CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP015859	Lactiplantibacillus plantarum strain LZ227 plasmid LZ227p4, complete sequence	0 crisprs	csa3	0	1
NZ_CP015857	Lactiplantibacillus plantarum strain LZ227 chromosome, complete genome	1 crisprs	cas3,DEDDh,DinG,csa3,csn2,cas2,cas1,cas9,WYL	5	8
NZ_CP015858	Lactiplantibacillus plantarum strain LZ227 plasmid LZ227p1, complete sequence	0 crisprs	NA	0	1
NZ_CP015862	Lactiplantibacillus plantarum strain LZ227 plasmid LZ227p5, complete sequence	0 crisprs	NA	0	0
NZ_CP015860	Lactiplantibacillus plantarum strain LZ227 plasmid LZ227p2, complete sequence	0 crisprs	NA	0	0
NZ_CP015861	Lactiplantibacillus plantarum strain LZ227 plasmid LZ227p3, complete sequence	0 crisprs	NA	0	5

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4119 : 73850

Streptococcus_phage(15.38%)

transposase,holin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053338758.1\|4119_5049_-\|transposase	IS30-like element ISLpl1 family transposase	H7BW47	unidentified_phage	1.1e-24	34.4
WP_011222016.1\|5403_5754_-	DUF5388 domain-containing protein	NA	NA	NA	NA
WP_015639692.1\|5755_6556_-	AAA family ATPase	F0PIG8	Enterococcus_phage	2.9e-53	41.9
WP_063493464.1\|7359_7692_+	hypothetical protein	NA	NA	NA	NA
WP_064578694.1\|9206_9488_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_103851992.1\|9477_9882_+	hypothetical protein	NA	NA	NA	NA
WP_016526694.1\|11210_12119_+	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_003646133.1\|14153_14432_-	hypothetical protein	NA	NA	NA	NA
WP_064578696.1\|14454_14664_-	hypothetical protein	NA	NA	NA	NA
WP_064578697.1\|14934_16998_+	MobA/MobL family protein	NA	NA	NA	NA
WP_064578698.1\|17094_19230_+	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	1.5e-107	46.0
WP_064578699.1\|19351_19567_+	hypothetical protein	NA	NA	NA	NA
WP_064578700.1\|19570_20695_+	hypothetical protein	NA	NA	NA	NA
WP_021353390.1\|20851_20941_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_027821237.1\|21952_23347_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_027821238.1\|23436_23784_+	winged helix-turn-helix transcriptional regulator	A0A2H4PQT4	Staphylococcus_phage	1.7e-18	44.3
WP_003596756.1\|23786_25082_+	arsenic transporter	A0A2H4PQU3	Staphylococcus_phage	6.9e-145	63.7
WP_003646125.1\|25458_25995_+	hypothetical protein	NA	NA	NA	NA
WP_064578701.1\|28099_29182_+	alcohol dehydrogenase catalytic domain-containing protein	A0A2K9L339	Tupanvirus	2.4e-18	31.2
WP_041161898.1\|30514_31231_-	LysM peptidoglycan-binding domain-containing protein	K4ID66	Lactobacillus_phage	3.6e-10	55.7
WP_181021348.1\|31613_32600_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.2e-43	36.0
WP_013356276.1\|33016_34213_+	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.9e-29	36.4
WP_020923853.1\|34212_35052_+	proline/glycine betaine ABC transporter permease	NA	NA	NA	NA
WP_064578705.1\|35059_35977_+	glycine/betaine ABC transporter	NA	NA	NA	NA
WP_056986431.1\|36096_36312_-\|transposase	transposase	A0A1S5SBP9	Streptococcus_phage	1.8e-05	49.1
WP_064578706.1\|38224_38662_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_064578707.1\|39045_40566_-	KUP/HAK/KT family potassium transporter	A7J6G4	Paramecium_bursaria_Chlorella_virus	1.5e-58	35.8
WP_064578708.1\|40665_41277_-	recombinase family protein	A0A219YA40	Aeromonas_phage	2.4e-18	35.5
WP_064578709.1\|41389_41635_-	helix-turn-helix transcriptional regulator	A0A1V0E021	Clostridioides_phage	2.3e-17	73.4
WP_064578710.1\|41610_41916_-	hypothetical protein	NA	NA	NA	NA
WP_181021341.1\|42145_42463_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_064578712.1\|42459_43290_+	hypothetical protein	NA	NA	NA	NA
WP_016378676.1\|43449_43554_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_064578713.1\|43842_45234_+	MFS transporter	NA	NA	NA	NA
WP_064578714.1\|45233_45896_+	HD domain-containing protein	A0A1S5XYU7	Kurlavirus	1.3e-14	31.4
WP_021353390.1\|46021_46111_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_072533468.1\|46663_47122_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	NA	NA	NA	NA
WP_043993132.1\|47149_49297_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	3.0e-254	60.3
WP_020923824.1\|49403_50330_+	ribonucleotide-diphosphate reductase subunit beta	A0A2H4P8A9	Corynebacterium_phage	1.2e-34	31.1
WP_027821209.1\|50344_51295_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	7.2e-99	54.6
WP_027821210.1\|51815_52103_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_064578715.1\|52520_53846_+	MHS family MFS transporter	Q6JIH2	Burkholderia_virus	2.4e-36	28.4
WP_012390814.1\|54036_54846_+	2-keto-4-pentenoate hydratase	NA	NA	NA	NA
WP_027822410.1\|54878_55823_+	L-lactate dehydrogenase	NA	NA	NA	NA
WP_020923829.1\|57221_57776_+	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	8.9e-33	45.1
WP_064578716.1\|58376_59558_-\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	1.2e-26	28.6
WP_020923831.1\|60053_62090_-	KUP/HAK/KT family potassium transporter	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	1.6e-63	33.4
WP_027823033.1\|63007_63910_+	YitT family protein	M1Q1P6	Streptococcus_phage	8.2e-52	40.3
WP_128484923.1\|64017_64792_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	1.0e-26	52.3
WP_027822938.1\|65163_66318_+	cation:proton antiporter	NA	NA	NA	NA
WP_020923857.1\|66440_68009_+	ClC family H(+)/Cl(-) exchange transporter	NA	NA	NA	NA
WP_072533465.1\|68345_68483_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_064578719.1\|68781_70008_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	2.8e-87	47.5
WP_064578693.1\|71298_72144_-	LysM peptidoglycan-binding domain-containing protein	K4ID66	Lactobacillus_phage	4.3e-10	55.7
WP_063484976.1\|72608_72872_-	hypothetical protein	NA	NA	NA	NA
WP_053338758.1\|72920_73850_-\|transposase	IS30-like element ISLpl1 family transposase	H7BW47	unidentified_phage	1.1e-24	34.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP015857

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP015857_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015857_1

2311451-2312014

TypeII

Consensus_repeat	Method
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CRT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CRISPRCasFinder

8 spacers

csa3,csn2,cas2,cas1,cas9

The CRISPR arrays of NZ_CP015857_1

>merge|NZ_CP015857|1|2311451-2312014|CRT,CRISPRCasFinder
CGTGAAACTGTTTTTGATGTGGCCGCTATTCAAGACAAACGTTCTATGCTTCGTTTCCTCAGCATCGTTCTAAACCTGTTTGATATGACTACTATTCAAGACGGCATGTTAGTAGTTTAGGCGCCCTCCAAAGTTCTAAACCTGTTTGATATGACTACTATTCAAGACTGCTTTCGTTTTTAAGTTGTCCGCCTAACTGTTCTAAACCTGTTTGATATGACTACTATTCAAGACTCGCGCCGCGAAACATTGGACAGACTTAGTGTTCTAAACCTGTTTGATATGACTACTATTCAAGACTGATCAAACAGTTTATAACAAGTTAAAAGAGTTCTAAACCTGTTTGATATGACTACTATTCAAGACAGAAGATATATGTTCCAGATACTAATTCTGGTTCTAAACCTGTTTGATATGACTACTATTCAAGACTGGTTACGACGCGTGGGGGCTAACGCCTACGTTCTAAACCTGTTTGATATGACTACTATTCAAGACGATGATGAGCGTATGATTCAGCAAGCCATGGTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

>NZ_CP015857|1|1|2311451-2312014|CRT
CGTGAAACTGTTTTTGATGTGGCCGCTATTCAAGAC	AAACGTTCTATGCTTCGTTTCCTCAGCATC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GGCATGTTAGTAGTTTAGGCGCCCTCCAAA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TGCTTTCGTTTTTAAGTTGTCCGCCTAACT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TCGCGCCGCGAAACATTGGACAGACTTAGT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TGATCAAACAGTTTATAACAAGTTAAAAGA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AGAAGATATATGTTCCAGATACTAATTCTG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TGGTTACGACGCGTGGGGGCTAACGCCTAC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GATGATGAGCGTATGATTCAGCAAGCCATG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

>NZ_CP015857|1|1|2311517-2312014|CRISPRCasFinder
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GGCATGTTAGTAGTTTAGGCGCCCTCCAAA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TGCTTTCGTTTTTAAGTTGTCCGCCTAACT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TCGCGCCGCGAAACATTGGACAGACTTAGT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TGATCAAACAGTTTATAACAAGTTAAAAGA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AGAAGATATATGTTCCAGATACTAATTCTG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TGGTTACGACGCGTGGGGGCTAACGCCTAC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GATGATGAGCGTATGATTCAGCAAGCCATG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015857.1\|WP_003646320.1\|2306699_2307302_+\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|377026
NZ_CP015857.1\|WP_064578474.1\|2314094_2318171_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	mkCas0193_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|374653
NZ_CP015857.1\|WP_003641722.1\|2323982_2324723_-\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|224982
NZ_CP015857.1\|WP_003646323.1\|2305001_2305457_+\|DUF3021-domain-containing-protein	unknown	unknown	gnl\|CDD\|378668
NZ_CP015857.1\|WP_021357178.1\|2319266_2319974_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015857.1\|WP_064578472.1\|2307604_2308363_-\|nucleoside-phosphorylase	unknown	unknown	gnl\|CDD\|350158
NZ_CP015857.1\|WP_015379639.1\|2312995_2313901_-\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187851
NZ_CP015857.1\|WP_003641738.1\|2301719_2302913_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340897
NZ_CP015857.1\|WP_071542797.1\|2304720_2305005_+\|LytTR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197918
NZ_CP015857.1\|WP_064578475.1\|2322095_2323739_-\|HIRAN-domain-containing-protein	unknown	unknown	gnl\|CDD\|214906
NZ_CP015857.1\|WP_015379641.1\|2312038_2312716_-\|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd12218_csn2_CAS-II-A	gnl\|CDD\|213411
NZ_CP015857.1\|WP_003646321.1\|2306112_2306586_-\|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP015857.1\|WP_011100893.1\|2318459_2319242_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP015857.1\|WP_003641730.1\|2307367_2307562_+\|PspC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377200
NZ_CP015857.1\|WP_003641733.1\|2305544_2305967_-\|Hsp20/alpha-crystallin-family-protein	unknown	unknown	gnl\|CDD\|107228
NZ_CP015857.1\|WP_003641725.1\|2320073_2321438_-\|amino-acid-permease	unknown	unknown	gnl\|CDD\|182694
NZ_CP015857.1\|WP_021357176.1\|2321670_2322141_+\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|240033
NZ_CP015857.1\|WP_015379645.1\|2302977_2303277_-\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP015857.1\|WP_064578473.1\|2308647_2311386_+\|cation-transporting-P-type-ATPase	unknown	unknown	gnl\|CDD\|319775
NZ_CP015857.1\|WP_015379640.1\|2312712_2313018_-\|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|226043

Protein	Function_ID	Function_description	E-value
NZ_CP015857.1\|WP_003646320.1\|2306699_2307302_+\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|377026	pfam03358, FMN_red, NADPH-dependent FMN reductase.	3.18179e-31
NZ_CP015857.1\|WP_064578474.1\|2314094_2318171_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|374653	pfam16592, Cas9_REC, REC lobe of CRISPR-associated endonuclease Cas9. The REC lobe of Cas9 - the CRISPR-associated endonuclease Cas9 - includes the REC1 and REC2 domains. REC1 forms an elongated, alpha-helical structure consisting of 25 alpha helices and two beta-sheets, whereas REC2 inserted within REC1 adopts a six-helix bundle structure. The REC lobe and the NUC lobe of Cas9 fold to present a positively charged groove at their interface which accommodates the negatively charged sgRNA:target DNA heteroduplex. CRISPR (clustered regularly interspaced short palindromic repeat)-Cas system occurs naturally in bacteria as a defense against invasion by phages or other mobile genetic elements. Cas9 is targeted to specific genomic locations by sgRNAs or single guide RNAs, in order to complex with invading DNA in order to cleave it and render it inactive.	2.317e-129
NZ_CP015857.1\|WP_003641722.1\|2323982_2324723_-\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	gnl\|CDD\|224982	COG2071, COG2071, Predicted glutamine amidotransferases [General function prediction only].	4.48973e-88
NZ_CP015857.1\|WP_003646323.1\|2305001_2305457_+\|DUF3021-domain-containing-protein	gnl\|CDD\|378668	pfam11457, DUF3021, Protein of unknown function (DUF3021). This is a bacterial family of uncharacterized proteins.	7.07627e-26
NZ_CP015857.1\|WP_064578472.1\|2307604_2308363_-\|nucleoside-phosphorylase	gnl\|CDD\|350158	cd09007, NP-I_spr0068, uncharacterized subfamily of the nucleoside phosphorylase-I family. This subfamily is composed of uncharacterized members including Streptococcus pneumoniae hypothetical protein spr0068. The nucleoside phosphorylase-I (NP-I) family members accept a range of purine nucleosides as well as the pyrimidine nucleoside uridine. The NP-1 family includes phosphorolytic nucleosidases such as purine nucleoside phosphorylase (PNP, EC. 2.4.2.1), uridine phosphorylase (UP, EC 2.4.2.3), and 5'-deoxy-5'-methylthioadenosine phosphorylase (MTAP, EC 2.4.2.28), and hydrolytic nucleosidases such as AMP nucleosidase (AMN, EC 3.2.2.4) and 5'-methylthioadenosine/S-adenosylhomocysteine (MTA/SAH) nucleosidase (MTAN, EC 3.2.2.16). Members of the NP-I family display different physiologically relevant quaternary structures: hexameric (trimer-of-dimers arrangement of Shewanella oneidensis MR-1 UP); homotrimeric (human PNP and Escherichia coli PNPII or XapA); hexameric (with some evidence for co-existence of a trimeric form) such as E. coli PNPI (DeoD); or homodimeric such as human and Trypanosoma brucei UP. The NP-I family is distinct from nucleoside phosphorylase-II, which belongs to a different structural family.	3.23517e-89
NZ_CP015857.1\|WP_015379639.1\|2312995_2313901_-\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	1.7681e-88
NZ_CP015857.1\|WP_003641738.1\|2301719_2302913_-\|MFS-transporter	gnl\|CDD\|340897	cd17339, MFS_NIMT_CynX_like, 2-nitroimidazole and cyanate transporters and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Escherichia coli 2-nitroimidazole transporter (NIMT) and cyanate transport protein CynX, and similar proteins. NIMT, also called YeaN, confers resistance to 2-nitroimidazole, the antibacterial and antifungal antibiotic, by mediating the active efflux of this compound. CynX is part of an active transport system that transports exogenous cyanate into E. coli cells. The NIMT/CynX-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.6578e-118
NZ_CP015857.1\|WP_071542797.1\|2304720_2305005_+\|LytTR-family-transcriptional-regulator	gnl\|CDD\|197918	smart00850, LytTR, LytTr DNA-binding domain. This domain is found in a variety of bacterial transcriptional regulators. The domain binds to a specific DNA sequence pattern.	6.75435e-19
NZ_CP015857.1\|WP_064578475.1\|2322095_2323739_-\|HIRAN-domain-containing-protein	gnl\|CDD\|214906	smart00910, HIRAN, The HIRAN protein (HIP116, Rad5p N-terminal) is found in the N-terminal regions of the SWI2/SNF2 proteins typified by HIP116 and Rad5p. HIRAN is found as a standalone protein in several bacteria and prophages, or fused to other catalytic domains, such as a nuclease of the restriction endonuclease fold and TDP1-like DNA phosphoesterases, in the eukaryotes. It has been predicted that this protein functions as a DNA-binding domain that probably recognises features associated with damaged DNA or stalled replication forks.	4.58128e-17
NZ_CP015857.1\|WP_015379641.1\|2312038_2312716_-\|type-II-A-CRISPR-associated-protein-Csn2	gnl\|CDD\|213411	cd12218, Csn2, CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	4.14563e-81
NZ_CP015857.1\|WP_003646321.1\|2306112_2306586_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	0.000122978
NZ_CP015857.1\|WP_011100893.1\|2318459_2319242_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	8.96404e-26
NZ_CP015857.1\|WP_003641730.1\|2307367_2307562_+\|PspC-domain-containing-protein	gnl\|CDD\|377200	pfam04024, PspC, PspC domain. This family includes Phage shock protein C (PspC) that is thought to be a transcriptional regulator. The presumed domain is 60 amino acid residues in length.	2.12668e-17
NZ_CP015857.1\|WP_003641733.1\|2305544_2305967_-\|Hsp20/alpha-crystallin-family-protein	gnl\|CDD\|107228	cd06471, ACD_LpsHSP_like, Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18.5, HSP 18.55 and HSP 19.3. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Transcription of the genes encoding Lp HSP 18.5, 18.55 and 19.3 is regulated by a variety of stresses including heat, cold and ethanol. Early growing L. plantarum cells contain elevated levels of these mRNAs which rapidly fall of as the cells enter stationary phase. Also belonging to this group is Bifidobacterium breve (Bb) HSP20 and Oenococcus oenis (syn. Leuconostoc oenos) (Oo) HSP18. Transcription of the gene encoding BbHSP20 is strongly induced following heat or osmotic shock, and that of the gene encoding OoHSP18 following heat, ethanol or acid shock. OoHSP18 is peripherally associated with the cytoplasmic membrane.	2.47416e-43
NZ_CP015857.1\|WP_003641725.1\|2320073_2321438_-\|amino-acid-permease	gnl\|CDD\|182694	PRK10746, PRK10746, putative transport protein YifK; Provisional.	0
NZ_CP015857.1\|WP_021357176.1\|2321670_2322141_+\|NUDIX-hydrolase	gnl\|CDD\|240033	cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	1.14377e-57
NZ_CP015857.1\|WP_015379645.1\|2302977_2303277_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	2.33489e-13
NZ_CP015857.1\|WP_064578473.1\|2308647_2311386_+\|cation-transporting-P-type-ATPase	gnl\|CDD\|319775	cd02080, P-type_ATPase_cation, P-type cation-transporting ATPase similar to Exiguobacterium aurantiacum Mna, an Na(+)-ATPase, and Synechocystis sp. PCC 6803 PMA1, a putative Ca(2+)-ATPase. This subfamily includes the P-type Na(+)-ATPase of an alkaliphilic bacterium Exiguobacterium aurantiacum Mna and cyanobacterium Synechocystis sp. PCC 6803 PMA1, a cation-transporting ATPase which may translocate calcium. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP015857.1\|WP_015379640.1\|2312712_2313018_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	2.01798e-25

>NZ_CP015857.1|WP_064578473.1|2308647_2311386_+|cation-transporting-P-type-ATPase
MIKDDNQSLTSNEEQNDTQNPPDADNLWQLDESALAAKYATDPENGLSTAEAAERLQHNGRNELETKRTSRFVQFIKQFNNSIIYILAAAAVLTFFMHHYSDSIVIGLVIIANAIIGYVQERQAGNALERIREMLISKNFVIRDGKKLEIDARELVVGDLVNLEAGDAVPADMRLISADNFNVQESVLTGETNPVEKQEEPITETTPALADRKNMVYASTAVTSGSAVGIVTATAEDTEIGHIQQSVSDVKQTTTPLMRNLNSLGVGLSIAIVVAAVLLFLLGMVMDTYSLPTLLIAVITMVVGSMPEGLPASTSVVLAMGTRQMTKKNVIVKSLPAVETLGAVDIVNTDKTGTLTKNEMTVTKVVTPEHTFDVTGVGYDDNGGVNFDGHLKLNGNKVDWHQDNAMEWLVKIAGQTTDAELHFENNRWELTGEPTDGALTTLYRKMTGHDPEVEEVDSLPFDSAFRFSARLADLDGQRLLMVKGSPATVLRLTDQANQTAYWDDAMDDLTADGLRVVALAYQEVDDDVTTIDAQAIGGLHLAGLVGIIDPPREEAATAIAELRQAGVQVKMITGDHPDTAMAIANKLNLAANVKAITGPEIDAMDDQQLQAHIDDYNVFARATPNNKLRIVRAQQANNHVVSMTGDGVNDAPALKQADIGVAMGIKGTEVAKESADMVLADDDFADIVAAVREGRHVFDNIRKTIRFLLPTSFAEGLVVIISILMGHELPLYPTQLLWINMVSALTIQFAFIFEPPEAGIMARGPRNVKSGLLSKLDYFEIGYVSFLISGLGIFAYDYLTALGLPNVVGSTMSLNIIIFGKIFYLFNLRNDHPVISKYFFQNKMAFYIIGILILLQLGIIYLPFMQSVFHTTSINFWYGWGIPIICGIVVLIVTEVGKSIRFRWMGKDGVID
>NZ_CP015857.1|WP_064578472.1|2307604_2308363_-|nucleoside-phosphorylase
MTDKLTLLQYDPNPTAMVGPDVDCRFTVPAKLLYIFSGDDYFQQFVTRYHGHRLGQFNTITKVSWVYQIGYRGQKLAVAQAPLGSPAATMYLEMLIDFGARTVIAVGSCGALTALPEEQLLIPTVALRDEGTSLHYLAAADWVPLDPKVIQVLGTTLTKACLPWQMVKTWTTDAFFRETVSKVKAARQQGCQVVEMECSALAACSAFRQVSFGQLLYTADTLAQLEHYDPRHWGAGGVLVAIELATESLAAY
>NZ_CP015857.1|WP_003641730.1|2307367_2307562_+|PspC-domain-containing-protein
MKIDIHRSATDRVIAGVIGGIAEHFNWNTNVTRLLFVVLAITPMFPGIIAYLILWLLMKDPIKD
>NZ_CP015857.1|WP_003646320.1|2306699_2307302_+|NAD(P)H-dependent-oxidoreductase
MFKIAIILGSTRSQANGRALFNHLKLIIDQLPTHSTIHYQFLDLANYQLPLFDEPEPPMANPHRELPANQQQWLTDMASADGYIILTPEYNHAMPAGLKNAFDFLAFEGARKPAKIISYSDNMRGGQFGAAALVPVLQRLGMVVLPKPTPIGNVPQTLQSNGHFIDNAPLSKRYDHALHQALTEITYYTTVLTTTPFPTD
>NZ_CP015857.1|WP_003646321.1|2306112_2306586_-|winged-helix-turn-helix-transcriptional-regulator
MTTPLVSQLMTELNQFLTQDSVDDQEKRWAMQQTTDPQLQAALKQLSTTDIKIIAYLGRRGASRAKSLPAPTELSQATISRGLTKLSRLKLATKYRDLTNNKEILVRLTTLGEAVADLHTQLDAAIAAKAQAIADDYSDAELRRFVSLMRRIREIKI
>NZ_CP015857.1|WP_003641733.1|2305544_2305967_-|Hsp20/alpha-crystallin-family-protein
MANTLMNRNDFGMLDPFERMARSFWAPLENMDQVLKTDINETDDQYQVKVDVPGIDKQDVKLDYRDNVLSIKVQKDSFVDHEDQDQNIVMNERHTGTLQRQYMLPNVAADKITASQADGVLTITLPKTQPSANDGQIEIQ
>NZ_CP015857.1|WP_003646323.1|2305001_2305457_+|DUF3021-domain-containing-protein
MKRLWHTLLIGAIGGIVIGYLMALGFSTFFNTTYLFPSNPTFVSHWSSPLAATQLSTLLWILIGEVWAFSSWLFEIETWSITKQTIAHCLCSYLGMTPLAILCGWFPLNVRWFGFYTLVYTGAYIGLWLIEMALARIKVIQLNQQLTNHRS
>NZ_CP015857.1|WP_071542797.1|2304720_2305005_+|LytTR-family-transcriptional-regulator
MPLQSVSRFYTANKRLYCETTTGAYLVHSHLHTLMDQLPPHQFLRISSSEIVRIACVKNFTLTKWGSFQVNLTTGTTTYASRRYTQQIRKAAQL
>NZ_CP015857.1|WP_015379645.1|2302977_2303277_-|winged-helix-turn-helix-transcriptional-regulator
MNIEISKQDQADQQRVAIFKALADANRLRIIRVLYQAQREMTCSEVGAQLNISKSTVSYHFKTLRLVGLTNTRRKAQTKYLSLQLATFDRFLPGFLATL
>NZ_CP015857.1|WP_003641738.1|2301719_2302913_-|MFS-transporter
MTTTHQHSRYLTLGMMLAATNMRLPITMMPGLISSLKRTLGLPSSMAGLLTTIPLLTFAIMSPLIAHWGRRFGNELTIYVMLIFLAVGSYLRVIPTIAALFIGTLLVGIGADGGNVLIPAIIKDNFPTKIPVATSQYTLSMLLVGSLGTGLSGVLAAHWSLPLTMAVLSVIGLINLVVWLPNLKYNHRAPTVAMTASDGQSTATHGSVWRRPLAWVVTAFFGLQALVYYSLLTWLPTVFVAHGFSLIVAGNLVTVMQLSGLPMSYLVPATSGHRRGVWAMIMVVGVGFIAGIGGILLSGTNFWVAALSCVLLGLGSGAAFSLAVVFFTQKTTNGFETADLSGMAQSAGYLLAAVGPVLFGWLGGQLGWGPVLWLAIILSALLALSGSIIFQHATIYE
>NZ_CP015857.1|WP_015379641.1|2312038_2312716_-|type-II-A-CRISPR-associated-protein-Csn2
MNITYYPFPPFKIDAGKVNVLDLGNSNMYAEVCQGFRDRIDSVRISNDDLELQTISSQCNWYGDLMLSVDLNRLFLKKVQTQIIKLMADDRQVAVLDENRKVVSQVMEASFLLDLPLDVDESPSLEQILKFTGIHFPTALMNDPRAILEALVQTHVELGLKQKLVLTNVSHYLNQKQWASFEQLVHDLGATVIVIEYSEINRMEKFKNSCYYYVDEDLVDWRDMN
>NZ_CP015857.1|WP_015379640.1|2312712_2313018_-|CRISPR-associated-endonuclease-Cas2
MRLIVMFDVPMDTSEERRAYRHFHKALVREGFLMMQYSTYVRVCVNKKAAEFVEKRIAPLAPKGGKVQTMTVTEKQYQAMHYIQGTPSNDILNSAERTIVI
>NZ_CP015857.1|WP_015379639.1|2312995_2313901_-|type-II-CRISPR-associated-endonuclease-Cas1
MGWRNVIITQHAKVSYSMNRILVQTSSDKYAVPISDIQLLLVGTTQAVITSAALCALTEAHVKVIFTDHQGEPISETNDYYPTRRTADLVRQQVTWPEARIATLWTKNVGSKILNQIQVIDFVGGDTQTLVDELDKLELNDVTNREAVVANKYFSLLFGDQFYRRDFSPINAALNYGYAVLLSMVNREIVLNGYLTCIGIHHENNENEFNLGSDLMEPFRPIVDQWVSQQRFKDFTPDIKIGLVSLLDLEIGFNGHQTIVSHAITEYVAACLHYLSGETEELKIEVKLPNEVSSDAINSHV
>NZ_CP015857.1|WP_064578474.1|2314094_2318171_-|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MKEPYGVGLDIGTNSVGWTVVDASGHVRKIKGQTGIGVRLFKEGAAAADRRGFRTTRRRLKRVKWRLRLLREFFDQPISKVDINFFARRKYSDISPRDPNYNGLEKTLFNDRSDQDFYHDYPTIYHLREALMTQHRKFDVREIYLAIHHIVKYRGNFLRNDAATAYRSGTLDLQQHFETLNHLFSQADLELNLNLTTDVALLDSIKQTLVRTDISRSDRQKLIMPLLAVLTGATTAEKKRQKAVVTEFAKALVGNKTKIDVLTLTDIDATEAKDWAFSLEENQDKLPGIEDRFSEVGQQIIDEVIRLYASVNLAQLIPEGKRFSQSMVEKYKRHGEDLKLLKAYIRSQSDAKRGRAIRATYDQYIDGVKSKQVTQEAFQKALGKFVDADVDLNSWAAQIKQAIDSEQFMPKLRTKQNGAIPYQVQQNELDQIISNQKEYYPWLGEENPVIKRRGKFPYKLDELVGFRVPYYVGPLITKEMQAATANADFAWMVRKADGPITPWNFDDKVDRVASATAFIQRMQTTDTYLIGEEVLPARSLIYQRFMVLNELNNIRVDDGQLTPRQKQRLYNQVFKKHKRVTAKNIQDNLVAAGEFPTAPRITGLADPKVFNSSLSTYHDLKQVLPEAMSDVRKQADIEKIILWSTIFEDSTIFKQKLTEISWLTAAQLKQLGQLRYRGWGQLSRKLLTGLKDDNNRSIMDGLWETNANFMQLRSQPAIENQIKSANQANLTTADLQDTINELYTSPQNKKAIREVMVVLADIKDAMHGQTPNWIFVEAARGGGVAGRRTQSRSKQIVAAYQGTAQAIVRDQVQRELKEKIKNKANFNTRLVLYFLQNGRDLYTGDAINIDRLSEYDIDHILPQSLVKDDSLDNRVLTNARINREKNDTFASEKFGKKMGAKWKEMHRMGLMTKRKLDHLLMRPDEISKYATGFINRQLVETRQVIKLVEELINAEYPSTAIVSVKANLTHQFRQTFDFPKIREVNDYHHAFDAALTAFIGTYLLKRYPKLERFFVYGKFAKQPVNLTRFNVIRKLAKTDTPITDIDTGEVLWDKLTDIKYFETLYDYKRLLVTREVSENYGAMFDQTLLKASDNGKRLIRKKQSFDTAIYGGYTGKTLAYMAIVKVSTKKDVQYQVVGVPTTMVTQIEQLEQQGMTNKQAVTKVIEPLIDANNKKMLTYEVLLPKVRFEQVVRDRIKGQTHRFALGTDTYYHNIQELYLPLTLQRAFLGKQNEYEVQLNQNLLTVFDATLAQVNRYFPLYEMNKFKKILNSARDQIELLEAKNQFVKNKLVLGKQGILTNMFIGLHANASYGDLKVLGVKTDFGKLQVPGGIKLTGDAEIIYQSPTGLFERKIALKDL
>NZ_CP015857.1|WP_011100893.1|2318459_2319242_-|alpha/beta-hydrolase
MRFITSDHVQLDYTDEGQGQPIVILTGFGGAKDIWRAQIPVLIQAGYRVINLDGRCQGLSEHTAKGLRMSRRAVDAHELIEKLQLEQPILLGNSMGAATWFAYVSLYGDTGIKALIDVDQTPRMINTPHWQYGFKQVQWQDIPDYFRMPLGHSTFKHIDDATYARVKAVEAQAPFDAKLMFPLLVNHAVQDWRDVIRQLTVPFLIIAGAKSPFFNPDFAAVTAQMALRGQSVVIPEAGHIVMAEQSAAFNKALLEFLATC
>NZ_CP015857.1|WP_021357178.1|2319266_2319974_-|hypothetical-protein
MVKQGHYAKVSKQKRLRQLKQRRQAQEKRAIMPEMVSEFLQVRYHLTQAAKQRPVMRQMMQRFMAQWLAAGQAELSDNGQTTWSVVALTKQTLQTFNRQLPWQGYALVDQEMARWTAFLNKEVPAVPLSERITLTEALSPATWQACLSEQLAINALLALTGDSRQLGQITTEQVRQLQTSIQTATGIDWEKVAQLLDSTVIAQNTLSEAGLDDKTRQWLEKLKKLTPQDFNDHVE
>NZ_CP015857.1|WP_003641725.1|2320073_2321438_-|amino-acid-permease
MQRKLSTGQMQMIALGGTIGVGLFMGSSSTIKWTGPSVLIAYIVSGAFLYLIMRALGEMLYVDPNTGSFAKFASEYIHPVFGYLTAWSNIFQFVVVGMSEMIALGGYCRYWWPNLPDWIPGLIAIVFLCAANLISVKMFGTLETWFSLIKVVTIILMIIAGLGLIIFGIGNGGHPIGISNLWTHGGFFTGGVKGFVFALAIVLASYQGIELIGVTAGEAENPQSTIVKAIRSTVARILIFYVGAIFVIVSIYPWDKLSQIGSPFVQTFAKIGITAAASIINFVVITASLSGTNSGIYSASRMTYTLAESHQLPRKMTLLNRHGVPFYSVIAIATGILIGVVLNVVLPMFFKDASEIFVMVYSSSVLPGMVPWFVILVSQIAFRKQNAAKMANHPFKMPLSPYSNYLTLAFLALTLVFMFINPETRYSILVGVVFLVIMTLIYFRKYAGNKEETL
>NZ_CP015857.1|WP_021357176.1|2321670_2322141_+|NUDIX-hydrolase
MANYIKEIRALVGHKPIILNTAAGILVNDQQQILLNLRTDTHNWSLPGGYLEYGETYATACVREYKEDSGIDVEVVDRIGIFDKGETAYPNGDVAQTISALFLVKPIGGHVLTQATDETLKLDYFDFDNLPPLLNQQNADMIHAAQEYLQTHSATK
>NZ_CP015857.1|WP_064578475.1|2322095_2323739_-|HIRAN-domain-containing-protein
MERIEAGMSVMTLKKQTYRVIAVINQGQELLVRAHEPETADIEIIPVTTVVQVTEQNSTGDAAVALDTVTVVGERYVDDIVATLTTLRVGMAVLLQRESGNQYDDNAISVWTLQHAKLGYIARYQNQPYAALMDQGQRLYGIVTVLDQQKQHLELMLWRTTAVPSPIEALQIRQRLAKSRTNLGAVPTHSLQTPLGTIVMMCNGHPIKYQQVPLSPWLTPADELHVTKRYLLTPDWSQVPPDSLITCQVTAKADVVQRWQNEHISAAVLTNASSFYVVGISAQTKTGLNDNLVDDAAQPAVIYRVGQVSAHMQAGFMVSWAPFGDPRVQPALKLALHFSSQPLVPYHPVTPSRTNATFTQQELAALLVSALPNYQGGQRLEPSVTTITVEKLRQTLGDQTYHALANYQRHVQLVAGSTEGVNETLLQALIHAVTYHELTTMHYYQPTVGMVDQVIYPIQLFSTTTKDEDDAQLVGCLALYNYETFEIQQVPLTAIARIAIIADPEHPQTTPETESPDWLRIFLHGWNDDFWLGYLVAEWVCKYSWAA
>NZ_CP015857.1|WP_003641722.1|2323982_2324723_-|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein
MVKPIIGIAPGVVTVNSQMFPGRVRDYVNRDYLKSVTDNGGVPLVLPVTTDATTIERYVGMIDGLLLCGGADVAPLTYGEEPQPKLGGVDPERDQYEIALIRATHAVGKPVLGICRGLQILNVCYGGNLYQDMSELPAGQGTLKHMQGQLAAYGMHHVKVVPGTTLAEYLGTTSDAITVNSFHHQAVKQVATGFQVVAQSADQVVEAIEATAGGLQLGVQWHPEMMQQVNSVQARLFAAFMRACVA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP015857_1	1.4\|2311685\|30\|NZ_CP015857\|CRT,CRISPRCasFinder	2311685-2311714	30	NC_006936	Lactobacillus phage phiJL-1, complete genome	14654-14683	0	1.0
NZ_CP015857_1	1.4\|2311685\|30\|NZ_CP015857\|CRT,CRISPRCasFinder	2311685-2311714	30	AY236756	Lactobacillus plantarum bacteriophage phiJL-1, complete genome	14654-14683	0	1.0
NZ_CP015857_1	1.8\|2311949\|30\|NZ_CP015857\|CRT,CRISPRCasFinder	2311949-2311978	30	NZ_CP015341	Lactobacillus brevis strain 100D8 plasmid unnamed3, complete sequence	30045-30074	0	1.0
NZ_CP015857_1	1.8\|2311949\|30\|NZ_CP015857\|CRT,CRISPRCasFinder	2311949-2311978	30	NC_019489	Lactobacillus phage Sha1, complete genome	6422-6451	0	1.0
NZ_CP015857_1	1.5\|2311751\|30\|NZ_CP015857\|CRT,CRISPRCasFinder	2311751-2311780	30	NZ_CP025224	Enterococcus sp. CR-Ec1 plasmid pCREc1, complete sequence	45686-45715	6	0.8
NZ_CP015857_1	1.5\|2311751\|30\|NZ_CP015857\|CRT,CRISPRCasFinder	2311751-2311780	30	NC_018510	Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence	146460-146489	6	0.8
NZ_CP015857_1	1.5\|2311751\|30\|NZ_CP015857\|CRT,CRISPRCasFinder	2311751-2311780	30	NC_019754	Crinalium epipsammum PCC 9333 plasmid pCRI9333.03, complete sequence	5336-5365	6	0.8
NZ_CP015857_1	1.5\|2311751\|30\|NZ_CP015857\|CRT,CRISPRCasFinder	2311751-2311780	30	NZ_CP013700	Clostridium botulinum strain AM1195 plasmid pRSJ11_1, complete sequence	38555-38584	6	0.8
NZ_CP015857_1	1.5\|2311751\|30\|NZ_CP015857\|CRT,CRISPRCasFinder	2311751-2311780	30	NZ_CP013280	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence	13062-13091	6	0.8
NZ_CP015857_1	1.5\|2311751\|30\|NZ_CP015857\|CRT,CRISPRCasFinder	2311751-2311780	30	NZ_CP039726	Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence	22113-22142	6	0.8
NZ_CP015857_1	1.5\|2311751\|30\|NZ_CP015857\|CRT,CRISPRCasFinder	2311751-2311780	30	NZ_CP009350	Bacillus thuringiensis HD1002 plasmid 4, complete sequence	41892-41921	6	0.8
NZ_CP015857_1	1.6\|2311817\|30\|NZ_CP015857\|CRT,CRISPRCasFinder	2311817-2311846	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	258656-258685	7	0.767
NZ_CP015857_1	1.6\|2311817\|30\|NZ_CP015857\|CRT,CRISPRCasFinder	2311817-2311846	30	KX712143	Sulfolobus islandicus rudivirus 3 isolate SIRV3, complete genome	30474-30503	8	0.733
NZ_CP015857_1	1.3\|2311619\|30\|NZ_CP015857\|CRT,CRISPRCasFinder	2311619-2311648	30	MK448723	Streptococcus phage Javan271, complete genome	33973-34002	9	0.7
NZ_CP015857_1	1.6\|2311817\|30\|NZ_CP015857\|CRT,CRISPRCasFinder	2311817-2311846	30	NZ_AP019800	Vibrio rotiferianus strain AM7 plasmid pAM7, complete sequence	207517-207546	9	0.7

1. spacer 1.4|2311685|30|NZ_CP015857|CRT,CRISPRCasFinder matches to NC_006936 (Lactobacillus phage phiJL-1, complete genome) position: , mismatch: 0, identity: 1.0

tcgcgccgcgaaacattggacagacttagt	CRISPR spacer
tcgcgccgcgaaacattggacagacttagt	Protospacer
******************************

2. spacer 1.4|2311685|30|NZ_CP015857|CRT,CRISPRCasFinder matches to AY236756 (Lactobacillus plantarum bacteriophage phiJL-1, complete genome) position: , mismatch: 0, identity: 1.0

tcgcgccgcgaaacattggacagacttagt	CRISPR spacer
tcgcgccgcgaaacattggacagacttagt	Protospacer
******************************

3. spacer 1.8|2311949|30|NZ_CP015857|CRT,CRISPRCasFinder matches to NZ_CP015341 (Lactobacillus brevis strain 100D8 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gatgatgagcgtatgattcagcaagccatg	CRISPR spacer
gatgatgagcgtatgattcagcaagccatg	Protospacer
******************************

4. spacer 1.8|2311949|30|NZ_CP015857|CRT,CRISPRCasFinder matches to NC_019489 (Lactobacillus phage Sha1, complete genome) position: , mismatch: 0, identity: 1.0

gatgatgagcgtatgattcagcaagccatg	CRISPR spacer
gatgatgagcgtatgattcagcaagccatg	Protospacer
******************************

5. spacer 1.5|2311751|30|NZ_CP015857|CRT,CRISPRCasFinder matches to NZ_CP025224 (Enterococcus sp. CR-Ec1 plasmid pCREc1, complete sequence) position: , mismatch: 6, identity: 0.8

tgatcaaacagtttataacaagttaaaaga	CRISPR spacer
agatccaacagttgataacaagttgacgga	Protospacer
 **** ******* **********.* .**

6. spacer 1.5|2311751|30|NZ_CP015857|CRT,CRISPRCasFinder matches to NC_018510 (Bacillus thuringiensis HD-789 plasmid pBTHD789-3, complete sequence) position: , mismatch: 6, identity: 0.8

tgatcaaacagtttataacaagttaaaaga	CRISPR spacer
taaaaaagaagtttataacaaattaaaaga	Protospacer
*.*  **. ************.********

7. spacer 1.5|2311751|30|NZ_CP015857|CRT,CRISPRCasFinder matches to NC_019754 (Crinalium epipsammum PCC 9333 plasmid pCRI9333.03, complete sequence) position: , mismatch: 6, identity: 0.8

tgatcaaacagtttataacaagttaaaaga	CRISPR spacer
agttaaaacagtttgtaacaagtaaaaata	Protospacer
 * * *********.******** **** *

8. spacer 1.5|2311751|30|NZ_CP015857|CRT,CRISPRCasFinder matches to NZ_CP013700 (Clostridium botulinum strain AM1195 plasmid pRSJ11_1, complete sequence) position: , mismatch: 6, identity: 0.8

tgatcaaacagtttataacaagttaaaaga	CRISPR spacer
tgaaatattagtttataacaagttaataga	Protospacer
***   * .***************** ***

9. spacer 1.5|2311751|30|NZ_CP015857|CRT,CRISPRCasFinder matches to NZ_CP013280 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-5-100K, complete sequence) position: , mismatch: 6, identity: 0.8

tgatcaaacagtttataacaagttaaaaga	CRISPR spacer
taaaaaagaagtttataacaaattaaaaga	Protospacer
*.*  **. ************.********

10. spacer 1.5|2311751|30|NZ_CP015857|CRT,CRISPRCasFinder matches to NZ_CP039726 (Bacillus thuringiensis strain BT-59 plasmid p5, complete sequence) position: , mismatch: 6, identity: 0.8

tgatcaaacagtttataacaagttaaaaga	CRISPR spacer
taaaaaagaagtttataacaaattaaaaga	Protospacer
*.*  **. ************.********

11. spacer 1.5|2311751|30|NZ_CP015857|CRT,CRISPRCasFinder matches to NZ_CP009350 (Bacillus thuringiensis HD1002 plasmid 4, complete sequence) position: , mismatch: 6, identity: 0.8

tgatcaaacagtttataacaagttaaaaga	CRISPR spacer
taaaaaagaagtttataacaaattaaaaga	Protospacer
*.*  **. ************.********

12. spacer 1.6|2311817|30|NZ_CP015857|CRT,CRISPRCasFinder matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 7, identity: 0.767

agaagatatatgttccaga-----tactaattctg	CRISPR spacer
agaagatatattttccagataaagtaccaa-----	Protospacer
*********** *******     ***.**

13. spacer 1.6|2311817|30|NZ_CP015857|CRT,CRISPRCasFinder matches to KX712143 (Sulfolobus islandicus rudivirus 3 isolate SIRV3, complete genome) position: , mismatch: 8, identity: 0.733

agaagatatatgttccagatactaattctg	CRISPR spacer
atttttttcattttccagatactaattctg	Protospacer
*     * .** ******************

14. spacer 1.3|2311619|30|NZ_CP015857|CRT,CRISPRCasFinder matches to MK448723 (Streptococcus phage Javan271, complete genome) position: , mismatch: 9, identity: 0.7

tgctttcgtttttaagttgtccgcctaact	CRISPR spacer
aatcaatgatttcaagttgtccgcctaact	Protospacer
 ...  .* ***.*****************

15. spacer 1.6|2311817|30|NZ_CP015857|CRT,CRISPRCasFinder matches to NZ_AP019800 (Vibrio rotiferianus strain AM7 plasmid pAM7, complete sequence) position: , mismatch: 9, identity: 0.7

agaagatatatgttccagatactaattctg	CRISPR spacer
gagcaatatgttttccagatactaattcac	Protospacer
... .****.* ****************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

80817 : 89328

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645861.1\|80817_81300_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0
WP_027822323.1\|81283_82414_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003642587.1\|82416_83148_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
WP_003642588.1\|83149_83404_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_015380736.1\|83403_84084_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_021356102.1\|84076_86296_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.5e-144	39.1
WP_027822324.1\|86280_87735_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	7.3e-50	33.8
WP_015380733.1\|87731_88757_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.2e-59	41.0
WP_003645867.1\|88749_89328_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9

DBSCAN-SWA_2

254349 : 347005

106

Lactobacillus_phage(48.72%)

portal,integrase,terminase,head,holin,transposase,tail,capsid

attL 289777:289798|attR 343377:343393

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086989537.1\|254349_255124_+\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
WP_064578048.1\|255291_256482_-	GGDEF domain-containing protein	NA	NA	NA	NA
WP_003642741.1\|256705_256936_+	hypothetical protein	NA	NA	NA	NA
WP_003642742.1\|256961_257183_+	hypothetical protein	NA	NA	NA	NA
WP_015380658.1\|257329_257794_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_015380657.1\|258015_258909_+	C40 family peptidase	NA	NA	NA	NA
WP_015380656.1\|258975_259839_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003642746.1\|260400_260565_+	hypothetical protein	NA	NA	NA	NA
WP_003642747.1\|260623_261367_+	NUDIX hydrolase	NA	NA	NA	NA
WP_003642748.1\|261472_262660_+	MFS transporter	NA	NA	NA	NA
WP_003644671.1\|262873_263191_+	hypothetical protein	NA	NA	NA	NA
WP_003642750.1\|263266_263827_+	ECF transporter S component	NA	NA	NA	NA
WP_011101810.1\|264583_265522_-	EamA family transporter	NA	NA	NA	NA
WP_015380652.1\|265718_265988_+	ACT domain-containing protein	NA	NA	NA	NA
WP_003642754.1\|265997_267341_+	PFL family protein	NA	NA	NA	NA
WP_003646617.1\|267713_268442_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.1e-34	37.1
WP_003642756.1\|268438_269962_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_064578049.1\|270257_271439_+	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	3.9e-46	29.9
WP_003642758.1\|271674_272532_+	GRP family sugar transporter	NA	NA	NA	NA
WP_003642759.1\|272752_274105_+	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_154811976.1\|274596_275372_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
WP_064578051.1\|275376_275577_+	hypothetical protein	NA	NA	NA	NA
WP_064578052.1\|275981_277976_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	7.2e-32	41.3
WP_003642762.1\|277993_279571_+	glycosyltransferase	NA	NA	NA	NA
WP_064578053.1\|279542_281306_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.8e-96	40.9
WP_003639252.1\|282246_282390_+	hypothetical protein	NA	NA	NA	NA
WP_011101805.1\|282748_282892_+	hypothetical protein	NA	NA	NA	NA
WP_064578054.1\|283579_286300_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_003642771.1\|288420_288906_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_015380646.1\|288954_289227_-	hypothetical protein	NA	NA	NA	NA
WP_003642773.1\|289251_289485_-	hypothetical protein	NA	NA	NA	NA
289777:289798	attL	NA	NA	NA	NA
WP_064578055.1\|289944_291102_-\|integrase	site-specific integrase	Q938N9	Temperate_phage	2.3e-54	34.5
289777:289798	attL	NA	NA	NA	NA
WP_050480169.1\|291172_291886_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_064578056.1\|292032_292212_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_027823049.1\|292481_292709_+	hypothetical protein	NA	NA	NA	NA
WP_054519349.1\|292722_293523_+	bifunctional DNA primase/polymerase	NA	NA	NA	NA
WP_064578057.1\|293522_294917_+	virulence protein	A0A0A7RTG3	Clostridium_phage	9.0e-66	33.4
WP_027823041.1\|295061_295541_+	hypothetical protein	NA	NA	NA	NA
WP_027823040.1\|295555_295747_+	hypothetical protein	NA	NA	NA	NA
WP_054519350.1\|295733_296072_+\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	1.9e-09	36.6
WP_064578058.1\|297149_297623_+\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_064578059.1\|297619_299323_+\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	1.2e-120	40.1
WP_054519337.1\|299477_300578_+\|portal	phage portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	1.0e-48	33.6
WP_054519336.1\|300574_302116_+\|capsid	phage major capsid protein	B8R651	Lactobacillus_phage	1.1e-45	26.0
WP_027823052.1\|302525_302795_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_024971530.1\|302952_303324_+	hypothetical protein	NA	NA	NA	NA
WP_015380645.1\|304128_304335_+	hypothetical protein	NA	NA	NA	NA
303801:303822	attR	NA	NA	NA	NA
WP_064578062.1\|304685_305807_-\|integrase	site-specific integrase	D6PSS4	Lactobacillus_phage	1.3e-46	32.7
303801:303822	attR	NA	NA	NA	NA
WP_063490409.1\|305926_306754_-	DUF3037 domain-containing protein	NA	NA	NA	NA
WP_099739059.1\|306756_307551_-	hypothetical protein	NA	NA	NA	NA
WP_076636272.1\|307927_308104_-	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	2.6e-10	51.7
WP_063722276.1\|308423_308615_+	hypothetical protein	NA	NA	NA	NA
WP_064578064.1\|308874_309510_-	DUF2304 domain-containing protein	NA	NA	NA	NA
WP_080474029.1\|309665_310091_-	ImmA/IrrE family metallo-endopeptidase	D6PSS8	Lactobacillus_phage	6.2e-26	46.8
WP_064578065.1\|310087_310435_-	helix-turn-helix domain-containing protein	A8ASM2	Listeria_phage	5.1e-10	37.8
WP_064578066.1\|310592_310796_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_080474030.1\|310863_311034_+	hypothetical protein	NA	NA	NA	NA
WP_064578067.1\|311045_311351_+	DUF771 domain-containing protein	NA	NA	NA	NA
WP_046947674.1\|311417_311930_+	helix-turn-helix transcriptional regulator	D6PST4	Lactobacillus_phage	2.1e-28	42.9
WP_187337847.1\|312038_312185_+	hypothetical protein	E9LUT9	Lactobacillus_phage	2.9e-15	87.2
WP_064578068.1\|312184_312442_+	hypothetical protein	NA	NA	NA	NA
WP_064578069.1\|312438_312825_+	hypothetical protein	NA	NA	NA	NA
WP_064578071.1\|312821_313721_+	recombinase RecT	E9LUM3	Lactobacillus_phage	2.3e-62	47.4
WP_187337853.1\|313752_314505_+	PD-(D/E)XK nuclease-like domain-containing protein	A0A0P0IZH9	Lactobacillus_phage	2.7e-72	51.4
WP_064578075.1\|314585_315494_+	DnaD domain protein	NA	NA	NA	NA
WP_064578077.1\|315490_315778_+	hypothetical protein	NA	NA	NA	NA
WP_064578078.1\|315774_316497_+	phage antirepressor KilAC domain-containing protein	A0A141E1D3	Streptococcus_phage	5.5e-51	46.4
WP_064578079.1\|316501_317020_+	hypothetical protein	O03915	Lactobacillus_phage	3.9e-38	53.6
WP_064578080.1\|317016_317391_+	hypothetical protein	NA	NA	NA	NA
WP_056953070.1\|317393_317705_+	hypothetical protein	A0A2P0ZLB4	Lactobacillus_phage	7.2e-48	90.3
WP_154811977.1\|317867_318017_+	hypothetical protein	NA	NA	NA	NA
WP_064578081.1\|318256_318727_+	hypothetical protein	B4XYT9	Lactobacillus_phage	1.4e-15	40.0
WP_103420664.1\|318962_319130_+	BC1881 family protein	NA	NA	NA	NA
WP_064578082.1\|319418_320609_+	AAA family ATPase	C7BGE8	Burkholderia_phage	3.0e-33	28.3
WP_064578083.1\|320605_321349_+	HNH endonuclease	NA	NA	NA	NA
WP_080474032.1\|321458_321626_+	hypothetical protein	NA	NA	NA	NA
WP_064578084.1\|321604_321817_+	hypothetical protein	A0A1C8E971	Bacillus_phage	1.4e-26	72.9
WP_064578085.1\|321866_322118_+	hypothetical protein	NA	NA	NA	NA
WP_064578086.1\|322208_322724_+\|terminase	terminase small subunit	O03926	Lactobacillus_phage	5.7e-50	70.1
WP_064578087.1\|322716_324006_+\|terminase	PBSX family phage terminase large subunit	A0A2H4IYR5	uncultured_Caudovirales_phage	2.8e-114	49.8
WP_080474033.1\|323995_325672_+\|portal	phage portal protein	D2IYW2	Enterococcus_phage	3.7e-66	32.9
WP_064578088.1\|325685_326630_+\|capsid	minor capsid protein	NA	NA	NA	NA
WP_064578089.1\|326738_327386_+	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_064578090.1\|327399_328470_+	hypothetical protein	A0A0P0HSG2	Acinetobacter_phage	1.7e-40	33.2
WP_064578091.1\|328484_328835_+\|head,tail	phage head-tail connector protein	NA	NA	NA	NA
WP_080474089.1\|328839_329163_+	hypothetical protein	NA	NA	NA	NA
WP_064578093.1\|329152_329707_+	hypothetical protein	NA	NA	NA	NA
WP_074029844.1\|329708_330095_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_064578095.1\|330106_330694_+	hypothetical protein	NA	NA	NA	NA
WP_064578096.1\|330711_331224_+	hypothetical protein	NA	NA	NA	NA
WP_064578097.1\|331292_331529_+	hypothetical protein	NA	NA	NA	NA
WP_064578098.1\|331528_335455_+	tape measure protein	E9LUR1	Lactobacillus_phage	7.9e-83	48.4
WP_064578099.1\|335464_336361_+\|tail	phage tail family protein	A8ATA8	Listeria_phage	3.5e-18	29.3
WP_187337848.1\|336360_337539_+\|tail	phage tail protein	A0A0M7RDS2	Lactobacillus_phage	3.6e-23	29.1
WP_064578101.1\|337535_337799_+	hypothetical protein	NA	NA	NA	NA
WP_064578102.1\|337785_338085_+	hypothetical protein	NA	NA	NA	NA
WP_064578103.1\|338085_340002_+	metallophosphoesterase	A0A2K9VD08	Lactobacillus_phage	1.3e-51	35.1
WP_064578104.1\|340017_340761_+	hypothetical protein	NA	NA	NA	NA
WP_080474034.1\|340757_341066_+	DUF2977 domain-containing protein	E0Y3M4	Staphylococcus_virus	2.0e-05	31.7
WP_080474035.1\|341062_341203_+	XkdX family protein	NA	NA	NA	NA
WP_064578620.1\|341329_342445_+	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	6.8e-32	66.7
WP_060418016.1\|342445_342742_+	hypothetical protein	A0A1I9KK55	Lactobacillus_phage	2.0e-39	77.6
WP_064578106.1\|342728_343103_+\|holin	holin	A0A2P0ZLG6	Lactobacillus_phage	1.5e-15	72.4
WP_064578107.1\|343580_344432_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_011101730.1\|344654_345047_+	YxeA family protein	NA	NA	NA	NA
WP_003644665.1\|345274_347005_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.6e-46	27.6

DBSCAN-SWA_3

631357 : 717831

Lactobacillus_phage(78.85%)

lysis,portal,integrase,terminase,tRNA,holin,protease,transposase,tail,capsid

attL 624410:624427|attR 692233:692250

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
624410:624427	attL	NA	NA	NA	NA
WP_064578146.1\|631357_632521_-\|integrase	site-specific integrase	B4XYR4	Lactobacillus_phage	5.4e-56	36.5
WP_027822546.1\|633568_633751_-	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	8.8e-14	66.7
WP_003641358.1\|634056_634257_-	hypothetical protein	E9LUS6	Lactobacillus_phage	4.9e-26	100.0
WP_064578147.1\|634271_635150_-	HIRAN domain-containing protein	A0A2H4J549	uncultured_Caudovirales_phage	3.0e-06	34.8
WP_003641360.1\|635212_635602_-	ImmA/IrrE family metallo-endopeptidase	D6PSS8	Lactobacillus_phage	4.6e-36	54.3
WP_003641361.1\|635632_635959_-	helix-turn-helix transcriptional regulator	A0A1B0Y2R0	Lactobacillus_phage	6.9e-17	44.1
WP_003644552.1\|636215_636431_+	hypothetical protein	NA	NA	NA	NA
WP_027823017.1\|637301_637553_-	hypothetical protein	NA	NA	NA	NA
WP_050339257.1\|639189_639399_+	hypothetical protein	NA	NA	NA	NA
WP_154811978.1\|639411_639576_+	hypothetical protein	NA	NA	NA	NA
WP_164882561.1\|639799_639964_+	hypothetical protein	NA	NA	NA	NA
WP_064578149.1\|640101_640479_-	hypothetical protein	NA	NA	NA	NA
WP_027823021.1\|640536_640797_+	hypothetical protein	NA	NA	NA	NA
WP_064578150.1\|640938_641187_+	hypothetical protein	E9LUT6	Lactobacillus_phage	1.9e-35	84.1
WP_057138670.1\|641189_641390_+	hypothetical protein	E9LUT7	Lactobacillus_phage	2.9e-26	87.9
WP_064578151.1\|641401_641626_+	hypothetical protein	E9LUT8	Lactobacillus_phage	7.0e-29	87.7
WP_164882560.1\|641674_641821_+	hypothetical protein	E9LUT9	Lactobacillus_phage	1.4e-17	95.7
WP_064578152.1\|641820_642681_+	DUF1351 domain-containing protein	A0A0P0IV40	Lactobacillus_phage	1.4e-32	35.6
WP_056953065.1\|642680_643307_+	ERF family protein	D7RWM8	Brochothrix_phage	2.3e-13	37.4
WP_064578153.1\|643303_643765_+	single-stranded DNA-binding protein	A0A218MNB4	uncultured_virus	1.1e-39	70.9
WP_064578154.1\|643779_644472_+	hypothetical protein	E9LUU3	Lactobacillus_phage	5.0e-118	88.7
WP_064578155.1\|645288_646074_+	ATP-binding protein	E9LUN6	Lactobacillus_phage	1.6e-131	90.4
WP_064578156.1\|646209_646518_+	hypothetical protein	E9LUN7	Lactobacillus_phage	1.3e-46	90.2
WP_128468352.1\|646510_646669_+	hypothetical protein	A0A2P0ZLB5	Lactobacillus_phage	1.9e-17	90.4
WP_153629594.1\|646671_646818_+	hypothetical protein	NA	NA	NA	NA
WP_080474041.1\|646810_647239_+	hypothetical protein	Q5ULU9	Lactobacillus_virus	3.1e-73	87.9
WP_056953073.1\|647446_647758_+	hypothetical protein	A0A2P0ZLD0	Lactobacillus_phage	8.5e-49	93.2
WP_064578158.1\|647769_648183_+	hypothetical protein	A0A2P0ZLC0	Lactobacillus_phage	8.9e-70	98.5
WP_064578159.1\|648258_648960_+	hypothetical protein	NA	NA	NA	NA
WP_060811411.1\|649858_650059_+	hypothetical protein	A0A2P0ZLC2	Lactobacillus_phage	5.1e-15	86.4
WP_063730053.1\|650042_650381_+	HNH endonuclease	A0A2P0ZLC6	Lactobacillus_phage	6.6e-63	98.2
WP_064578160.1\|650380_650623_+	hypothetical protein	A0A2P0ZLD3	Lactobacillus_phage	2.5e-32	82.5
WP_054396974.1\|650640_650883_+	hypothetical protein	A0A2P0ZLD2	Lactobacillus_phage	6.8e-38	95.0
WP_064578161.1\|651275_652955_+\|terminase	terminase large subunit	A0A2P0ZLE5	Lactobacillus_phage	0.0e+00	97.9
WP_050339977.1\|652973_654116_+\|portal	phage portal protein	A0A2P0ZLC9	Lactobacillus_phage	4.0e-213	97.6
WP_064578162.1\|654102_654825_+\|protease	Clp protease ClpP	A0A2P0ZLE3	Lactobacillus_phage	5.3e-94	74.2
WP_064578163.1\|654847_656020_+\|capsid	phage major capsid protein	A0A2P0ZLD6	Lactobacillus_phage	1.0e-110	54.8
WP_056953089.1\|656191_656449_+	hypothetical protein	A0A2P0ZLD5	Lactobacillus_phage	4.2e-38	95.3
WP_056953084.1\|656429_656819_+	hypothetical protein	A0A2P0ZLD1	Lactobacillus_phage	5.8e-63	89.1
WP_064578164.1\|656815_657223_+	HK97 gp10 family phage protein	A0A2P0ZLD7	Lactobacillus_phage	2.0e-66	94.1
WP_003643909.1\|657219_657642_+	hypothetical protein	A0A2P0ZLE4	Lactobacillus_phage	7.4e-72	98.6
WP_064578165.1\|657656_658268_+\|tail	phage tail protein	A0A2P0ZLF5	Lactobacillus_phage	4.3e-105	96.1
WP_064578166.1\|658360_658675_+	hypothetical protein	A0A2P0ZLF3	Lactobacillus_phage	7.0e-51	95.2
WP_054396950.1\|658698_658920_+	hypothetical protein	A0A2P0ZLD9	Lactobacillus_phage	1.0e-32	100.0
WP_064578167.1\|658938_663483_+\|tail	phage tail tape measure protein	A0A2P0ZLF1	Lactobacillus_phage	0.0e+00	90.4
WP_064578168.1\|663486_664308_+\|tail	phage tail family protein	A0A2P0ZLE2	Lactobacillus_phage	1.2e-150	96.3
WP_054519015.1\|669330_669822_+	DUF1617 family protein	A0A2P0ZLE0	Lactobacillus_phage	1.3e-48	63.8
WP_064578169.1\|669823_670258_+	hypothetical protein	A0A2P0ZLE9	Lactobacillus_phage	3.7e-58	80.6
WP_064578170.1\|670274_670655_+	hypothetical protein	A0A2P0ZLF7	Lactobacillus_phage	2.7e-49	75.2
WP_015380197.1\|670660_670870_+	hypothetical protein	A0A2P0ZLG4	Lactobacillus_phage	1.3e-08	58.0
WP_064578171.1\|670869_671154_+\|lysis	lysis protein	A0A2P0ZLE8	Lactobacillus_phage	2.0e-41	96.8
WP_080474043.1\|671153_672212_+	LysM peptidoglycan-binding domain-containing protein	A0A2P0ZLG2	Lactobacillus_phage	2.7e-115	71.3
WP_003644510.1\|672211_672475_+	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	2.0e-38	100.0
WP_064578172.1\|672487_672865_+\|holin	holin	A0A2K9VCG4	Lactobacillus_phage	3.7e-14	63.8
WP_064578173.1\|674108_675320_+	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_016527118.1\|675798_677541_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_064578174.1\|677559_678351_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.3e-29	36.3
WP_064578175.1\|679554_680127_+\|transposase	transposase	NA	NA	NA	NA
WP_003645635.1\|680826_681768_-	glycosyltransferase family 2 protein	V9QJB1	Oenococcus_phage	3.1e-78	48.7
WP_015640487.1\|682213_682606_-	hypothetical protein	NA	NA	NA	NA
WP_003645633.1\|682769_683162_+	hypothetical protein	NA	NA	NA	NA
WP_064578176.1\|683197_684367_+	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_003645631.1\|684416_685046_-	hypothetical protein	NA	NA	NA	NA
WP_089197934.1\|685363_685594_+	DNA alkylation repair protein	NA	NA	NA	NA
WP_003640747.1\|685683_686316_-	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	2.3e-16	56.2
WP_003644501.1\|686467_686707_+	DUF896 domain-containing protein	NA	NA	NA	NA
WP_003640745.1\|686804_687041_+	YneF family protein	NA	NA	NA	NA
WP_003645630.1\|687097_687733_-	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_003645629.1\|687844_688603_+\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_003645628.1\|688586_688892_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_003640741.1\|688976_689975_+	D-2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	2.3e-47	34.9
WP_064578177.1\|690247_691003_-	HAD family hydrolase	NA	NA	NA	NA
WP_003640739.1\|691227_692031_+	30S ribosomal protein S2	NA	NA	NA	NA
WP_064578178.1\|692133_693012_+	elongation factor Ts	NA	NA	NA	NA
692233:692250	attR	NA	NA	NA	NA
WP_003640737.1\|693211_693934_+	UMP kinase	NA	NA	NA	NA
WP_003640736.1\|693935_694499_+	ribosome recycling factor	NA	NA	NA	NA
WP_003640735.1\|694618_695398_+	isoprenyl transferase	R9W0U9	Flavobacterium_phage	1.1e-23	43.1
WP_064578179.1\|695413_696199_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_003640733.1\|696236_697514_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_003640732.1\|697553_699263_+\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_003640729.1\|699756_704070_+	DNA polymerase III subunit alpha	A0A1X9SH08	Bradyrhizobium_phage	1.0e-14	34.0
WP_003640728.1\|704365_704842_+	ribosome maturation factor RimP	NA	NA	NA	NA
WP_064578180.1\|704862_706080_+	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_003640726.1\|706124_706424_+	YlxR family protein	NA	NA	NA	NA
WP_003640725.1\|706413_706719_+	ribosomal L7Ae/L30e/S12e/Gadd45 family protein	NA	NA	NA	NA
WP_003645962.1\|706733_709310_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	9.6e-21	23.3
WP_003640723.1\|709332_709686_+	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_003645963.1\|710334_711789_+	MFS transporter	NA	NA	NA	NA
WP_003640721.1\|711781_712951_+	chorismate synthase	NA	NA	NA	NA
WP_064578181.1\|712959_713487_+	hypothetical protein	NA	NA	NA	NA
WP_064578182.1\|713500_714799_+	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_064578183.1\|714801_715899_+	prephenate dehydrogenase	NA	NA	NA	NA
WP_003645967.1\|715901_716423_+	shikimate kinase	NA	NA	NA	NA
WP_003645968.1\|716907_717831_+\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA

DBSCAN-SWA_4

1216348 : 1227387

Lactobacillus_phage(77.78%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645220.1\|1216348_1217344_-	glycosyltransferase family 2 protein	S5FKN0	Shigella_phage	3.1e-52	38.8
WP_015380221.1\|1217970_1218108_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_003643094.1\|1218203_1218644_+	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	8.0e-77	99.3
WP_003643095.1\|1218714_1219275_-	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	2.7e-101	100.0
WP_064578262.1\|1219362_1221801_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.4
WP_003643097.1\|1221803_1222418_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_003643099.1\|1222761_1223709_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
WP_015640259.1\|1223894_1224866_+	Nisin resistance protein	A0A2P0ZL68	Lactobacillus_phage	2.0e-181	98.8
WP_015640258.1\|1224956_1226186_-	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	2.7e-215	97.7
WP_004271307.1\|1226463_1227387_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	6.7e-33	31.9

DBSCAN-SWA_5

1593582 : 1663163

Lactobacillus_phage(20.0%)

protease,transposase,tRNA,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021357097.1\|1593582_1593912_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_015379975.1\|1594047_1595376_-	glucarate dehydratase	NA	NA	NA	NA
WP_015379974.1\|1595524_1596418_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_043992670.1\|1596566_1597544_+	hydroxyacid dehydrogenase	A0A285PXZ1	Cedratvirus	2.1e-32	32.3
WP_064578324.1\|1597558_1598956_+	anion permease	NA	NA	NA	NA
WP_015379971.1\|1599512_1600847_-	gluconate transporter	NA	NA	NA	NA
WP_061871768.1\|1601096_1602311_+	mandelate racemase/muconate lactonizing enzyme family protein	Q6A202	Oenococcus_phage	2.5e-48	33.6
WP_015379969.1\|1602326_1603469_+	lactonase family protein	NA	NA	NA	NA
WP_003644074.1\|1603561_1604230_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_016526995.1\|1604361_1604931_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003641207.1\|1604981_1605746_-	YibE/F family protein	NA	NA	NA	NA
WP_080474062.1\|1605742_1606993_-	YibE/F family protein	NA	NA	NA	NA
WP_015379965.1\|1606956_1607958_-	hypothetical protein	NA	NA	NA	NA
WP_187337841.1\|1608377_1609160_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_003641203.1\|1609494_1609821_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_015379963.1\|1610012_1610894_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_015379962.1\|1610936_1612745_-	DNA helicase RecQ	M1PGQ0	Moumouvirus	1.0e-77	36.1
WP_003641200.1\|1613002_1613200_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003644064.1\|1613419_1613686_+	hypothetical protein	NA	NA	NA	NA
WP_064578326.1\|1613736_1614969_+	hypothetical protein	NA	NA	NA	NA
WP_003641197.1\|1615004_1616411_+	C69 family dipeptidase	NA	NA	NA	NA
WP_015379959.1\|1616862_1617870_+	aspartate--ammonia ligase	A0A1C9C5F0	Heterosigma_akashiwo_virus	1.4e-63	43.0
WP_003645743.1\|1617908_1619204_+\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	4.2e-57	31.2
WP_043992667.1\|1619264_1619882_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_003641193.1\|1619990_1620464_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_011101224.1\|1620739_1622629_-	FAD-binding protein	A0A2P0ZL82	Lactobacillus_phage	5.2e-16	26.2
WP_064578327.1\|1622815_1623742_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	5.0e-20	25.2
WP_064578328.1\|1624462_1625215_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_187337854.1\|1625864_1625984_-	putative metal homeostasis protein	NA	NA	NA	NA
WP_064578329.1\|1626192_1629762_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_053267329.1\|1629876_1630407_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_154811976.1\|1630761_1631537_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
WP_154811980.1\|1631587_1632271_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_016511035.1\|1632251_1632761_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_154811976.1\|1633248_1634023_+\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
WP_080474064.1\|1634695_1635892_-	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	4.6e-10	25.5
WP_016526986.1\|1637488_1640362_-	type I restriction endonuclease subunit R	NA	NA	NA	NA
WP_003645758.1\|1640589_1643124_-	M1 family metallopeptidase	A0A0P0IY26	Acinetobacter_phage	3.5e-68	27.4
WP_003644050.1\|1643305_1643878_-	hypothetical protein	NA	NA	NA	NA
WP_003644049.1\|1643983_1644316_-	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_003645760.1\|1644677_1645688_-	DUF4767 domain-containing protein	NA	NA	NA	NA
WP_016511031.1\|1645819_1646620_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_003641176.1\|1646823_1647264_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_003644046.1\|1647324_1647747_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_003641174.1\|1647761_1647944_-	hypothetical protein	NA	NA	NA	NA
WP_003644045.1\|1647956_1648502_-	alkaline shock response membrane anchor protein AmaP	NA	NA	NA	NA
WP_003641172.1\|1648513_1648768_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_003645763.1\|1649008_1650856_-	acetyltransferase	A0A1R3Y5Q6	Salmonella_virus	5.8e-20	23.7
WP_003645764.1\|1650845_1651229_-	hypothetical protein	NA	NA	NA	NA
WP_064578331.1\|1654488_1655787_+	MFS transporter	NA	NA	NA	NA
WP_154811981.1\|1655863_1656739_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.1e-20	28.9
WP_003645769.1\|1657610_1657955_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_015379934.1\|1658174_1658858_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641165.1\|1659423_1659792_+	helix-turn-helix transcriptional regulator	E9LUL4	Lactobacillus_phage	5.9e-17	42.7
WP_015379932.1\|1660025_1660394_+	hypothetical protein	NA	NA	NA	NA
WP_015640090.1\|1660930_1662355_+	hypothetical protein	NA	NA	NA	NA
WP_154811976.1\|1662387_1663163_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2

DBSCAN-SWA_6

1860281 : 1868905

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_064578369.1\|1860281_1861277_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	1.0e-50	37.9
WP_003640969.1\|1861415_1862201_-	acyl-ACP thioesterase	NA	NA	NA	NA
WP_064578370.1\|1862204_1863101_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	2.2e-81	55.7
WP_003640967.1\|1863199_1863547_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
WP_003640966.1\|1863571_1864591_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
WP_003640965.1\|1864607_1864937_-	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_064578371.1\|1864933_1865599_-	dTMP kinase	M1PSC7	Streptococcus_phage	2.5e-53	52.7
WP_003640957.1\|1865996_1866248_-	YaaL family protein	NA	NA	NA	NA
WP_003637790.1\|1866262_1866862_-	recombination protein RecR	NA	NA	NA	NA
WP_003640956.1\|1866877_1867186_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003643940.1\|1867207_1868905_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0

DBSCAN-SWA_7

2392295 : 2404743

Staphylococcus_phage(37.5%)

portal,integrase,terminase,head,tail,capsid

attL 2394565:2394578|attR 2404937:2404950

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033611500.1\|2392295_2392565_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_064578490.1\|2392682_2394257_-\|capsid	phage major capsid protein	A0A1J0MFW8	Staphylococcus_phage	1.1e-40	35.3
WP_027822418.1\|2394246_2395353_-\|portal	phage portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	4.7e-49	33.9
2394565:2394578	attL	NA	NA	NA	NA
WP_064578492.1\|2395539_2397243_-\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	2.4e-121	40.5
WP_064578493.1\|2397239_2397713_-\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_064578494.1\|2398325_2398715_-	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	2.2e-17	42.6
WP_064578495.1\|2398707_2399046_-\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	1.0e-07	34.7
WP_064578496.1\|2399055_2399241_-	sporulation protein Cse60	NA	NA	NA	NA
WP_027822990.1\|2399265_2399685_-	hypothetical protein	NA	NA	NA	NA
WP_064578497.1\|2399829_2401224_-	virulence protein	Q4ZD27	Staphylococcus_phage	1.1e-68	37.1
WP_064578499.1\|2401223_2402024_-	bifunctional DNA primase/polymerase	NA	NA	NA	NA
WP_027823047.1\|2402037_2402268_-	hypothetical protein	NA	NA	NA	NA
WP_064578500.1\|2402538_2402718_-	helix-turn-helix domain-containing protein	E9LUT5	Lactobacillus_phage	2.1e-20	86.2
WP_064578501.1\|2402866_2403511_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_064578503.1\|2403588_2404743_+\|integrase	site-specific integrase	A0A172LN96	Lactococcus_phage	6.1e-60	36.7
2404937:2404950	attR	NA	NA	NA	NA

DBSCAN-SWA_8

2748491 : 2756779

Planktothrix_phage(16.67%)

bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027822312.1\|2748491_2749433_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	2.1e-18	30.5
WP_064578640.1\|2749525_2750497_-	GMP reductase	Q4ZCY7	Staphylococcus_virus	1.8e-137	71.2
WP_015381012.1\|2750545_2751835_-	adenylosuccinate synthase	L7Y4J5	Megavirus	3.5e-72	37.0
WP_003645480.1\|2752151_2753450_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	3.8e-18	33.6
WP_021357419.1\|2753672_2754002_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_015381010.1\|2754196_2755531_-	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	7.9e-27	27.1
WP_054519129.1\|2755666_2756779_+	glycerate kinase	W6LM47	Streptococcus_phage	1.3e-35	35.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP015861

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 6654

Staphylococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_181021348.1\|533_1520_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.2e-43	36.0
WP_064578751.1\|3316_3643_-	hypothetical protein	NA	NA	NA	NA
WP_064578752.1\|3820_4072_+\|transposase	IS3 family transposase	Q6J1X3	Lactobacillus_phage	1.5e-35	91.6
WP_064578753.1\|5026_5266_+	hypothetical protein	NA	NA	NA	NA
WP_021357841.1\|5481_5838_-	hypothetical protein	NA	NA	NA	NA
WP_031264030.1\|5841_6654_-	AAA family ATPase	F0PIG8	Enterococcus_phage	4.5e-49	40.2

DBSCAN-SWA_2

12388 : 14524

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_064578756.1\|12388_14524_+	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	1.6e-109	46.8

DBSCAN-SWA_3

21429 : 22410

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_064578760.1\|21429_22410_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	1.9e-06	34.3

DBSCAN-SWA_4

26190 : 28226

Bacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_064578762.1\|26190_27069_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	7.5e-42	36.1
WP_003688751.1\|27092_27380_-\|transposase	transposase	NA	NA	NA	NA
WP_064578763.1\|27638_28226_+	recombinase family protein	M4QQC6	Vibrio_phage	7.8e-19	42.4

DBSCAN-SWA_5

31539 : 32463

unidentified_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_064578765.1\|31539_32463_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	1.1e-32	32.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP015858

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3053 : 54407

Lactobacillus_phage(30.77%)

transposase,protease,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_064578642.1\|3053_3983_+\|transposase	IS30-like element ISLpl1 family transposase	H7BW47	unidentified_phage	6.7e-25	34.1
WP_064578643.1\|5938_6805_+	AAA family ATPase	F0PIG8	Enterococcus_phage	9.0e-56	45.1
WP_003554871.1\|6797_7106_+	hypothetical protein	NA	NA	NA	NA
WP_064578644.1\|7342_7594_+\|transposase	IS3 family transposase	Q6J1X3	Lactobacillus_phage	2.3e-36	94.0
WP_046040924.1\|7647_8490_+\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	8.8e-157	99.3
WP_064578645.1\|9033_9591_+	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	2.0e-32	44.6
WP_064578646.1\|9663_9999_-	hypothetical protein	NA	NA	NA	NA
WP_016526619.1\|10102_10387_+	BRCT domain-containing protein	NA	NA	NA	NA
WP_064578647.1\|10569_13284_+	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_064578648.1\|13408_13627_+	hypothetical protein	NA	NA	NA	NA
WP_064578649.1\|13627_15220_+	hypothetical protein	NA	NA	NA	NA
WP_027822898.1\|15286_15610_+	hypothetical protein	NA	NA	NA	NA
WP_046041500.1\|15682_16081_-	hypothetical protein	NA	NA	NA	NA
WP_046041498.1\|16073_16394_-	hypothetical protein	NA	NA	NA	NA
WP_056988790.1\|16386_17688_-	Y-family DNA polymerase	M1Q231	Streptococcus_phage	4.5e-83	40.0
WP_056988833.1\|18109_18334_-	hypothetical protein	NA	NA	NA	NA
WP_056988831.1\|18336_19110_-	ParA family protein	F0PIG8	Enterococcus_phage	3.3e-33	36.6
WP_064578650.1\|19886_21425_+	primase C-terminal domain-containing protein	NA	NA	NA	NA
WP_064578651.1\|21734_24380_+	hypothetical protein	NA	NA	NA	NA
WP_041161906.1\|24643_25027_+	hypothetical protein	NA	NA	NA	NA
WP_064578652.1\|24998_25658_+	hypothetical protein	NA	NA	NA	NA
WP_064578653.1\|25674_27627_+	hypothetical protein	NA	NA	NA	NA
WP_041161907.1\|27629_27836_+	hypothetical protein	NA	NA	NA	NA
WP_064578654.1\|27836_29000_+	CHAP domain-containing protein	A0A0A0RSI6	Bacillus_phage	4.5e-10	35.5
WP_064578655.1\|29012_29642_+	hypothetical protein	NA	NA	NA	NA
WP_064578656.1\|30458_31421_+	DUF3102 domain-containing protein	A0A2H4JAH5	uncultured_Caudovirales_phage	4.7e-37	48.2
WP_060678043.1\|31417_31633_+	hypothetical protein	NA	NA	NA	NA
WP_016526759.1\|31634_31853_+	hypothetical protein	NA	NA	NA	NA
WP_016526760.1\|31849_32149_+	hypothetical protein	NA	NA	NA	NA
WP_064578657.1\|32145_32571_+	thioredoxin family protein	NA	NA	NA	NA
WP_080474092.1\|32589_33498_+	hypothetical protein	NA	NA	NA	NA
WP_064578659.1\|33783_34080_+	hypothetical protein	NA	NA	NA	NA
WP_064578660.1\|34081_34582_+	hypothetical protein	NA	NA	NA	NA
WP_064578661.1\|34599_35067_+	hypothetical protein	NA	NA	NA	NA
WP_064578662.1\|35038_37228_+	hypothetical protein	NA	NA	NA	NA
WP_064578663.1\|37229_37865_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_064578664.1\|38145_38250_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_006293514.1\|38690_38795_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_064578665.1\|39360_41523_+	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	4.5e-104	47.3
WP_154811985.1\|41684_41849_+	hypothetical protein	NA	NA	NA	NA
WP_056988529.1\|42016_42646_+	hypothetical protein	NA	NA	NA	NA
WP_064578666.1\|42721_43687_+	DUF3991 and TOPRIM domain-containing protein	NA	NA	NA	NA
WP_064578667.1\|43683_43878_+	hypothetical protein	NA	NA	NA	NA
WP_064578668.1\|43880_44486_+	hypothetical protein	NA	NA	NA	NA
WP_064578669.1\|44488_46273_+\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A223W0B1	Agrobacterium_phage	1.8e-82	33.7
WP_016526775.1\|46339_46654_+	hypothetical protein	NA	NA	NA	NA
WP_064578670.1\|46749_48831_+	hypothetical protein	NA	NA	NA	NA
WP_064578671.1\|48840_49629_+	class A sortase	NA	NA	NA	NA
WP_064578672.1\|49658_52598_+	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
WP_064578673.1\|52674_52971_+	hypothetical protein	NA	NA	NA	NA
WP_064578674.1\|53260_54103_-\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	2.8e-155	98.6
WP_064578675.1\|54143_54407_-\|transposase	IS3 family transposase	Q6J1X3	Lactobacillus_phage	2.1e-32	94.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP015859

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP015857

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP015861

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP015858

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection