWLLMGSQLLFKINNAVVGLLVLGTVLMLVMVFMAPTTSQSVSTTSMTFGQAVELNVTMALSWLPLIGDYTQRVDRPLPVALVSAGGYMLGSLVMFVTGLLVVLRTGQTDITALLTRSGLGLVALLIIVFSTVTTTFLDTYSAATSLANLTGSRHVNRLAVGVTVVGLLIALTVAMTYYQNFLYLIGSVFTPLYAIIFVTYFVRHATLPYWLNFCWWVVGIVAYYQLQAIDFIGGTTLLVLVGLSIAVWLTGIIVKPTELEYRELSH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP015966_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015966_2

3034080-3034220

Orphan

Consensus_repeat	Method
GAGCAACCAAGTCAACCGGAAGAACCGGGTCAA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP015966_2

>merge|NZ_CP015966|2|3034080-3034220|CRISPRCasFinder
AAATCGGCAATCCAACCGGAAGAACCGGGTCAACCTGAGCAACCAAGTCAACCGGAAGAACCGGGTCAACCTGAGCAACCAAGTCAACCAGAAGAGCCGGGGCAACACGAGCAACCGAGTCAACCGGAAGAACCGGGTCAA

>NZ_CP015966|2|2|3034080-3034220|CRISPRCasFinder
AAATCGGCAATCCAACCGGAAGAACCGGGTCAA	CCTGAGCAACCAAGTCAACCG
GAAGAACCGGGTCAACCTGAGCAACCAAGTCAA	CCAGAAGAGCCGGGGCAACAC
GAGCAACCGAGTCAACCGGAAGAACCGGGTCAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015966.1\|WP_003642316.1\|3026041_3027529_+\|cell-surface-protein	unknown	unknown	gnl\|CDD\|375438
NZ_CP015966.1\|WP_080475231.1\|3043897_3044719_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP015966.1\|WP_015380914.1\|3042286_3043771_+\|glutamate/gamma-aminobutyrate-family-transporter-YjeM	unknown	unknown	gnl\|CDD\|237929
NZ_CP015966.1\|WP_011102025.1\|3025623_3026049_+\|cell-surface-protein	unknown	unknown	unknown
NZ_CP015966.1\|WP_015380915.1\|3035645_3037571_+\|copper-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319783
NZ_CP015966.1\|WP_003642310.1\|3034986_3035361_+\|cupredoxin-domain-containing-protein	unknown	unknown	gnl\|CDD\|226980
NZ_CP015966.1\|WP_015380921.1\|3022077_3023046_+\|zinc-binding-dehydrogenase	unknown	unknown	gnl\|CDD\|176215
NZ_CP015966.1\|WP_162936250.1\|3020929_3021562_+\|GyrI-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|227169
NZ_CP015966.1\|WP_003642303.1\|3041594_3041990_-\|transglycosylase	unknown	unknown	unknown
NZ_CP015966.1\|WP_064523645.1\|3037935_3039057_+\|NAD(P)-dependent-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176239
NZ_CP015966.1\|WP_003642314.1\|3029070_3029355_+\|TfoX/Sxy-family-protein	unknown	unknown	gnl\|CDD\|377439
NZ_CP015966.1\|WP_003644883.1\|3044875_3045301_+\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176863
NZ_CP015966.1\|WP_003642319.1\|3023770_3024475_+\|WxL-domain-containing-protein	unknown	unknown	gnl\|CDD\|372694
NZ_CP015966.1\|WP_003642299.1\|3045290_3045428_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015966.1\|WP_003642312.1\|3029685_3030447_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_CP015966.1\|WP_003642315.1\|3027786_3029067_+\|GHKL-domain-containing-protein	unknown	unknown	gnl\|CDD\|225827
NZ_CP015966.1\|WP_003644879.1\|3040126_3041299_-\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341467
NZ_CP015966.1\|WP_011102026.1\|3024531_3025596_+\|DUF916-and-DUF3324-domain-containing-protein	unknown	unknown	gnl\|CDD\|368712
NZ_CP015966.1\|WP_015380916.1\|3035376_3035646_+\|cupredoxin-domain-containing-protein	unknown	unknown	gnl\|CDD\|379208
NZ_CP015966.1\|WP_013355922.1\|3021657_3022053_+\|iron-sulfur-cluster-biosynthesis-family-protein	unknown	unknown	gnl\|CDD\|366687

Protein	Function_ID	Function_description	E-value
NZ_CP015966.1\|WP_003642316.1\|3026041_3027529_+\|cell-surface-protein	gnl\|CDD\|375438	pfam17936, Big_6, Bacterial Ig domain. This domain is found in a wide variety of extracellular bacterial proteins often in multiple tandem copies.	0.00941488
NZ_CP015966.1\|WP_080475231.1\|3043897_3044719_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.65267e-09
NZ_CP015966.1\|WP_015380914.1\|3042286_3043771_+\|glutamate/gamma-aminobutyrate-family-transporter-YjeM	gnl\|CDD\|237929	PRK15238, PRK15238, inner membrane transporter YjeM; Provisional.	0
NZ_CP015966.1\|WP_015380915.1\|3035645_3037571_+\|copper-translocating-P-type-ATPase	gnl\|CDD\|319783	cd02094, P-type_ATPase_Cu-like, P-type heavy metal-transporting ATPase, similar to human copper-transporting ATPases, ATP7A and ATP7B. The mammalian copper-transporting P-type ATPases, ATP7A and ATP7B are key molecules required for the regulation and maintenance of copper homeostasis. Menkes and Wilson diseases are caused by mutation in ATP7A and ATP7B respectively. This subfamily includes other copper-transporting ATPases such as: Bacillus subtilis CopA , Archeaoglobus fulgidus CopA, and Saccharomyces cerevisiae Ccc2p. This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP015966.1\|WP_003642310.1\|3034986_3035361_+\|cupredoxin-domain-containing-protein	gnl\|CDD\|226980	COG4633, COG4633, Plastocyanin domain containing protein [General function prediction only].	1.52584e-33
NZ_CP015966.1\|WP_015380921.1\|3022077_3023046_+\|zinc-binding-dehydrogenase	gnl\|CDD\|176215	cd08253, zeta_crystallin, Zeta-crystallin with NADP-dependent quinone reductase activity (QOR). Zeta-crystallin is a eye lens protein with NADP-dependent quinone reductase activity (QOR). It has been cited as a structural component in mammalian eyes, but also has homology to quinone reductases in unrelated species. QOR catalyzes the conversion of a quinone and NAD(P)H to a hydroquinone and NAD(P+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H)-binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	3.40416e-66
NZ_CP015966.1\|WP_162936250.1\|3020929_3021562_+\|GyrI-like-domain-containing-protein	gnl\|CDD\|227169	COG4832, COG4832, Uncharacterized conserved protein [Function unknown].	1.31385e-58
NZ_CP015966.1\|WP_064523645.1\|3037935_3039057_+\|NAD(P)-dependent-alcohol-dehydrogenase	gnl\|CDD\|176239	cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydrogenase. Benzyl alcohol dehydrogenase is similar to liver alcohol dehydrogenase, but has some amino acid substitutions near the active site, which may determine the enzyme's specificity of oxidizing aromatic substrates. Also known as aryl-alcohol dehydrogenases, they catalyze the conversion of an aromatic alcohol + NAD+ to an aromatic aldehyde + NADH + H+. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	0
NZ_CP015966.1\|WP_003642314.1\|3029070_3029355_+\|TfoX/Sxy-family-protein	gnl\|CDD\|377439	pfam04994, TfoX_C, TfoX C-terminal domain. TfoX may play a key role in the development of genetic competence by regulating the expression of late competence-specific genes. This family corresponds to the C-terminal presumed domain of TfoX. The domain is found associated with pfam00383 in Neisseria meningitidis TadA. It is also found as an isolated domain in some proteins suggesting this is an autonomous domain.	1.71819e-21
NZ_CP015966.1\|WP_003644883.1\|3044875_3045301_+\|SRPBCC-family-protein	gnl\|CDD\|176863	cd07821, PYR_PYL_RCAR_like, Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins. The PYR/PYL/RCAR-like family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. PYR/PYL/RCAR plant proteins are receptors involved in signal transduction. They bind abscisic acid (ABA) and mediate its signaling. ABA is a vital plant hormone, which regulates plant growth, development, and response to environmental stresses. Upon binding ABA, these plant proteins interact with a type 2C protein phosphatase (PP2C), such as ABI1 and ABI2, and inhibit their activity. When ABA is bound, a loop (designated the gate/CL2 loop) closes over the ligand binding pocket, resulting in the weakening of the inactive PYL dimer and facilitating type 2C protein phosphatase binding. In the ABA:PYL1:ABI1 complex, the gate blocks substrate access to the phosphatase active site. A conserved Trp from PP2C inserts into PYL to lock the receptor in a closed formation. This group also contains Methylobacterium extorquens AM1 MxaD. The mxaD gene is located within the mxaFJGIR(S)ACKLDEHB cluster which encodes proteins involved in methanol oxidation. MxaD may participate in the periplasmic electron transport chain for oxidation of methanol. Mutants lacking MxaD exhibit a reduced growth on methanol, and a lower rate of respiration with methanol.	0.000351798
NZ_CP015966.1\|WP_003642319.1\|3023770_3024475_+\|WxL-domain-containing-protein	gnl\|CDD\|372694	pfam13731, WxL, WxL domain surface cell wall-binding. The WxL motif appears in two or three copies in these bacterial proteins and confers a cell surface localization function. It seems likely that this region is the cell wall-binding domain of gram-positive bacteria, and may interact with the peptidoglycan.	1.74207e-32
NZ_CP015966.1\|WP_003642312.1\|3029685_3030447_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	5.00029e-17
NZ_CP015966.1\|WP_003642315.1\|3027786_3029067_+\|GHKL-domain-containing-protein	gnl\|CDD\|225827	COG3290, CitA, Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms].	5.87556e-09
NZ_CP015966.1\|WP_003644879.1\|3040126_3041299_-\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341467	cd08188, PDDH, 1,3-Propanediol (1,3-PD) dehydrogenase. This family includes 1,3-propanediol (1,3-PD) dehydrogenase, a key enzyme in the microbial production of 1,3-PD that has been previously characterized as the product of dhaT gene in Klebsiella pneumoniae. 1,3-PD dehydrogenase is a member of the family III metal-dependent polyol dehydrogenases, which are shown to require a divalent metal ion for catalysis. However, some members of this family showed a dependence on Fe(2+) or Zn(2+) for activity.	0
NZ_CP015966.1\|WP_011102026.1\|3024531_3025596_+\|DUF916-and-DUF3324-domain-containing-protein	gnl\|CDD\|368712	pfam06030, DUF916, Bacterial protein of unknown function (DUF916). This family consists of several hypothetical bacterial proteins of unknown function.	1.17785e-47
NZ_CP015966.1\|WP_015380916.1\|3035376_3035646_+\|cupredoxin-domain-containing-protein	gnl\|CDD\|379208	pfam13473, Cupredoxin_1, Cupredoxin-like domain. The cupredoxin-like fold consists of a beta-sandwich with 7 strands in 2 beta-sheets, which is arranged in a Greek-key beta-barrel.	3.9659e-20
NZ_CP015966.1\|WP_013355922.1\|3021657_3022053_+\|iron-sulfur-cluster-biosynthesis-family-protein	gnl\|CDD\|366687	pfam01521, Fe-S_biosyn, Iron-sulphur cluster biosynthesis. This family is involved in iron-sulphur cluster biosynthesis. Its members include proteins that are involved in nitrogen fixation such as the HesB and HesB-like proteins.	3.55441e-20

>NZ_CP015966.1|WP_003642312.1|3029685_3030447_+|helix-turn-helix-transcriptional-regulator
MGTELQFVQYLHQMRDYNDQHPTTKGLILLGYLERDFIRFYRAGKIEEGIQFAKKNLTRSRDLLNKLSSEEKQLQLSALVDVLAFEGIQNHAEIYEFVKLRNDYHRWLVKLPVTTERYQPLVVQIIRDFAAIAKPNALAYNAHLESTLDVMYYTNAHLHDQLSVKKVLAHVNARCNPESVRRSFSQEMHMSIRDYINAKKIQEAEHMLLATDLTIRAIAAELCFYDAADFSKRFKKETGQTPLEFRQLNTRTD
>NZ_CP015966.1|WP_003642314.1|3029070_3029355_+|TfoX/Sxy-family-protein
MIMNRKDLNLVALLTTLPNIGPTLAKQLQAVAITTPEQLKSTGSKVAFTAIKKANPHACIQLLYSLQGAIENCAYPQLSPATREDLKQFFRSLL
>NZ_CP015966.1|WP_003642315.1|3027786_3029067_+|GHKL-domain-containing-protein
MLFLMIGFREYVTWRIAIIWLSLVIITMSLGEVASNLWPQVPLAYFWIIPIVCVTTFMSSRLLYTQWILMLPVAIFLNALKRLVGAIMGVIAKAVAQSASPMLLRQAIGLHSTADINLFLASIMMLPVIIILGMLAHRWLVQVSAADFLQRARVNISDYLLVILFFAIYIIAYVFAMEWSVNAQTYMAIAAIVTFGIIGSYLISNKNSHLNDAQLLLQVSNYNELLSHHNRDLHLFKHDYENILLSMSAFIQNNDMAGLKRYFTTEVMPARVTLNRQSGLSDLSRLDMPTVSGLIYAKYEAANGQNVHLVVTILEKVTLADIPQIKVVRILGNLLDNATDAAARANHQVALTVKNRDAHTTVFSITNQIPTHEAVDLSVIKKSRFTTKPGHLGYGLSSIEQLTTDQLVVNYCIEEGNFIAELIIKH
>NZ_CP015966.1|WP_003642316.1|3026041_3027529_+|cell-surface-protein
MRNRRVKWLLILVFGILGLLNLLPLEGNAATLTSKMTDVKANAAFQAVPGGNSVGSNVDNGLQAYPALGNVSANYADNGRITRQTTQITMTMTGSITLKSSNSMSKAYFDIMAGPASGSYTGATLVTATPTSLGSGNSIMISSSKQTQTLSVNFQNIKSELPIYIGFRITVNGEEGTYQLGRFNAQTLSPKITGTLYSTDTTIKGTGTPGNTISSNVNGVTTTVGSDGTYTLNLGTALGTLSNVTVTEVDEITGDKGTATAAVTLKKLNITSSKTAVDLYPGDLDSLTSDSAVVAWLVKQAGIVATNPDSATDTITYAADETSLASKLSSLAVGSSTTINIYGKGSSGLKSDAKAITVTMRDGTLSLGTLPASLTFGTLTIPFKETLYQPTNAWNITVNDTRKTGSQWYLRATATAMKSSTRTMSGNLIYLNAGNKQVLTNTSVTVSSGKKIAGTTSTNAASGWSSSQGILLDVQPSVQIDSYSGTINWTLQDTP
>NZ_CP015966.1|WP_011102025.1|3025623_3026049_+|cell-surface-protein
MPNKWWRLILGVMLVLSWAIPVRAATHGRTEISVGFYETKYSADRIIPARVIPDGGHPYVIRPADPGTQGQRNQSERKPIRRQLIIDGWLRGQSRNGQQLPQTSERLVIGSILGGMGLLASVLAGALYRILKRQDGGERNA
>NZ_CP015966.1|WP_011102026.1|3024531_3025596_+|DUF916-and-DUF3324-domain-containing-protein
MQLLKRIMVIVGTLILGLQVSSVSGLAASNASSSSSKTTQSNDIGFSVAAKIPNNQIDQHNSYFDLKMTRGRQQQIQTTIYNVTNADIKVQTAIHTAYTNGNGIIEYVTPTKSYDPSLKYRMDQITKIQGPTTITIPANGSKVVTATVTMPKQAVNGVILGGWYFKRVANKVTGSVKGSMNIANQYSYVIGLKYTAGIVPQPQLKLDTITAGMQNYRRGVFPQLRNVTAVIVPKLTITARLTSKNSGKVIKNFTQKNVQLAPNSVYKVPILTGTNRLQAGSYHVRLVAKNTDHRWVFDKDFVISTAAADKYNQASVDDSGMSVGWFILFGALGMLIIGLIGLLIFFWIKKRRRA
>NZ_CP015966.1|WP_003642319.1|3023770_3024475_+|WxL-domain-containing-protein
MKPMLGHLLMAGTLLLAGSTPIVANAAENRSGNTDIKAEFTKSTSTVTPVDPSNPDVPSTDGDGDNGAAAGGDLSLIFVSKSLGYGTHELDVLNDQQYKVDPTSSYTLLWQDKMVVEVSDVRGTNAGWKLTVTGSNLTGTDGTAAKGATLSLPKGDVVNSGSEANGAVATASEVALNGTVGSSAVLNADKGGGSGVTVSRLDPKALTLNIKANTVKAQAYSANLNWTLSDLPTN
>NZ_CP015966.1|WP_015380921.1|3022077_3023046_+|zinc-binding-dehydrogenase
MKSVIFDDFGSPDVLRIADVQRPVATTATVLVKVMAVAVNHVDTFVRSGAFKTALAAPHVAGRDLVGEVVASSQPDFQIGDQVWTNSMGYEGRMGATAEYVAVPTDRLYHVPDGVAPMPLVAAVHSAATAAIVLNDVMEIRRGQTLLIEGAAGNVGRKLIQLAHQMGVTAVITASPRDFARCQQLGSTACYDYHAGFADQLTTDQWTFDHVIDTSGRVPLAINLALLRLGGQVTLITAPQDNQFEFPVRQFYMSQQRITGFVISHATVDQLAQAASRLNRAFSAGLLLDDQVSQRYFKDAAQCHAQLEAGTDHHQRFVLLPS
>NZ_CP015966.1|WP_013355922.1|3021657_3022053_+|iron-sulfur-cluster-biosynthesis-family-protein
MTQIEISDRLKALLVAKGFDKKQLVLVTDDGGGKYSLHGGACSIGTKFTIIVLDQPDPEYNVTVVNDQGLALWTSTYDLIFFNDGIKMDYDQGRIAIKDNAHMLDNAVQIAKGAEVLAAFEQGVPADNLTC
>NZ_CP015966.1|WP_162936250.1|3020929_3021562_+|GyrI-like-domain-containing-protein
MKMKYEWCKQEKTTYATKKQPQLLTIPAQTFMSIHGTGNPNGPEFQTHLQTLYPAAYGLKHAYKQYAQTQACEFDDYVVFPLEGVWSLTIKGQQLDHLDKDEFSYDIMIRVPDFVPNELIAPALAAVKAKKQLPTEQINVQQFDAMQVAQILHLGAYDDEPASFAKIDELVANQGMHRTSKIHREIYLSDARRVAPDKLKTILRYRVASN
>NZ_CP015966.1|WP_003642310.1|3034986_3035361_+|cupredoxin-domain-containing-protein
MMIKVLVLLIGGLAIGFILWWFFGKHATTTVTASAVDDLQQVDVEVKGGYSPEQIVLKKGVPAVLNFTRKDASGCLDHVVFSDFGINQELPQNQVEAITIDTSKSGEYQWACGMDMFHGKLIIK
>NZ_CP015966.1|WP_015380916.1|3035376_3035646_+|cupredoxin-domain-containing-protein
MSARQQINITVDGHYDPAEVTLQQGVPAQLTFTRTSTQGCLEQVHSTDLHFTTELPLDQPQTVTVPTDRAGEFHFSCGMDMVSGKVVIA
>NZ_CP015966.1|WP_015380915.1|3035645_3037571_+|copper-translocating-P-type-ATPase
MSTTKRFWISLIFSLPLLANMILMPFGWMLPGGDWTQLILTTIIMAVSARPFLQSSWASFTKHHANMDTLVAIGTATAYFYSLYAMATGQAVFFESAALVTTFVLLGQVFEERMRHNASSAVAKLVGLQAKEAEVLRNQEFVKVPLDQVVVGDIIRVKPGEKIPVDGVITTGRSTVDESMVTGESMPVQKTVADAVIGSTINSNGTFQFKASKVGDQTMLAQIVELVKKAQNSHAPIQKLTDKVSDIFVPIVLIIAIVTFLTWYVFLNASLANALIFAVAVVVIACPCALGLATPTALMVGTGRGAKMGILIKNGEVLEAVNDVKTVIFDKTGTITVGHPQVTDVIGDEAQVLRVATSLEAASEHPLAAAILKRGTARGIQAPTATNFQAIEGKGVTAQVEGQLAVVGNHKLLTDEPISAELQRQATELQDAAKTVVYVGLNHEIIGLIAIQDVAKSTSEVAIASLKARGLKTVMLTGDNERVAQAVADQVGIDEVIADVLPGDKADHVHAFQKAGKVAFVGDGINDAPALTTADVGIAMGSGTDIAIDAGGIVLVKNDLRDVDRALALSKKTFNRIKLNLFWAFVYNVLGIPVAAGLFFAIGLTLSPELAGLAMAFSSLSVVTSSVLLNKAKISSNAQPA
>NZ_CP015966.1|WP_064523645.1|3037935_3039057_+|NAD(P)-dependent-alcohol-dehydrogenase
MKIKAAVVDKVNDPFVIKDDIELAEMKATDLQIKMVATGICHSDEAIRRGDASLGYPVILGHEGSGIVEKVGSEVTNFEVGDHVILSFYADGTCDNCLKGMPTKCRNYADYNLSGTRPDGSDHFQENGHHISDMFDQSSFTTHTVVDQRNAVKVPKELDLRRLGPLGCGYVTGSGTVLNSLQPRPGQTIAVFGTGAVGLAAMMAGKISGCTEVIAVDIVDSRLELAKELGATHAINSKKEDPVEAIKKLTHGYGVDFAVDTTGVEPVMVSAIHALAQGGTAALIAVTAKNITISSWNDLCVDDKKVIGVNMGDAIPGVDIPRLIDFYQHGMFPFEKTEKFYKFEDINQANADSGSGKTIKPVLIIDEDYQPGK
>NZ_CP015966.1|WP_003644879.1|3040126_3041299_-|iron-containing-alcohol-dehydrogenase
MTERNFDFLMPSVNFFGPGVISKIGERAKTLGMHKPVIVTDKFLESLPDGAVAQVRRSLDAAGIDYVIYNQVEPNPKIHNIQAVKALYQANQADSLITIGGGSAHDTGKGAGIIMTNGDDITKLAGIETLKNALPPLIAVNTTAGTGSELTRHCVITNEETHYKFVVASWRNMPLVSFNDPTLMLDVPKGLTAATGMDAFVQAIEPFVSVDHNPITDSQCIQAIKLIETSLREAVANGHNLEARTHMVEAEMLAGMAFNNANLGYVHAMAHQLGGQYDAPHGVCCALLLPYVEEYNLIACPERFAELAKIMGENTDGLSTRDAAELAIKAMKQLSEDVGIPHSIKEIGAKIEDFEHMATNALKDGNAFSNPRKGTKEDIIKIFQAAYDAK
>NZ_CP015966.1|WP_003642303.1|3041594_3041990_-|transglycosylase
MKKFNFKTMLLLVLASCVFGVVVNVTTSLGPQTTITAQASKKLSQAQQIAKINAKLSKANRAAKNWIAYRESGYSYTARNGRCYGRYQLLRSYLHGNLSPVNQEKRANTYVASRYGSWVKAKRFWQHHHWY
>NZ_CP015966.1|WP_015380914.1|3042286_3043771_+|glutamate/gamma-aminobutyrate-family-transporter-YjeM
MATKDNEKITLMALVMMIFTTVFGFANSTVAYYLMGYSSILFYLVAAVLFFIPFALMMAEFGAAVKSDSSGMYKWLEVSVNAKFAFVGTFMWFASYIIWLVSTSAKVWIPFTTIFFGSDQTQRFAMFGLNATQMIGILSCLWMVLVTFVSIKGMKGIVRVTSLGGLAVTSLTAILLVVSGVVLALNHGQFAQPLQHVMTSPNPSYQHPVGLLGFAVFAIFAYGGLEVLGGMVDKTKNPEKTFPRGIIISAIVITLGYGLGIFCWGISTNWQAVLSNPTTNLGNISYVMMQNLGYVLGQALGLSTAAAKTMGLWFARYTGLGMFLAYSGAFFTLTYSPLKTLILGTPKELWPKKFTKLNKAGMPSYAMMVQCAIVIVIILVASFATADASAFYNVLTLMANVSMTLPYLFLLYAFPKFKENQNIVKPFEVYKSLAWTKIISWVVFIVVLGANVFTLIQPILETGQIQNTIWMLVGPIVFGVAGIIWYQVRERHVN
>NZ_CP015966.1|WP_080475231.1|3043897_3044719_+|helix-turn-helix-transcriptional-regulator
MTLGTALKQARKAKQLNQKQAARGICAQSMLSAIENDRYVPNARLLLALCQRLGVAVSTLSLADDFEISAEQAFNDRVRQMCNAHQYQQLKDWLLQPTTLEHVQTDEQTQAYYYYLGVACWQVDRTSDAAQQNLRLAIGMAAPSSPPTTLTRLALISLAVVKAHHHPQVPVAALVTRALADIDASAYEENANIVFYLAGLVAYEQHDSQLAVARLTQGLAFATTHDSHYMLANIYQLMAQLAMAAGETATAQVASQRSQVFKDLFKEQINDRL
>NZ_CP015966.1|WP_003644883.1|3044875_3045301_+|SRPBCC-family-protein
MTTALFTNQVLTQATPATVRALLADPLNLPAWATAITTVKPTATGYVLQRSGSAFDQPEQLQVTVGADQVVYHSEGGQLGYEIVFTMTPLAERTAVQEEVSLTTTPPSWLPLPLVKPVMQRDFQRKLGQLATLAEEQPNDD
>NZ_CP015966.1|WP_003642299.1|3045290_3045428_+|hypothetical-protein
MTINDGMTLIKVLVTWWSVSWLLRATLIGVVGIIAYRFLKQRQFK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP015966_1	1.2\|2416857\|30\|NZ_CP015966\|CRT,PILER-CR,CRISPRCasFinder	2416857-2416886	30	JX486087	Lactobacillus phage ATCC 8014-B1, complete genome	790-819	1	0.967
NZ_CP015966_1	1.2\|2416857\|30\|NZ_CP015966\|CRT,PILER-CR,CRISPRCasFinder	2416857-2416886	30	JN051154	Pediococcus phage clP1, complete genome	6473-6502	1	0.967
NZ_CP015966_1	1.6\|2417121\|30\|NZ_CP015966\|CRT,PILER-CR,CRISPRCasFinder	2417121-2417150	30	NZ_CP015089	Pelagibaca abyssi strain JLT2014 plasmid pPABY5, complete sequence	37190-37219	7	0.767
NZ_CP015966_1	1.5\|2417055\|30\|NZ_CP015966\|CRT,PILER-CR,CRISPRCasFinder	2417055-2417084	30	NZ_CP040048	Acinetobacter baumannii strain VB1190 plasmid unnamed1, complete sequence	611914-611943	8	0.733
NZ_CP015966_1	1.5\|2417055\|30\|NZ_CP015966\|CRT,PILER-CR,CRISPRCasFinder	2417055-2417084	30	MK721187	Enterococcus phage vB_EfaS_Ef6.1, complete genome	161-190	8	0.733

1. spacer 1.2|2416857|30|NZ_CP015966|CRT,PILER-CR,CRISPRCasFinder matches to JX486087 (Lactobacillus phage ATCC 8014-B1, complete genome) position: , mismatch: 1, identity: 0.967

cgtaaataggttgtaaacgttcaggtctga	CRISPR spacer
cgtgaataggttgtaaacgttcaggtctga	Protospacer
***.**************************

2. spacer 1.2|2416857|30|NZ_CP015966|CRT,PILER-CR,CRISPRCasFinder matches to JN051154 (Pediococcus phage clP1, complete genome) position: , mismatch: 1, identity: 0.967

cgtaaataggttgtaaacgttcaggtctga	CRISPR spacer
cgtgaataggttgtaaacgttcaggtctga	Protospacer
***.**************************

3. spacer 1.6|2417121|30|NZ_CP015966|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP015089 (Pelagibaca abyssi strain JLT2014 plasmid pPABY5, complete sequence) position: , mismatch: 7, identity: 0.767

aagcgcgggatcacgtgcaacagcaccatc	CRISPR spacer
aagcgcgggatcacctggaacagctcggag	Protospacer
************** ** ****** * .

4. spacer 1.5|2417055|30|NZ_CP015966|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP040048 (Acinetobacter baumannii strain VB1190 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

gtttggactggtttatcaagcaacaagttg	CRISPR spacer
tggtggacaggtttatcaagcaacaaagat	Protospacer
   ***** *****************.

5. spacer 1.5|2417055|30|NZ_CP015966|CRT,PILER-CR,CRISPRCasFinder matches to MK721187 (Enterococcus phage vB_EfaS_Ef6.1, complete genome) position: , mismatch: 8, identity: 0.733

gtttggactggtttatcaagcaacaagttg	CRISPR spacer
atcaaaactggtttctcaaacaacaagttt	Protospacer
.*. ..******** ****.*********

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

294015 : 350538

Lactobacillus_phage(40.0%)

terminase,portal,transposase,integrase,capsid

attL 326823:326840|attR 336596:336613

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086989537.1\|294015_294791_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
WP_027822673.1\|295004_296195_-	GGDEF domain-containing protein	NA	NA	NA	NA
WP_064522715.1\|296418_296649_+	hypothetical protein	NA	NA	NA	NA
WP_003642742.1\|296674_296896_+	hypothetical protein	NA	NA	NA	NA
WP_015380658.1\|297042_297507_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_015380657.1\|297728_298622_+	C40 family peptidase	NA	NA	NA	NA
WP_015380656.1\|298688_299552_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003642746.1\|300113_300278_+	hypothetical protein	NA	NA	NA	NA
WP_003642747.1\|300336_301080_+	NUDIX hydrolase	NA	NA	NA	NA
WP_064522716.1\|301185_302373_+	MFS transporter	NA	NA	NA	NA
WP_003644671.1\|302586_302904_+	hypothetical protein	NA	NA	NA	NA
WP_003642750.1\|302979_303540_+	ECF transporter S component	NA	NA	NA	NA
WP_064522717.1\|304295_305234_-	EamA family transporter	NA	NA	NA	NA
WP_015380652.1\|305430_305700_+	ACT domain-containing protein	NA	NA	NA	NA
WP_003642754.1\|305709_307053_+	PFL family protein	NA	NA	NA	NA
WP_003646617.1\|307425_308154_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.1e-34	37.1
WP_003642756.1\|308150_309674_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_011101808.1\|309969_311151_+	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	3.9e-46	29.9
WP_003642758.1\|311385_312243_+	GRP family sugar transporter	NA	NA	NA	NA
WP_064522719.1\|312463_313816_+	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_064522721.1\|314241_314448_+	hypothetical protein	NA	NA	NA	NA
WP_064522722.1\|314835_316830_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	7.2e-32	41.3
WP_003642762.1\|316847_318425_+	glycosyltransferase	NA	NA	NA	NA
WP_015380648.1\|318396_320160_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.8e-96	40.9
WP_003639252.1\|321100_321244_+	hypothetical protein	NA	NA	NA	NA
WP_011101805.1\|321602_321746_+	hypothetical protein	NA	NA	NA	NA
WP_064522725.1\|322433_325367_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_003642770.1\|325466_327443_+	hypothetical protein	NA	NA	NA	NA
326823:326840	attL	NA	NA	NA	NA
WP_003642771.1\|327497_327983_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_015380646.1\|328030_328303_-	hypothetical protein	NA	NA	NA	NA
WP_003642773.1\|328327_328561_-	hypothetical protein	NA	NA	NA	NA
WP_015380645.1\|328973_329180_+	hypothetical protein	NA	NA	NA	NA
WP_064522727.1\|329530_330652_-\|integrase	site-specific integrase	D6PSS4	Lactobacillus_phage	9.9e-47	32.4
WP_064522729.1\|330900_332094_-	hypothetical protein	A0A141E0C6	Streptococcus_phage	5.4e-19	25.9
WP_080444026.1\|332255_332432_-	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	3.3e-10	51.7
WP_063489221.1\|332713_333415_-	DUF3862 domain-containing protein	A0A0P0IXE0	Lactobacillus_phage	2.0e-05	80.8
WP_003642782.1\|333522_333777_-	hypothetical protein	NA	NA	NA	NA
WP_053566834.1\|333786_334578_-	hypothetical protein	NA	NA	NA	NA
WP_120787351.1\|335049_335748_-	hypothetical protein	NA	NA	NA	NA
WP_162936253.1\|335932_336856_-	DUF5067 domain-containing protein	NA	NA	NA	NA
336596:336613	attR	NA	NA	NA	NA
WP_063204181.1\|336956_337379_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_064522735.1\|337393_337912_-	helix-turn-helix domain-containing protein	S6C481	Thermus_phage	1.6e-15	34.1
WP_064522737.1\|338053_338242_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_187337861.1\|338383_339136_+	PD-(D/E)XK nuclease-like domain-containing protein	A0A0P0IZH9	Lactobacillus_phage	3.8e-71	50.2
WP_064522741.1\|339216_340125_+	DnaD domain protein	NA	NA	NA	NA
WP_003642800.1\|340121_340409_+	hypothetical protein	NA	NA	NA	NA
WP_015380627.1\|340405_340924_+	hypothetical protein	O03915	Lactobacillus_phage	3.5e-55	68.4
WP_013355743.1\|340920_341301_+	endodeoxyribonuclease	NA	NA	NA	NA
WP_003642805.1\|341511_341973_+	transcriptional regulator	D6PSV8	Lactobacillus_phage	1.1e-39	57.0
WP_015380625.1\|342237_342855_-	hypothetical protein	NA	NA	NA	NA
WP_015380624.1\|343750_343948_+	hypothetical protein	NA	NA	NA	NA
WP_072533559.1\|343925_344102_+	hypothetical protein	E9LUP6	Lactobacillus_phage	9.1e-08	57.4
WP_064522742.1\|344070_344328_+	hypothetical protein	A0A0N9SKC5	Staphylococcus_phage	1.3e-15	47.6
WP_064522744.1\|344381_344921_+\|terminase	terminase small subunit	O03926	Lactobacillus_phage	1.0e-49	75.3
WP_064522746.1\|344901_346227_+\|terminase	PBSX family phage terminase large subunit	A0A1S5SA45	Streptococcus_phage	4.5e-139	55.7
WP_129075458.1\|346229_347825_+\|portal	phage portal protein	B5LPR1	Bacillus_virus	9.0e-86	37.8
WP_129075459.1\|347805_348012_+	hypothetical protein	NA	NA	NA	NA
WP_064522752.1\|348044_348902_+	hypothetical protein	A0A1B1P858	Bacillus_phage	2.1e-36	35.3
WP_064522753.1\|348965_349577_+	hypothetical protein	NA	NA	NA	NA
WP_064522755.1\|349590_350538_+\|capsid	N4-gp56 family major capsid protein	A8ASJ6	Listeria_phage	4.4e-88	59.1

DBSCAN-SWA_2

360910 : 368542

Lactobacillus_phage(66.67%)

tail,holin,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_064522772.1\|360910_362038_+\|tail	phage tail protein	O03938	Lactobacillus_phage	3.1e-72	42.0
WP_064522774.1\|362030_362279_+	hypothetical protein	NA	NA	NA	NA
WP_064522776.1\|362253_362607_+	hypothetical protein	NA	NA	NA	NA
WP_064523719.1\|363103_363907_+	SGNH/GDSL hydrolase family protein	Q597U1	Lactobacillus_virus	1.4e-127	84.3
WP_064522778.1\|363920_364475_+\|plate	phage baseplate upper protein	O03968	Lactobacillus_phage	4.9e-55	61.8
WP_129075460.1\|364501_366307_+	hypothetical protein	Q597U3	Lactobacillus_virus	1.3e-184	54.0
WP_064522782.1\|366318_366588_+	hypothetical protein	NA	NA	NA	NA
WP_080475200.1\|366580_366712_+	XkdX family protein	NA	NA	NA	NA
WP_015380597.1\|367881_368178_+	hypothetical protein	A0A1I9KK55	Lactobacillus_phage	1.2e-39	77.6
WP_064522784.1\|368164_368542_+\|holin	holin	A0A2K9VCG4	Lactobacillus_phage	4.1e-21	77.5

DBSCAN-SWA_3

658839 : 695539

Lactobacillus_phage(92.68%)

terminase,portal,tail,protease,head,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_043992828.1\|658839_659040_-	hypothetical protein	E9LUS6	Lactobacillus_phage	5.5e-25	97.0
WP_015380507.1\|659221_659920_-	hypothetical protein	Q9AZW5	Lactococcus_phage	2.1e-18	36.8
WP_027822123.1\|659928_660315_-	hypothetical protein	NA	NA	NA	NA
WP_015380505.1\|660372_660651_-	hypothetical protein	D2KRD5	Lactobacillus_phage	1.3e-21	59.3
WP_043992826.1\|660660_660999_-	helix-turn-helix transcriptional regulator	Q8W5Y0	Listeria_phage	1.0e-15	42.2
WP_015380504.1\|661244_661466_+	hypothetical protein	NA	NA	NA	NA
WP_043992824.1\|661480_662179_+	Rha family transcriptional regulator	D2IYT0	Enterococcus_phage	6.7e-70	62.2
WP_064522839.1\|662190_662400_+	hypothetical protein	NA	NA	NA	NA
WP_015380501.1\|662515_662842_-	hypothetical protein	E9LUT2	Lactobacillus_phage	2.7e-53	98.1
WP_015380500.1\|662899_663160_+	hypothetical protein	NA	NA	NA	NA
WP_015380499.1\|663302_663551_+	hypothetical protein	E9LUT6	Lactobacillus_phage	1.9e-35	84.1
WP_015380498.1\|663553_663754_+	hypothetical protein	E9LUT7	Lactobacillus_phage	1.7e-26	89.4
WP_043992823.1\|663765_663990_+	hypothetical protein	E9LUT8	Lactobacillus_phage	1.2e-28	86.3
WP_162936256.1\|664038_664209_+	hypothetical protein	NA	NA	NA	NA
WP_043992822.1\|664208_664466_+	hypothetical protein	NA	NA	NA	NA
WP_015380497.1\|664570_665374_+	hypothetical protein	E9LUM6	Lactobacillus_phage	6.4e-40	56.9
WP_043992819.1\|665367_666243_+	ATP-binding protein	A0A0P0I3L9	Lactobacillus_phage	2.2e-49	41.6
WP_064522840.1\|666705_667017_+	hypothetical protein	A0A2P0ZLB4	Lactobacillus_phage	3.0e-46	87.4
WP_162936257.1\|667127_667718_+	hypothetical protein	E9LUN9	Lactobacillus_phage	5.2e-63	94.2
WP_043992815.1\|667978_668380_+	hypothetical protein	K4I239	Lactobacillus_phage	5.5e-32	54.5
WP_015380491.1\|668452_668878_+	DUF1642 domain-containing protein	E9LUP3	Lactobacillus_phage	2.2e-39	61.7
WP_064522842.1\|668880_669330_+	hypothetical protein	A0A2K9VC44	Lactobacillus_phage	1.1e-41	65.3
WP_015380489.1\|669380_669809_+	phage transcriptional activator RinA	E9LUP5	Lactobacillus_phage	1.1e-65	86.5
WP_015380487.1\|670142_670322_+	hypothetical protein	E9LUP6	Lactobacillus_phage	3.1e-19	86.4
WP_015380486.1\|670332_670800_+	HNH endonuclease	E9LUP7	Lactobacillus_phage	2.0e-78	91.5
WP_064522844.1\|670996_671452_+\|terminase	phage terminase small subunit P27 family	E9LUP8	Lactobacillus_phage	9.4e-81	97.4
WP_015380483.1\|673348_673543_+	DUF1056 family protein	E9LUQ0	Lactobacillus_phage	3.7e-26	93.8
WP_015380482.1\|673545_674739_+\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	3.1e-224	98.7
WP_015380481.1\|674716_675472_+\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	3.9e-124	93.2
WP_015380480.1\|675471_676704_+\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	4.3e-213	94.1
WP_015380479.1\|676776_677115_+\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	5.8e-51	91.1
WP_015380478.1\|677098_677461_+\|head	phage head closure protein	E9LUQ5	Lactobacillus_phage	6.4e-64	97.5
WP_015380477.1\|677450_677891_+	hypothetical protein	E9LUQ6	Lactobacillus_phage	4.2e-78	97.9
WP_015380476.1\|677887_678271_+	DUF806 family protein	E9LUQ7	Lactobacillus_phage	1.0e-64	96.9
WP_015380475.1\|678271_678910_+\|tail	phage tail protein	E9LUQ8	Lactobacillus_phage	1.4e-109	93.9
WP_015380474.1\|679111_679495_+	hypothetical protein	E9LUQ9	Lactobacillus_phage	2.0e-63	99.2
WP_015380473.1\|679491_679683_+	hypothetical protein	E9LUR0	Lactobacillus_phage	1.5e-27	98.4
WP_064522846.1\|679695_684918_+	hypothetical protein	E9LUR1	Lactobacillus_phage	0.0e+00	76.9
WP_015380471.1\|684989_686762_+\|tail	phage tail family protein	E9LUR2	Lactobacillus_phage	0.0e+00	96.6
WP_064522848.1\|686828_689198_+\|tail	phage tail protein	E9LUR3	Lactobacillus_phage	0.0e+00	92.9
WP_064522850.1\|689214_692013_+	hypothetical protein	E9LUR4	Lactobacillus_phage	3.1e-222	73.2
WP_015380468.1\|692005_692248_+	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	6.2e-31	92.5
WP_015380467.1\|692251_692413_+	hypothetical protein	A0A2P0ZLG1	Lactobacillus_phage	8.9e-18	94.3
WP_015380465.1\|693489_693702_+	hypothetical protein	A0A0A1ENR9	Lactobacillus_phage	2.0e-17	80.3
WP_015380464.1\|693713_694892_+	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	6.9e-200	89.0
WP_003644510.1\|694891_695155_+	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	2.0e-38	100.0
WP_015380463.1\|695164_695539_+	nitrate/sulfonate/bicarbonate ABC transporter permease	A0A2K9VCG4	Lactobacillus_phage	2.6e-20	76.2

DBSCAN-SWA_4

1651924 : 1720633

Lactobacillus_phage(26.67%)

protease,transposase,integrase,bacteriocin,tRNA

attL 1689985:1690006|attR 1692819:1692840

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021357097.1\|1651924_1652254_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_015379975.1\|1652389_1653718_-	glucarate dehydratase	NA	NA	NA	NA
WP_015379974.1\|1653866_1654760_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_043992670.1\|1654908_1655886_+	hydroxyacid dehydrogenase	A0A285PXZ1	Cedratvirus	2.1e-32	32.3
WP_015379972.1\|1655900_1657298_+	anion permease	NA	NA	NA	NA
WP_086989537.1\|1657600_1658376_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
WP_064523109.1\|1658709_1660044_-	gluconate permease	NA	NA	NA	NA
WP_015379970.1\|1660293_1661508_+	mandelate racemase/muconate lactonizing enzyme family protein	Q6A202	Oenococcus_phage	2.5e-48	33.8
WP_015379969.1\|1661523_1662666_+	lactonase family protein	NA	NA	NA	NA
WP_015379968.1\|1662758_1663427_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_016526995.1\|1663558_1664128_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003641207.1\|1664178_1664943_-	YibE/F family protein	NA	NA	NA	NA
WP_080125228.1\|1664939_1666190_-	YibE/F family protein	NA	NA	NA	NA
WP_064523112.1\|1666153_1667155_-	hypothetical protein	NA	NA	NA	NA
WP_015379964.1\|1667574_1668357_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_003641203.1\|1668691_1669018_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_015379963.1\|1669209_1670091_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_015379962.1\|1670133_1671942_-	DNA helicase RecQ	M1PGQ0	Moumouvirus	1.0e-77	36.1
WP_003641200.1\|1672199_1672397_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003644064.1\|1672616_1672883_+	hypothetical protein	NA	NA	NA	NA
WP_064523115.1\|1672933_1674166_+	hypothetical protein	NA	NA	NA	NA
WP_015379960.1\|1674201_1675608_+	C69 family dipeptidase	NA	NA	NA	NA
WP_015379959.1\|1676059_1677067_+	aspartate--ammonia ligase	A0A1C9C5F0	Heterosigma_akashiwo_virus	1.4e-63	43.0
WP_064523118.1\|1677105_1678401_+\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	7.1e-57	31.2
WP_043992667.1\|1678461_1679079_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_064523121.1\|1679187_1679661_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_064523124.1\|1679936_1681826_-	FAD-binding protein	A0A2P0ZL82	Lactobacillus_phage	5.2e-16	26.2
WP_003645746.1\|1682012_1682939_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	3.2e-19	25.8
WP_015379952.1\|1683009_1683561_-	helix-turn-helix domain-containing protein	X2CXD8	Lactobacillus_phage	8.4e-07	48.4
WP_015379951.1\|1683660_1684413_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003645748.1\|1685062_1685182_-	putative metal homeostasis protein	NA	NA	NA	NA
WP_053267329.1\|1689074_1689605_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_080125226.1\|1689918_1690152_-	restriction endonuclease subunit S	NA	NA	NA	NA
1689985:1690006	attL	NA	NA	NA	NA
WP_120787327.1\|1690118_1690523_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_080125224.1\|1690527_1691109_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_015379944.1\|1691119_1692037_-\|integrase	site-specific integrase	A8ATM2	Listeria_phage	2.7e-74	44.7
WP_003645758.1\|1698076_1700611_-	M1 family metallopeptidase	A0A0P0IY26	Acinetobacter_phage	3.5e-68	27.4
1692819:1692840	attR	NA	NA	NA	NA
WP_003644050.1\|1700792_1701365_-	hypothetical protein	NA	NA	NA	NA
WP_064523127.1\|1701470_1701803_-	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_064523130.1\|1702164_1703175_-	DUF4767 domain-containing protein	NA	NA	NA	NA
WP_064523133.1\|1703306_1704107_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_003641176.1\|1704310_1704751_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_003644046.1\|1704811_1705234_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_003641174.1\|1705248_1705431_-	hypothetical protein	NA	NA	NA	NA
WP_003644045.1\|1705443_1705989_-	alkaline shock response membrane anchor protein AmaP	NA	NA	NA	NA
WP_003641172.1\|1706000_1706255_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_003645763.1\|1706495_1708343_-	acetyltransferase	A0A1R3Y5Q6	Salmonella_virus	5.8e-20	23.7
WP_003645764.1\|1708332_1708716_-	hypothetical protein	NA	NA	NA	NA
WP_015379937.1\|1709200_1711708_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_064523137.1\|1711981_1713280_+	MFS transporter	NA	NA	NA	NA
WP_015640093.1\|1713356_1714232_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.8e-20	28.9
WP_003645768.1\|1714240_1714948_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003645769.1\|1715103_1715448_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_064523140.1\|1715667_1716351_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641165.1\|1716916_1717285_+	helix-turn-helix transcriptional regulator	E9LUL4	Lactobacillus_phage	5.9e-17	42.7
WP_015379932.1\|1717518_1717887_+	hypothetical protein	NA	NA	NA	NA
WP_004271307.1\|1719709_1720633_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	6.7e-33	31.9

DBSCAN-SWA_5

1943863 : 2050980

Lactobacillus_phage(75.93%)

terminase,tail,portal,tRNA,protease,transposase,integrase,capsid,lysis

attL 2010933:2010948|attR 2019032:2019047

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015379855.1\|1943863_1945276_-\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	3.1e-45	30.0
WP_003640932.1\|1945553_1947044_-\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_003640931.1\|1947369_1948545_-	PIN/TRAM domain-containing protein	NA	NA	NA	NA
WP_003643928.1\|1948560_1949940_-	DNA repair protein RadA	NA	NA	NA	NA
WP_003640928.1\|1951066_1951603_-	dUTP diphosphatase	J9PV85	Bacillus_phage	2.4e-35	45.8
WP_003640927.1\|1951741_1952038_+	N-acetyltransferase	NA	NA	NA	NA
WP_015379853.1\|1952046_1952730_+	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_003643927.1\|1952805_1954137_+	C1 family peptidase	R4TV59	Phaeocystis_globosa_virus	5.4e-68	33.3
WP_080475214.1\|1954042_1955812_-\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	1.2e-91	41.0
WP_031263579.1\|1956098_1956791_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_003644979.1\|1957209_1957887_-	2,3-diphosphoglycerate-dependent phosphoglycerate mutase	NA	NA	NA	NA
WP_015379850.1\|1958036_1959062_-	EamA family transporter	NA	NA	NA	NA
WP_003643925.1\|1959494_1960457_-	AEC family transporter	NA	NA	NA	NA
WP_003640920.1\|1960766_1961960_+	LCP family protein	NA	NA	NA	NA
WP_003640919.1\|1962027_1962801_-	hypothetical protein	NA	NA	NA	NA
WP_064523239.1\|1962793_1963597_-	acetyl-CoA carboxyl transferase	NA	NA	NA	NA
WP_015379847.1\|1963593_1964916_-	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_003640916.1\|1964918_1965320_-	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_003640915.1\|1965330_1966302_-	ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_003640914.1\|1966465_1966984_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_064523241.1\|1966980_1967400_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_064523245.1\|1967470_1970320_-	sigma-54-dependent transcriptional regulator	NA	NA	NA	NA
WP_003640911.1\|1970626_1971013_-	DUF956 family protein	NA	NA	NA	NA
WP_015379845.1\|1971141_1972074_-	PTS mannose/fructose/sorbose transporter family subunit IID	NA	NA	NA	NA
WP_015379844.1\|1972092_1972902_-	PTS mannose/fructose/sorbose transporter subunit IIC	NA	NA	NA	NA
WP_015379843.1\|1972937_1973912_-	PTS mannose transporter subunit IIAB	NA	NA	NA	NA
WP_021357534.1\|1974202_1975057_-	C39 family peptidase	NA	NA	NA	NA
WP_064523247.1\|1975484_1976417_-	lysin	A0A2P0ZLG2	Lactobacillus_phage	6.9e-171	92.3
WP_064523250.1\|1976416_1976701_-\|lysis	lysis protein	A0A2P0ZLE8	Lactobacillus_phage	4.1e-42	97.9
WP_064523253.1\|1976700_1976910_-	hypothetical protein	A0A2P0ZLG4	Lactobacillus_phage	9.8e-09	58.0
WP_064523256.1\|1976915_1977296_-	hypothetical protein	A0A2P0ZLF7	Lactobacillus_phage	3.2e-50	76.0
WP_064523259.1\|1977312_1977747_-	hypothetical protein	A0A2P0ZLE9	Lactobacillus_phage	9.7e-59	79.9
WP_064523262.1\|1977748_1978240_-	DUF1617 family protein	A0A2P0ZLE0	Lactobacillus_phage	2.8e-46	62.5
WP_080475215.1\|1978263_1983129_-	hypothetical protein	A0A2P0ZLE1	Lactobacillus_phage	0.0e+00	52.0
WP_063486813.1\|1983148_1983970_-\|tail	phage tail family protein	A0A2P0ZLE2	Lactobacillus_phage	1.3e-149	95.6
WP_064523264.1\|1983973_1988566_-\|tail	phage tail tape measure protein	A0A2P0ZLF1	Lactobacillus_phage	0.0e+00	78.6
WP_021731063.1\|1988829_1989144_-	hypothetical protein	A0A2P0ZLF3	Lactobacillus_phage	2.4e-51	96.2
WP_021731062.1\|1989237_1989849_-\|tail	major tail protein	A0A2P0ZLF5	Lactobacillus_phage	9.6e-105	96.1
WP_064523268.1\|1989863_1990286_-	hypothetical protein	A0A2P0ZLE4	Lactobacillus_phage	2.8e-71	97.9
WP_021357103.1\|1990282_1990690_-	HK97 gp10 family phage protein	A0A2P0ZLD7	Lactobacillus_phage	1.0e-65	93.3
WP_050339980.1\|1990686_1991076_-	hypothetical protein	A0A2P0ZLD1	Lactobacillus_phage	1.5e-63	90.7
WP_050339979.1\|1991056_1991362_-	hypothetical protein	A0A2P0ZLD5	Lactobacillus_phage	1.2e-47	95.0
WP_050339978.1\|1991500_1992673_-\|capsid	phage major capsid protein	A0A2P0ZLD6	Lactobacillus_phage	6.6e-110	54.5
WP_021730266.1\|1992695_1993418_-\|protease	Clp protease ClpP	A0A2P0ZLE3	Lactobacillus_phage	9.7e-96	75.4
WP_050339977.1\|1993404_1994547_-\|portal	phage portal protein	A0A2P0ZLC9	Lactobacillus_phage	4.0e-213	97.6
WP_064523270.1\|1994565_1996245_-\|terminase	terminase large subunit	A0A2P0ZLE5	Lactobacillus_phage	0.0e+00	98.0
WP_062688238.1\|1996637_1996880_-	hypothetical protein	A0A2P0ZLD2	Lactobacillus_phage	5.6e-40	100.0
WP_064523273.1\|1996897_1997140_-	hypothetical protein	A0A2P0ZLD3	Lactobacillus_phage	8.6e-33	83.8
WP_064523278.1\|1997139_1997478_-	HNH endonuclease	A0A2P0ZLC6	Lactobacillus_phage	2.8e-61	96.4
WP_064523281.1\|1997461_1997698_-	hypothetical protein	A0A2P0ZLC2	Lactobacillus_phage	1.8e-19	72.9
WP_064523284.1\|1998081_1999353_-	hypothetical protein	NA	NA	NA	NA
WP_024971547.1\|1999368_2000238_-	DNA adenine methylase	A0A1S5PRR3	Streptococcus_phage	8.9e-80	51.4
WP_064523287.1\|2000573_2001005_-	hypothetical protein	A0A2P0ZLC0	Lactobacillus_phage	2.5e-67	93.4
WP_064523290.1\|2001016_2001325_-	hypothetical protein	A0A2P0ZLD0	Lactobacillus_phage	1.7e-46	90.1
WP_080475236.1\|2001456_2001942_-	adenine methyltransferase	A0A2P0ZL79	Lactobacillus_phage	2.1e-78	93.8
WP_064523296.1\|2002009_2002501_-	methyltransferase domain-containing protein	O03918	Lactobacillus_phage	5.8e-84	89.9
WP_064523302.1\|2003077_2003419_-	VRR-NUC domain-containing protein	A0A2P0ZLB6	Lactobacillus_phage	1.5e-59	95.6
WP_064523305.1\|2003673_2004939_-	helicase	A0A2P0ZLC4	Lactobacillus_phage	5.8e-229	94.1
WP_064523308.1\|2004935_2005730_-	bifunctional DNA primase/polymerase	A0A2P0ZLB0	Lactobacillus_phage	2.1e-136	92.0
WP_064523311.1\|2005800_2006433_-	hypothetical protein	A0A2P0ZLB9	Lactobacillus_phage	4.6e-102	97.3
WP_064523314.1\|2006435_2007152_-	AAA family ATPase	A0A2P0ZLB2	Lactobacillus_phage	1.5e-112	97.7
WP_064523317.1\|2007148_2008408_-	DEAD/DEAH box helicase family protein	A0A2P0ZLA5	Lactobacillus_phage	8.0e-231	96.7
WP_064523319.1\|2008559_2009039_-	siphovirus Gp157 family protein	A0A2P0ZLB3	Lactobacillus_phage	1.8e-77	89.9
WP_064523322.1\|2009309_2009540_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_162936243.1\|2009532_2009697_-	hypothetical protein	A0A2P0ZLA3	Lactobacillus_phage	1.0e-24	96.2
WP_162936244.1\|2009689_2009866_-	hypothetical protein	A0A2P0ZLB1	Lactobacillus_phage	1.4e-24	89.7
WP_064523325.1\|2009846_2010128_-	hypothetical protein	NA	NA	NA	NA
WP_021357721.1\|2010265_2010538_-	hypothetical protein	A0A2P0ZLA9	Lactobacillus_phage	1.2e-43	100.0
WP_064523328.1\|2010537_2010741_-	hypothetical protein	A0A2P0ZLA4	Lactobacillus_phage	1.5e-30	98.5
WP_064523331.1\|2010812_2011301_+	DUF2321 domain-containing protein	Q6SEF3	Lactobacillus_prophage	2.7e-33	43.5
2010933:2010948	attL	NA	NA	NA	NA
WP_064523334.1\|2011428_2011638_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_064523337.1\|2011889_2012297_+	helix-turn-helix transcriptional regulator	Q9T1J3	Lactobacillus_phage	1.2e-10	36.0
WP_064523340.1\|2012306_2012780_+	hypothetical protein	NA	NA	NA	NA
WP_063486788.1\|2012870_2013551_+	hypothetical protein	NA	NA	NA	NA
WP_064523346.1\|2014280_2015438_+\|integrase	site-specific integrase	A0A2P0ZL94	Lactobacillus_phage	3.6e-217	98.2
WP_015379841.1\|2015728_2016604_-	homoserine kinase	NA	NA	NA	NA
WP_003640905.1\|2016612_2017899_-	homoserine dehydrogenase	NA	NA	NA	NA
WP_015379840.1\|2017964_2018411_-	SprT family protein	NA	NA	NA	NA
WP_054519103.1\|2018410_2020582_-	RNA-binding transcriptional accessory protein	NA	NA	NA	NA
2019032:2019047	attR	NA	NA	NA	NA
WP_003640902.1\|2020875_2021310_-	hypothetical protein	NA	NA	NA	NA
WP_031263668.1\|2021364_2024019_-	cation-translocating P-type ATPase	M1I547	Acanthocystis_turfacea_Chlorella_virus	6.8e-70	28.9
WP_003640900.1\|2024474_2025302_-	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	6.5e-72	54.0
WP_003640899.1\|2025301_2026780_-	nicotinate phosphoribosyltransferase	G3MA18	Bacillus_virus	2.5e-106	44.1
WP_013355215.1\|2026936_2027674_+	WecB/TagA/CpsF family glycosyltransferase	NA	NA	NA	NA
WP_003640897.1\|2027843_2028545_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003644997.1\|2028568_2029705_-	N-acetylglucosamine-6-phosphate deacetylase	NA	NA	NA	NA
WP_003640895.1\|2029783_2030575_-	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	3.5e-30	36.1
WP_003640894.1\|2030935_2031757_+	nicotinamide mononucleotide transporter	A0A2K9VCL6	Lactobacillus_phage	3.3e-52	42.2
WP_003640893.1\|2031949_2033056_+	anion permease	NA	NA	NA	NA
WP_015379837.1\|2033214_2034057_-	metallophosphoesterase	NA	NA	NA	NA
WP_064523349.1\|2034091_2034427_-	cupin domain-containing protein	NA	NA	NA	NA
WP_024971775.1\|2034457_2034982_-	cupin domain-containing protein	NA	NA	NA	NA
WP_003640889.1\|2035162_2035621_-	hypothetical protein	NA	NA	NA	NA
WP_003640888.1\|2036179_2037022_-	metallophosphoesterase	NA	NA	NA	NA
WP_003643855.1\|2037076_2038549_-	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	2.1e-68	34.3
WP_003642090.1\|2045096_2046596_-\|tRNA	lysine--tRNA ligase	A0A2K9L3L6	Tupanvirus	1.6e-89	37.5
WP_003642089.1\|2046699_2047707_-\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_003642088.1\|2047706_2048594_-	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_003643854.1\|2048742_2050980_-\|protease	ATP-dependent zinc metalloprotease FtsH	G8DDJ2	Micromonas_pusilla_virus	6.0e-104	47.8

DBSCAN-SWA_6

2100895 : 2199013

uncultured_Mediterranean_phage(16.67%)

protease,transposase,bacteriocin,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015379813.1\|2100895_2102167_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	4.5e-96	43.7
WP_003642042.1\|2102633_2104247_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.2e-143	49.9
WP_003642041.1\|2104419_2105028_-	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
WP_064523373.1\|2105072_2105513_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_024971479.1\|2105875_2106808_+	lipoate--protein ligase family protein	NA	NA	NA	NA
WP_187291423.1\|2106816_2108175_+	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	5.2e-26	32.9
WP_015379810.1\|2108194_2109004_+	sugar-phosphatase	NA	NA	NA	NA
WP_043992605.1\|2109173_2110160_-	hypothetical protein	NA	NA	NA	NA
WP_015379808.1\|2110242_2111265_-	YdcF family protein	NA	NA	NA	NA
WP_003643830.1\|2111553_2112534_-	ribose-phosphate diphosphokinase	A0A2K9L8D8	Tupanvirus	4.9e-42	36.3
WP_064523377.1\|2112899_2113724_-	serine hydrolase	NA	NA	NA	NA
WP_003646504.1\|2113959_2115342_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A2K9L140	Tupanvirus	5.7e-28	33.2
WP_003642030.1\|2115410_2116247_-	pur operon repressor	NA	NA	NA	NA
WP_003642029.1\|2116739_2117003_-	hypothetical protein	NA	NA	NA	NA
WP_003646503.1\|2117017_2117560_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_003646500.1\|2118740_2119538_-	metal ABC transporter permease	NA	NA	NA	NA
WP_003642023.1\|2119530_2120229_-	ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	1.2e-15	27.8
WP_015379805.1\|2120496_2121441_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_015379804.1\|2121750_2122617_-	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_003642020.1\|2122749_2123001_-	Veg family protein	NA	NA	NA	NA
WP_003642019.1\|2123105_2123996_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_003643826.1\|2123992_2124556_-	ribonuclease M5	NA	NA	NA	NA
WP_003643825.1\|2124542_2125319_-	TatD family hydrolase	NA	NA	NA	NA
WP_086989537.1\|2125703_2126479_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
WP_064523380.1\|2126503_2126914_-	hypothetical protein	NA	NA	NA	NA
WP_043992601.1\|2127476_2128367_+	XRE family transcriptional regulator	NA	NA	NA	NA
WP_015379798.1\|2128400_2129585_-	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_015379797.1\|2129914_2130241_-	hypothetical protein	NA	NA	NA	NA
WP_064523384.1\|2130719_2132771_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.7e-90	35.8
WP_015379795.1\|2133092_2133482_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_015379793.1\|2134076_2134919_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_003642011.1\|2134918_2135623_-	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_003642010.1\|2135644_2136604_-	hypothetical protein	NA	NA	NA	NA
WP_003642009.1\|2136596_2137871_-	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_003642008.1\|2137916_2138834_-	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_043992598.1\|2139233_2140247_-\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
WP_015379789.1\|2140359_2141106_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_003642003.1\|2141255_2142152_-	ROK family protein	NA	NA	NA	NA
WP_003642002.1\|2142272_2143709_-	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	9.7e-31	25.5
WP_043992963.1\|2143726_2145082_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003642000.1\|2145304_2145727_-	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_003641999.1\|2145716_2145905_-	hypothetical protein	NA	NA	NA	NA
WP_015379786.1\|2145911_2147273_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003641997.1\|2147345_2148056_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_043992597.1\|2148461_2149478_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_064523387.1\|2149911_2150688_-	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_064523390.1\|2150946_2153256_+	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_027821496.1\|2153350_2153554_-	hypothetical protein	NA	NA	NA	NA
WP_015379782.1\|2153691_2154378_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_015379781.1\|2154471_2155152_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_015379780.1\|2155238_2155907_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_015379779.1\|2155974_2156664_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_064523393.1\|2156750_2158130_-	HlyD family secretion protein	NA	NA	NA	NA
WP_004271307.1\|2160581_2161505_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	6.7e-33	31.9
WP_015379774.1\|2161704_2162880_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_015379773.1\|2162911_2163463_-	hypothetical protein	NA	NA	NA	NA
WP_003643807.1\|2163476_2163626_-	hypothetical protein	NA	NA	NA	NA
WP_015379772.1\|2163757_2164504_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_015379769.1\|2165610_2165778_+\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnJ	NA	NA	NA	NA
WP_003641972.1\|2165808_2165982_+\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnK	NA	NA	NA	NA
WP_003643805.1\|2165978_2166647_+	hypothetical protein	NA	NA	NA	NA
WP_003641969.1\|2167058_2167262_-	hypothetical protein	NA	NA	NA	NA
WP_064523765.1\|2167466_2167982_-	cation:proton antiporter	NA	NA	NA	NA
WP_120787350.1\|2168137_2168341_+\|transposase	transposase	NA	NA	NA	NA
WP_080125207.1\|2168447_2168759_+\|transposase	transposase	NA	NA	NA	NA
WP_050495850.1\|2169220_2169409_-	hypothetical protein	NA	NA	NA	NA
WP_003643800.1\|2169420_2169564_-	hypothetical protein	NA	NA	NA	NA
WP_011100995.1\|2170225_2171410_-	cation:proton antiporter	NA	NA	NA	NA
WP_064523396.1\|2171454_2172831_-	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_003641966.1\|2173358_2174174_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_015379762.1\|2174333_2175206_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_015825116.1\|2175276_2176068_+	HAD family hydrolase	NA	NA	NA	NA
WP_003646460.1\|2176071_2177226_+	MFS transporter	NA	NA	NA	NA
WP_015379760.1\|2177229_2177847_+	sugar O-acetyltransferase	NA	NA	NA	NA
WP_003641945.1\|2178042_2178765_-	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
WP_003643774.1\|2178779_2180609_-	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_064523399.1\|2180623_2182141_-	glycerol kinase GlpK	NA	NA	NA	NA
WP_043992584.1\|2182606_2183938_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003641941.1\|2184015_2184987_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_003643770.1\|2184987_2186514_-	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_064523403.1\|2186751_2187099_+	hypothetical protein	NA	NA	NA	NA
WP_064523406.1\|2187270_2189151_-	hypothetical protein	NA	NA	NA	NA
WP_064523408.1\|2189590_2190490_-	oxidoreductase	NA	NA	NA	NA
WP_003646441.1\|2190626_2191547_+	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_003641936.1\|2191712_2192285_-	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_003641935.1\|2192388_2192844_-	hypothetical protein	NA	NA	NA	NA
WP_003641934.1\|2192862_2193333_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_064523413.1\|2193442_2194639_+	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|2194669_2195179_+	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_003643763.1\|2195291_2195660_-	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_015379750.1\|2195924_2197430_-	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_015379749.1\|2197587_2198256_-	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_015379748.1\|2198449_2199013_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_7

2844651 : 2854019

Planktothrix_phage(16.67%)

bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080475227.1\|2844651_2846673_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.5e-18	30.5
WP_003645478.1\|2846765_2847737_-	GMP reductase	Q4ZCY7	Staphylococcus_virus	1.8e-137	71.2
WP_015381012.1\|2847785_2849075_-	adenylosuccinate synthase	L7Y4J5	Megavirus	3.5e-72	37.0
WP_003645480.1\|2849391_2850690_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	3.8e-18	33.6
WP_021357419.1\|2850912_2851242_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_015381010.1\|2851436_2852771_-	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	7.9e-27	27.1
WP_054519129.1\|2852906_2854019_+	glycerate kinase	W6LM47	Streptococcus_phage	1.3e-35	35.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP015966

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection