CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP011460	Vibrio anguillarum strain 90-11-286 chromosome I, complete sequence	1 crisprs	cas3,DEDDh,DinG,csa3,WYL,csx1,cas6f,cas7f,cas5f	0	1	6	0
NZ_CP011461	Vibrio anguillarum strain 90-11-286 chromosome II, complete sequence	0 crisprs	csa3,RT,cas5f,cas7f,cas6f,DinG,cas9	0	0	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP011460_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP011460_1

1986778-1986910

Unclear

I-F

Consensus_repeat	Method
TTCTTAGCTGCCTATGCGGCAGGTCAC	CRISPRCasFinder

2 spacers

cas6f,cas7f,cas5f

The CRISPR arrays of NZ_CP011460_1

>merge|NZ_CP011460|1|1986778-1986910|CRISPRCasFinder
TTATTAACTGCTTGTCCAGCAGGTCGGTTGCTTTCTTCCTGACCTATTCTTAGCTGCCTATGCGGCAGGTCACAACGATGGACTTGCAAAAGCGTTACGCATGATTTTCTTGGCTGCCTATGCGGCAGGTCAC

>NZ_CP011460|1|1|1986778-1986910|CRISPRCasFinder
TTATTAACTGCTTGTCCAGCAGGTCGG	TTGCTTTCTTCCTGACCTA
TTCTTAGCTGCCTATGCGGCAGGTCAC	AACGATGGACTTGCAAAAGCGTTACGCATGATT
TTCTTGGCTGCCTATGCGGCAGGTCAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP011460.1\|WP_064625642.1\|1977935_1978565_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|276809
NZ_CP011460.1\|WP_064625656.1\|1990805_1992017_-\|TniQ-family-protein	unknown	unknown	gnl\|CDD\|377670
NZ_CP011460.1\|WP_064624628.1\|1984598_1985288_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011460.1\|WP_047687889.1\|1982611_1983097_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319968
NZ_CP011460.1\|WP_064625648.1\|1983224_1984124_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP011460.1\|WP_064625665.1\|1998437_1998836_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011460.1\|WP_064625663.1\|1996782_1998273_-\|N-6-DNA-methylase	unknown	unknown	gnl\|CDD\|280533
NZ_CP011460.1\|WP_185762008.1\|1981625_1982228_-\|thermostable-hemolysin	unknown	unknown	gnl\|CDD\|378832
NZ_CP011460.1\|WP_064625660.1\|1993232_1994903_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|275228
NZ_CP011460.1\|WP_064625644.1\|1980115_1981615_-\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|341233
NZ_CP011460.1\|WP_064625654.1\|1988715_1990803_-\|hypothetical-protein	cas5f	cd09736_cas5f_CAS-I-F	gnl\|CDD\|187867
NZ_CP011460.1\|WP_064625650.1\|1987038_1987644_-\|type-I-F-CRISPR-associated-endoribonuclease-Cas6/Csy4	cas6f	cd09739_cas6f_CAS-I-F:CAS-IV	gnl\|CDD\|187870
NZ_CP011460.1\|WP_064625662.1\|1995001_1996783_-\|restriction-endonuclease-subunit-S	unknown	unknown	gnl\|CDD\|341149
NZ_CP011460.1\|WP_017047061.1\|1978592_1979390_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|236372
NZ_CP011460.1\|WP_013856451.1\|1979379_1980114_-\|iron-containing-redox-enzyme-family-protein	unknown	unknown	gnl\|CDD\|379634
NZ_CP011460.1\|WP_064624626.1\|1985290_1986541_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|379114
NZ_CP011460.1\|WP_013856454.1\|1977275_1977932_-\|response-regulator	unknown	unknown	gnl\|CDD\|182612
NZ_CP011460.1\|WP_064625651.1\|1987653_1988709_-\|type-I-F-CRISPR-associated-protein-Csy3	cas7f	cd09737_cas7f_CAS-I-F	gnl\|CDD\|187868
NZ_CP011460.1\|WP_017045295.1\|1998966_1999116_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP011460.1\|WP_064625658.1\|1992366_1993233_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP011460.1\|WP_064625642.1\|1977935_1978565_-\|hypothetical-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	5.69672e-09
NZ_CP011460.1\|WP_064625656.1\|1990805_1992017_-\|TniQ-family-protein	gnl\|CDD\|377670	pfam06527, TniQ, TniQ. This family consists of several bacterial TniQ proteins. TniQ along with TniA and B is involved in the transposition of the mercury-resistance transposon Tn5053 which carries the mer operon. It has been suggested that the tni genes are involved in the dissemination of integrons.	1.56295e-10
NZ_CP011460.1\|WP_064625644.1\|1980115_1981615_-\|AMP-binding-protein	gnl\|CDD\|341233	cd05907, VL_LC_FACS_like, Long-chain fatty acid CoA synthetases and Bubblegum-like very long-chain fatty acid CoA synthetases. This family includes long-chain fatty acid (C12-C20) CoA synthetases and Bubblegum-like very long-chain (>C20) fatty acid CoA synthetases. FACS catalyzes the formation of fatty acyl-CoA in a two-step reaction: the formation of a fatty acyl-AMP molecule as an intermediate, and the formation of a fatty acyl-CoA. Eukaryotes generally have multiple isoforms of LC-FACS genes with multiple splice variants. For example, nine genes are found in Arabidopsis and six genes are expressed in mammalian cells. Drosophila melanogaster mutant bubblegum (BGM) have elevated levels of very-long-chain fatty acids (VLCFA) caused by a defective gene later named bubblegum. The human homolog (hsBG) of bubblegum has been characterized as a very long chain fatty acid CoA synthetase that functions specifically in the brain; hsBG may play a central role in brain VLCFA metabolism and myelinogenesis. Free fatty acids must be "activated" to their CoA thioesters before participating in most catabolic and anabolic reactions.	1.80857e-116
NZ_CP011460.1\|WP_047687889.1\|1982611_1983097_+\|VOC-family-protein	gnl\|CDD\|319968	cd16361, VOC_ShValD_like, vicinal oxygen chelate (VOC) family protein similar to Streptomyces hygroscopicus ValD protein. This subfamily of vicinal oxygen chelate (VOC) family protein includes Streptomyces hygroscopicus ValD protein and similar proteins. ValD protein functions in validamycin biosynthetic pathway. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	6.09734e-66
NZ_CP011460.1\|WP_064625648.1\|1983224_1984124_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	1.95961e-33
NZ_CP011460.1\|WP_185762008.1\|1981625_1982228_-\|thermostable-hemolysin	gnl\|CDD\|378832	pfam12261, T_hemolysin, Thermostable hemolysin. This family of proteins is found in bacteria. Proteins in this family are typically between 200 and 228 amino acids in length. T_hemolysin is a pore-forming toxin of bacteria, able to lyse erythrocytes from a number of mammalian species.	4.46241e-82
NZ_CP011460.1\|WP_064625660.1\|1993232_1994903_-\|ATP-binding-protein	gnl\|CDD\|275228	TIGR04435, ABC_transporter, restriction system-associated AAA family ATPase. Members of this family are AAA family ATPases by homology. They occur regularly in a conserved gene neighborhood with the restriction (R), modification (M), and specificity (S) proteins of an apparent type I restriction enzyme system, plus one additional uncharacterized protein. It is not clear whether members of this family contribute to restriction per se, or to another process such as transfer of mobile elements.	4.46307e-13
NZ_CP011460.1\|WP_064625650.1\|1987038_1987644_-\|type-I-F-CRISPR-associated-endoribonuclease-Cas6/Csy4	gnl\|CDD\|187870	cd09739, Cas6_I-F, CRISPR/Cas system-associated RAMP superfamily protein Cas6f. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas6f is an endoribonuclease that generates crRNA; This family is specific for CRISPR/Cas system I-F subtype; Possesses RRM fold; also known as Csy4 family.	3.2207e-48
NZ_CP011460.1\|WP_064625654.1\|1988715_1990803_-\|hypothetical-protein	gnl\|CDD\|187867	cd09736, Csy2_I-F, CRISPR/Cas system-associated RAMP superfamily protein Csy2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; RAMP superfamily protein; predicted Cas5 ortholog.	4.10482e-20
NZ_CP011460.1\|WP_064625651.1\|1987653_1988709_-\|type-I-F-CRISPR-associated-protein-Csy3	gnl\|CDD\|187868	cd09737, Csy3_I-F, CRISPR/Cas system-associated RAMP superfamily protein Csy3. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; RAMP superfamily protein; predicted Cas7 ortholog.	1.04554e-147
NZ_CP011460.1\|WP_064625662.1\|1995001_1996783_-\|restriction-endonuclease-subunit-S	gnl\|CDD\|341149	cd17260, RMtype1_S_EcoEI-TRD1-CR1_like, Type I restriction-modification system specificity (S) subunit Target Recognition Domain-ConseRved domain (TRD-CR), similar to S.EcoEI TRD1-CR1, S.EcoJA17PI TRD1-CR1, S.EcoJA23PI TRD1-CR1, and S.StyLTIII TRD1-CR1. Escherichia coli A58 S subunit (S.EcoEI) recognizes 5'... GAGNNNNNNNATGC ... 3', Escherichia coli UCD_JA17_pb S subunit (S.EcoJA17PI) and Escherichia coli UCD_JA23_pb S subunit (S.EcoJA23PI) recognize 5'... GAGNNNNNNNGTCA ... 3', and Salmonella typhimurium LT7 S subunit (S.StyLTIII) recognizes 5'... GAGNNNNNNRTAYG ... 3'. The restriction-modification (RM) system S subunit consists of two variable target recognition domains (TRD1 and 2) and two conserved regions (CR1 and CR2) which separate the TRDs. The TRDs each bind to different specific sequences in the DNA. For example: S.EcoEI TRD1 and S.StyLTIII TRD1 recognize GAG/CTC, S.EcoEI TRD2 recognizes GCAT/ATGC, and S.StyLTIII TRD2 recognizes CRTAY/RTAYG. RM systems protect a bacterial cell against invasion of foreign DNA by endonucleolytic cleavage of DNA that lacks a site specific modification. The host genome is protected from cleavage by methylation of specific nucleotides in the target sites. In type I systems, both restriction and modification activities are present in one enzyme complex composed of one DNA specificity (S) subunit (this family), two modification (M) subunits and two restriction (R) subunits. This model contains both TRD1-CR1 and TRD2-CR2. It also includes TRD-CR-like sequence-recognition domains of various type II restriction enzymes and methyltransferases, such as Pseudomonas putida Jo 4-731 Type IIG restriction enzyme/N6-adenine DNA methyltransferas RM.PpiI and Porphyromonas macacae COT-192 OH2631 RM.Pma2631ORF8845P, as well as type I DNA methyltransferases such as Chlorobium limicola M.Cli245ORF128P. RM.PpiI recognizes the sequence 5' ... GAACNNNNNCTC ... 3'.	7.28671e-71
NZ_CP011460.1\|WP_017047061.1\|1978592_1979390_-\|SDR-family-oxidoreductase	gnl\|CDD\|236372	PRK09072, PRK09072, SDR family oxidoreductase.	1.13367e-126
NZ_CP011460.1\|WP_013856451.1\|1979379_1980114_-\|iron-containing-redox-enzyme-family-protein	gnl\|CDD\|379634	pfam14518, Haem_oxygenas_2, Iron-containing redox enzyme. The CADD, Chlamydia protein associating with death domains, crystal structure reveals a dimer of seven-helical bundles. Each bundle contains a di-iron centre adjacent to an internal cavity that forms an active site similar to that of methane mono-oxygenase hydrolase.	6.35138e-31
NZ_CP011460.1\|WP_064624626.1\|1985290_1986541_-\|AAA-family-ATPase	gnl\|CDD\|379114	pfam13304, AAA_21, AAA domain, putative AbiEii toxin, Type IV TA system. Several members are annotated as being of the abortive phage resistance system, in which case the family would be acting as the toxin for a type IV toxin-antitoxin resistance system.	7.67065e-12
NZ_CP011460.1\|WP_013856454.1\|1977275_1977932_-\|response-regulator	gnl\|CDD\|182612	PRK10643, PRK10643, two-component system response regulator PmrA.	6.22089e-82
NZ_CP011460.1\|WP_064625663.1\|1996782_1998273_-\|N-6-DNA-methylase	gnl\|CDD\|280533	pfam02384, N6_Mtase, N-6 DNA Methylase. Restriction-modification (R-M) systems protect a bacterial cell against invasion of foreign DNA by endonucleolytic cleavage of DNA that lacks a site specific modification. The R-M system is a complex containing three polypeptides: M (this family), S (pfam01420), and R. This family consists of N-6 adenine-specific DNA methylase EC:2.1.1.72 from Type I and Type IC restriction systems. These methylases have the same sequence specificity as their corresponding restriction enzymes.	3.57939e-113

>NZ_CP011460.1|WP_064624626.1|1985290_1986541_-|AAA-family-ATPase
MENYNSIQLIDTIIPNSDKHVTISLEGKNLIITGGNGCGKTRLLNQIHENISAQVEQMSHKTADQIRQDISNRERWMNNSSPTNADYHHYKQQIRELELKLADIDKVKVILGDLETYCTDFNEKKALLRLFPAVREQSLAHTGSYDSLARLKKEDEGNSLSKDSSSQFERYLVAFYNYGSHLLARVDDKAQGAKVDAWFDNVTSQLQYLFEDETLKLDYNAEEQAFYIKQDGKDPYKFDKLSSGYQSILSIYADLLMKVELKEVSAQELSGVVFIDEIDAHLHVSLQRKIFSFFDQAFPKVQFIVTTHSPFVVQSVNNSVIYDLSANEQLEDLSMYSYESILKGLLGVESKSSILDGLIEELATQIQVKKPDWDTIIDLIRRIKPNERNLDTHSSNVLKQAEIQLMDERNKNGMEE
>NZ_CP011460.1|WP_064624628.1|1984598_1985288_-|hypothetical-protein
MFKVIRPLEEPPELKTKGYNCDEVVHALWKICHRKCYLCETLNPDAPEIEHKEPHENKDEDLKVDWNNLFYSCRRCNSIKGTKHKNILDVAQVDPITKIIWNMAPSNYSDVTFEKVDKKCKDKAVDDTIKLLEHCFNETGTAFRGITREALIEKVEIKLQHFLKQAYKIRHEDSDEDDIEKARKQLKVMLQNEYPYSAFWRWRFLRDPVLMRGHSDLLPEYVTLSPCKL
>NZ_CP011460.1|WP_064625648.1|1983224_1984124_-|LysR-family-transcriptional-regulator
MTMLNPIWLNTFKTLVDIGHFTKTAELLHMTQPGVSQQINKLEAACGYPLIKRFNKKFELTIYGRKVYDYAVKHFEEEFELLQNLAHDEPFRGRCTIGCSGTFAWLIYSQLLSLQVSYPGLSIELEATPNHRIFEQILQGKLDIGLVTKEPNPKYFASRIVGAECLALVLPLSADESLPINDLLIELGVVRHPDFAHYFQTYVNQANNDLLRLVDLEDVSTQSYINQVHQILVPIAKGIGFTVVPRWCVNLFADKEQLKIFNITEDIQEPVYLVSKLNSPLARRYEQVIDVIDHSFKAV
>NZ_CP011460.1|WP_047687889.1|1982611_1983097_+|VOC-family-protein
MKMNHVGIMVGDMDKAVEFYTQALGLKIVMNNTQVIEERESAIGRMCIAVFGEGFKGFNIAHLVTTDGIGVELFEMKEREERHEVDFSRLGIFHFCLQTDDFEGAIKRIEQYGGKARMDIMRYHPEDDNKLAKMVYLEDPFGNLFELYSHSYEETYASDYE
>NZ_CP011460.1|WP_185762008.1|1981625_1982228_-|thermostable-hemolysin
MKTIRSASDLKLAVIDPSHPRWLEAIHLVRERYQQAFDARLITFMPAYLALLDHDEMKSVCGFRVAQQEPLFLEQYLDQPADEILSQRFDCRVSRSALIEFGQLASFGRGLSALHFTLIAQQLVDLGYEWCVFTATDPLHALMRRFGLQPTLIAKASASCIPNANQIWGSYYQHSPRILAGNLAQGLALLNRFHLNQKQA
>NZ_CP011460.1|WP_064625644.1|1980115_1981615_-|AMP-binding-protein
MNRILSALHQHAQQKPDSIAFIGHNAKQEKIALSYQQLLEKVEATARTLRQWQVQRIALKAENSLDWVIIDLAAMHAKIVLVPVPTFFSKAQVEHLLYESGVDVCLGDWPTLGEPFSTLSHLPAFVYLANPSAQVLPLTQKITFTSGSTGTPKGVCLSDENMQAVTLAIADKMSAQVERHLVMLPLSTLLENITGVYVPLVLGVTSTVVCGSEVGLTGSSQFCGATFALALQQFQPSSLVLTPALLLALIEVVKQSPALALPLRWVAVGGARVAPQLIDAARQLGIPAFEGYGLSESASVVSMNTPQQNQPGSCGQVLSHLQVSLAQDGELLVKGNTALGYLGEPFSHEWLSTGDMATIDDEGFLTIIGRKKNLIITSFGRNVAPEWIESQALALIAHHRFVVVGDGQAGLTAVSDSPLPDLVTRVQQLNSVLPDYAHITQLWLVSDIHCWQKWLTANGRPKRLAIENALQEARLARHTTNPQTVFISIPSFYSMAEEL
>NZ_CP011460.1|WP_013856451.1|1979379_1980114_-|iron-containing-redox-enzyme-family-protein
MSKFFHILKTQTEPAQQQMLQAPVFDACARGEISLEMYIRFLTQAYHHVKHTVPLLMACGSRLGDEYEWVRTAIAEYIDEEKGHQEWILNDIKACGGDVDAVRHNEGAGRVSASIELMVAYLYHQIDRANPLSLFGMVWVLEGTSVGVGGNIARLVKQRLELPDAAMTYLTSHSELDQGHIRFFESLMNNIQCVSDQEAIIRSANMVFDLYGQMLRELPLPCESMVHAGSQDLASQGVRSQYGS
>NZ_CP011460.1|WP_017047061.1|1978592_1979390_-|SDR-family-oxidoreductase
MDLNHRHVLLTGASGGIGQRIALLLAKQGASLVLVARDGQKLEQLRQTLPMPEKHLILSADLSTESGIEQINTFIQRFFMGQKRISVVINNAGINQFRLLARRTAVSVQQELHLNLLAPMQLTQSAIHWLNKPGIILNIGSSLGAIGYPGYATYCATKAGLHRFSEAMQRELEGTGIKVLYLAPRATNTELNNDTVNQFNQAVGNHCDEPEVVAQHVLSMLESESTTRWIGWPEKVLVRLNQLWPAVISSAIKKQQATILAFLNR
>NZ_CP011460.1|WP_064625642.1|1977935_1978565_-|hypothetical-protein
MKTVFKWASALVIFAVSTTPAFAITPLAQVQSDWAKCQYKMKSSDDQERCFERVIMRNTLEMQSSNNPELKVWLAINKSSLAGVKGGLGALSLVKEAKLLYEEVIDQAPNTLDGSAFTSLGTLYYKVPGWPVAFGDDVKAEELLQRALLINPTGIDANYFYGDFLAEQGRTDEARKYLLQAQQAPARPQRAIADAGRQQEIALLLENLK
>NZ_CP011460.1|WP_013856454.1|1977275_1977932_-|response-regulator
MRLLLVEDDKQLGESMQVALTRQGYTVDWLEKGGGVACALKTEQFSAVILDLTLPDMDGLEVLRGIRNAGYSLPVMILTARDDISDRVKGLDGGADEYIGKPFALEELLARLRLIIRRSSGSAEALISIGDLSLSLSKQEIEYRQQPLKLTRNEYKILASLITQAGRVMSKELLQQALHGWDEGSSDNAIEVHIHNLRKKMPENVIKNIRGVGYMIEK
>NZ_CP011460.1|WP_064625650.1|1987038_1987644_-|type-I-F-CRISPR-associated-endoribonuclease-Cas6/Csy4
MTKRYYFYIRYIPAHADFELLAGRCIHQMHMFMVNNPQVMNRIGVSFPSWGESSVGQTIAFVAEDKDMMIGLSFQPYFSLMINEGLFELSSVCKAPESLGEVRFVRNQMINKSFLGSKKRRIKRSMVRAELSGAEQRLPVAVEERVIDSFHRIPISSGSSGQDFILFIQKEFVGERAESSFNSYGFSTNNEKRGTVPDLML
>NZ_CP011460.1|WP_064625651.1|1987653_1988709_-|type-I-F-CRISPR-associated-protein-Csy3
MELCNQLNYVRSLSAGKAYFYHLSNDGEMCPLEIDRTRLRAPKSGYAEAYKGDKFAEKNVAPQDLAYANPQYIEECYVKPGVDDIYCAFSLRIRANSLNPDVCSDDEVRHKLSSLAKTYKELNGYSELAHRYAKNILLGTWIWRNRECRKLTIEVKTSDSETVIIENAARLSWYGHWDEASTECLEKLTAYLTRALSDSSEYFYMDVKAKIGVGWGDEIYPSQEFLDSREDGVPTKQLATVELLSGKETVAFHGQKVGAALQSIDDWWHEDADKPLRVNEYGADREYVIARRHVTFKNDFYQLLRNTENWIESMTATQTIPNDVHFIMSVLIKGGLFNCSKSKSKSKAKAK
>NZ_CP011460.1|WP_064625654.1|1988715_1990803_-|hypothetical-protein
MTKLNDLLAIEGETVKQAVLKKMFMPYTENVCIDGLEKEALTILLNLSSNHKGDKCTDWLDVARAKKYLKNDENLAESLAEIQWLHTHNLKFPDCRVKDQRIIARPLSTTEEFISSAGLDQRLGWAHNSAVYRHTLWLLNPFKWQSQPVCILSLIQQKNPVWLDLLTEFGLDVKSLARLQRAIEEQLPENSFPDSVSTYSKQLRFPWGDDYVSITPVVSHALQCELEIRSRSPENKLSFVSSSLPNSPSIGNLCGSLGGYMRVLNYPLGVKQTKGGTLTASRQKSGHYFDDYQVTNAKICQVLNRLIGSEPAKTQRQRERARQVRSKILRKQIALWMLPLIELRDIAESEPNQQQLEYDDTLAQAFLSLPELELGSLAGEFNRRLHLALQNNMYSAKFAYHPKLMQVAKAQVTWVLDQLSKPINNQDTVTGEQYIYLSSMRVQDAVAMSNPCLCGAPSLTAIWGFMHDYQRQFNQLVNNGSPVEFSSFAFYVRNENIQSTAKLTEPNSVAKARTVSNAKRPTIRSERLSDLEIDLVIRVNSESRISDFESALKTALPSSFAGGALYQPLISSQIDWLRTFTSKGEIFHVLKGLPAYGRWLYPSEKQPASFDELEQFLAKDADILPVSIGYHLLEHPTDRGNSITDCHAYAENALGISKRLNPIEVRFSGRDHFFSQAFWSLECSSEAILIKNDRN
>NZ_CP011460.1|WP_064625656.1|1990805_1992017_-|TniQ-family-protein
MNTDIQLYPNESLESFLLRLSQEQGYERFSHFAQDIWFDTMDQHEAIAGAFPLELNRINIYHAQTTSQMRVRVLIHLENQLRLNNFGALRLALSHSKAQFSSQYKAVHRFGVDYPYAFLRKRFTPICPLCIDEAPYIRQQWQFISHQACEHHACKLVHHCPECKSRLEYQSTESINQCECGYDLRNSPLEDAPEAEVLVAQWLSGNNSKPLRLLKAEMTISERYGFLLWYVNRYGDIENISFESFIEYCGAWPTPLWQDLDALKEKAELVRVKDWKKMFFNEAFGALLKDCRQLPSRQLSRNAVLTQVLVYFTKLMATLPSSAKGNIGDVLLSPLEASTLFSCTTDEVYRLYEFGEIKAAIRPRMHTKIASHESAFTLRSVIETKLTRMCSESDGLSVYLPEW
>NZ_CP011460.1|WP_064625658.1|1992366_1993233_-|hypothetical-protein
MKKLSIPTYDDIERTTQASENTRMSSYPQLRNRLADVTSAYDNYLRQSGSALNIGPIGISNDLAKALKTHYTSEPECFSFIPLLRRSSRRVCPMCGSLGTGTLDHLLPQAIYPEFAVFSKNLVPACDCNIKRQDVVSGFCNQFNTGVRVLHPYFDDCLSERQIYFSIEPAPEYPLAKFGLVYINPNCNKFPSIKFHVESVVLPSGIVAEMVDMWSSLSEYPSDKIHTLPSDATITIECLNEALRDVLGRHDRQKTTPNNWESIFVYSIINSESAKEWIVEKHNSLMEE
>NZ_CP011460.1|WP_064625660.1|1993232_1994903_-|ATP-binding-protein
MKNEESKRRLEVRFTEYESAPVPGEIQIIAPFDNWNDFGYKINCKAKLWNPRLERPFYFECFIGFLPPDKNAEEEIYNNYFKNYHREGRSLADMMGYIEHLMANNALDELRFFTMLPTMKDYRAAVEELGPHLLQDMLETIHDLVYFKNRSSSWFADALDSEVFNLGFMRNSEPFYAFNNADSILHGVDEERFEGISESLKLKYKLDGFENAHEVNLNYDQSALVPKRINILIGKNGIGKSQALNSFCRAALRYKDKNISLGVGEGNERPMINRLLAIGTPGETQNTFPAERRTSQKLYYRRLLLTRNARAKASKSINDMLIQLARSSERLGRKSRWNLFLDAIENILPLDSLVLRTKSNTYVKLKNLASGDGEQATLEKWAKVNKKTDPMLLISEEPYSMSSGQLTFFKFALLCCLYIENGSFVLLDEPETHMHPNMITDFVELLDEILENTGSLALIATHSAYFVREIPQDQVHVFKKEANNVCISNPRLITFGAPVDSISRFVFDDDAESKLAEKLYLRIKRQNTTFEDIVNTLGDEISVAAMMKLRQKMEEA
>NZ_CP011460.1|WP_064625662.1|1995001_1996783_-|restriction-endonuclease-subunit-S
MSAEQTSMNQLITDNIDIWTSTVKTKSASGRGSSKKRELYGVKKLRELILELAVRGKLVPQDPTDEPASVLLERIAEEKAQLVKDKKIKKQKLFGEVRDEEALFELPLGWQWTRLSELSEIGPRNSDVEDESEASFVPMPMISTSYKGDHGSEVRSWKDIKKGYTHFRDGDIALAKITPCFENSKAAVFSDLKNGVGTGTTELHVARPILGALEPLFVLLYLKAPMFLKVGETQMTGSAGQKRVPKDFFAGNPLPYPPLKEQHRIVAKVDELMTLCDQLEQQTEASIEAHQVLVETLLATLTNSQDATELMANWARISEHFETLFTTEQSIDQLKQTILQLAVMGKLVPQDPNDEPAAKLLERIAIEKAQLVNEKKIKKQKALPPIANSEKPFELPEGWVWCRLDDICQGITSGSTPPKSNFQELPGIPYLKVYNIRNQLIDFEYNPQFIDIECHSSKLARSILYPGDVVMNIVGPPLGKIALIPDSYPEWNCNQAITFFRPIEPSLNRYIYTYLTTGTFLESIELIGTAGQDNISVTKSRSIVLPTPPLEEQSRIVRKVNDLLEICEQLKQRLRDSQQTQLQLTDAIVEQAL
>NZ_CP011460.1|WP_064625663.1|1996782_1998273_-|N-6-DNA-methylase
MSISSVIKSIQDIMRKDAGVDGDAQRLGQMSWLLFLKVFDAQEEELELELDDYKTPIPEQYLWRNWAQDAEGITGDRLLEFVNDDLFYKLKNLIAPVDLNPRGYVVKEAFSDAFNYMKNGTLLRQVINKLNEIDFTDSSERHLFGDIYEQILKDLQSAGNAGEFYTPRAVTRFIVDRLDPKLGESIMDPATGTGGFLACSFDHVKNNYVKTAADHQTLQKQIHGVEKKQLPHLLCITNMMLHGIEVPVQIKHGNTLSKPLSSWDSNINVIATNPPFGGTEEDGIEKNFPAEMQTRETADLFLQLIIEVLDPANGRAGVVLPDGTLFGEGVKTKIKKLLTEECNLHTIVRLPNGVFNPYTGIKTNILFFTKGKPTKEVWFYEHPYPEGVKNYSKTKPMKFEEFQAEIDWWGKEEDGFSSRVENNHAWKVSVDEIIARNFNLDIKNPYQGEVISHDPNELLESYQQQQQEISHLRNQLKDILGTALKSSVGEATGESK
>NZ_CP011460.1|WP_064625665.1|1998437_1998836_+|hypothetical-protein
MKIECPHCQTDNLIEFAENISCTECKKNFKGYKFSKRKLVSASTAFLVGAVGAYAVESELDKERYPLEIEYAIVDTCVNSSENLVSVSWYESKRETCLCALEKTENDVAFSDYKSDQEMFLHTFKQHARSCS
>NZ_CP011460.1|WP_017045295.1|1998966_1999116_-|hypothetical-protein
MTKSKTPMTPEAAARIQGNVAKQNGGKVPKGDFVGRAQRAAANNQKTSK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP011460_1	1.1\|1986805\|19\|NZ_CP011460\|CRISPRCasFinder	1986805-1986823	19	NZ_CP045341	Vibrio sp. THAF190c plasmid pTHAF190c_c, complete sequence	66135-66153	0	1.0

1. spacer 1.1|1986805|19|NZ_CP011460|CRISPRCasFinder matches to NZ_CP045341 (Vibrio sp. THAF190c plasmid pTHAF190c_c, complete sequence) position: , mismatch: 0, identity: 1.0

ttgctttcttcctgaccta	CRISPR spacer
ttgctttcttcctgaccta	Protospacer
*******************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

457039 : 464278

uncultured_Mediterranean_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010320454.1\|457039_457786_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.0e-68	54.5
WP_013857716.1\|457785_458412_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	8.0e-38	53.9
WP_026028368.1\|458417_459350_+	murein hydrolase activator NlpD	I3PV79	Clostridium_phage	5.9e-13	32.8
WP_017047531.1\|459422_460424_+	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	3.5e-35	34.8
WP_026028369.1\|460556_463145_-	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	6.9e-35	20.9
WP_064624375.1\|463387_464278_-	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	5.2e-59	41.8

DBSCAN-SWA_2

705084 : 712155

Faustovirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013857499.1\|705084_706299_+	IscS subfamily cysteine desulfurase	A0A1X7C038	Faustovirus	2.4e-30	31.4
WP_010320409.1\|706355_706739_+	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	1.8e-53	78.2
WP_010320408.1\|706801_707125_+	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	3.6e-26	53.3
WP_026028094.1\|707191_707707_+	co-chaperone HscB	NA	NA	NA	NA
WP_064624545.1\|707728_709582_+	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	7.2e-111	41.2
WP_010320405.1\|709593_709932_+	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_010320404.1\|709982_710177_+	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_026028095.1\|710361_711657_+	aminopeptidase PepB	Q6GYZ8	Mycoplasma_phage	1.1e-33	34.5
WP_064624547.1\|711729_712155_+	nucleoside-diphosphate kinase	K7YW26	Megavirus	5.1e-20	41.4

DBSCAN-SWA_3

1622786 : 1711365

Vibrio_phage(30.0%)

integrase,plate,transposase

attL 1613494:1613510|attR 1712574:1712588

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1613494:1613510	attL	NA	NA	NA	NA
WP_064624621.1\|1622786_1624982_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
1613494:1613510	attL	NA	NA	NA	NA
WP_064624619.1\|1624996_1627342_-	hypothetical protein	NA	NA	NA	NA
WP_064624617.1\|1627341_1628742_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_064625339.1\|1629054_1630734_-	glycoside hydrolase family 32 protein	S6ATV4	Bacillus_phage	4.2e-17	25.8
WP_064625342.1\|1630852_1631839_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	6.0e-24	28.3
WP_026028729.1\|1632112_1633552_+	PTS sucrose transporter subunit IIBC	NA	NA	NA	NA
WP_064625344.1\|1633636_1634557_+	aminoimidazole riboside kinase	NA	NA	NA	NA
WP_064625346.1\|1634685_1636200_+	EAL domain-containing protein	NA	NA	NA	NA
WP_064625348.1\|1636246_1637014_-	potassium channel family protein	A0A2I7QWW4	Vibrio_phage	4.4e-06	38.5
WP_064625349.1\|1637477_1639109_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.6e-11	80.0
WP_017042970.1\|1639172_1640165_-	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_064625351.1\|1640161_1641502_-	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_064625353.1\|1641855_1644660_-	hypothetical protein	NA	NA	NA	NA
WP_017048641.1\|1644812_1645232_-	hypothetical protein	NA	NA	NA	NA
WP_064625356.1\|1645628_1646585_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_017050579.1\|1646574_1646889_+	hypothetical protein	NA	NA	NA	NA
WP_064625358.1\|1646876_1647740_+	DUF692 domain-containing protein	NA	NA	NA	NA
WP_064625361.1\|1647732_1648479_+	putative DNA-binding domain-containing protein	NA	NA	NA	NA
WP_017044810.1\|1648475_1649075_+	DoxX family protein	NA	NA	NA	NA
WP_013856712.1\|1649195_1650776_+	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_064625363.1\|1650787_1651924_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_013856710.1\|1651936_1652038_+	cytochrome bd-I oxidase subunit CydX	NA	NA	NA	NA
WP_064625364.1\|1652151_1652514_-	RidA family protein	NA	NA	NA	NA
WP_064625366.1\|1652526_1653579_-	lactonase family protein	NA	NA	NA	NA
WP_019280949.1\|1654217_1654787_+	hypothetical protein	NA	NA	NA	NA
WP_064625368.1\|1654807_1657312_+	hypothetical protein	NA	NA	NA	NA
WP_064625370.1\|1657314_1660476_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_064625374.1\|1662323_1663328_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_064625379.1\|1663998_1664787_-	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_064625383.1\|1665381_1666362_+\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	2.7e-40	33.1
WP_064625385.1\|1666409_1666907_-	thiol peroxidase	NA	NA	NA	NA
WP_064625386.1\|1667389_1668895_-	aldehyde dehydrogenase	NA	NA	NA	NA
WP_064625388.1\|1669298_1669874_+	nucleoside 2-deoxyribosyltransferase	NA	NA	NA	NA
WP_064625390.1\|1670064_1670346_+	hypothetical protein	NA	NA	NA	NA
WP_088721186.1\|1670471_1671627_+\|transposase	IS3-like element ISVa4 family transposase	Q716C2	Shigella_phage	1.8e-35	36.1
WP_064625392.1\|1672657_1673926_-\|transposase	IS4-like element ISVa14 family transposase	NA	NA	NA	NA
WP_185762005.1\|1674300_1675835_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_064625398.1\|1678641_1680543_-	hypothetical protein	NA	NA	NA	NA
1679361:1679377	attR	NA	NA	NA	NA
WP_176313653.1\|1680558_1681191_-	serine/threonine protein kinase	NA	NA	NA	NA
1679361:1679377	attR	NA	NA	NA	NA
WP_064625402.1\|1681199_1684652_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_064625404.1\|1684653_1685796_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_019282547.1\|1685803_1687120_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_064625406.1\|1687119_1687587_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_064625408.1\|1687586_1688534_-	FHA domain-containing protein	NA	NA	NA	NA
WP_064625410.1\|1688567_1689263_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_064625412.1\|1689265_1690399_-	hypothetical protein	NA	NA	NA	NA
WP_064625414.1\|1690395_1692591_-	MFS transporter	NA	NA	NA	NA
WP_064625417.1\|1692600_1693755_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_064625419.1\|1693897_1696504_-	type VI secretion system ATPase TssH	H6X3M6	Enterobacteria_phage	2.6e-82	31.8
WP_013856687.1\|1696512_1697496_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_064625421.1\|1697477_1699259_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_013856685.1\|1699251_1699668_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_013856684.1\|1699664_1701020_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_064625423.1\|1701066_1702548_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_013856682.1\|1702547_1703057_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_013856681.1\|1703126_1703657_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_064625425.1\|1703683_1705075_-	type VI secretion system ImpA family N-terminal domain-containing protein	NA	NA	NA	NA
WP_064625427.1\|1705749_1707741_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	1.5e-21	24.2
WP_029189801.1\|1707740_1708304_+	hypothetical protein	NA	NA	NA	NA
WP_013856676.1\|1708313_1708610_+	PAAR domain-containing protein	NA	NA	NA	NA
WP_019280941.1\|1709669_1709810_-	hypothetical protein	A0A067ZIA1	Vibrio_phage	4.5e-10	63.4
WP_013856673.1\|1709818_1710157_-	hypothetical protein	NA	NA	NA	NA
WP_019282554.1\|1710153_1711365_-\|integrase	site-specific integrase	A0A1W6JTA0	Pseudomonas_phage	6.3e-39	31.2
1712574:1712588	attR	NA	NA	NA	NA

DBSCAN-SWA_4

2301639 : 2308274

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_026027639.1\|2301639_2302110_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	8.4e-32	48.0
WP_013856195.1\|2302318_2303428_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	9.7e-63	39.3
WP_010320134.1\|2303516_2304173_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.5e-34	38.0
WP_064625817.1\|2304174_2305272_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	1.1e-47	36.8
WP_010320136.1\|2305278_2305728_-	transcriptional regulator NrdR	NA	NA	NA	NA
WP_064625818.1\|2305870_2307121_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	2.3e-97	48.2
WP_038148735.1\|2307134_2308274_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	2.9e-62	42.0

DBSCAN-SWA_5

2847698 : 2857646

Micromonas_sp._RCC1109_virus(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_064626020.1\|2847698_2848631_-	glycosyltransferase family 2 protein	A8CG95	Salmonella_phage	1.4e-41	33.8
WP_157722360.1\|2848662_2849058_-	GtrA family protein	NA	NA	NA	NA
WP_064626021.1\|2849075_2849354_-	hypothetical protein	NA	NA	NA	NA
WP_064626022.1\|2849361_2850375_-	NAD(P)-dependent oxidoreductase	M4QPK0	Synechococcus_phage	2.4e-12	24.8
WP_064626023.1\|2850492_2852319_-	thiamine pyrophosphate-binding protein	E5EQ70	Micromonas_sp._RCC1109_virus	6.1e-155	47.9
WP_064626024.1\|2852333_2853344_-	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_064626025.1\|2853343_2854354_-	4-hydroxy-2-oxovalerate aldolase	E5EQ69	Micromonas_sp._RCC1109_virus	1.1e-68	42.6
WP_064626026.1\|2854350_2855232_-	acetaldehyde dehydrogenase (acetylating)	G9E526	Ostreococcus_lucimarinus_virus	4.1e-56	42.9
WP_064626027.1\|2855250_2856564_-	lipopolysaccharide biosynthesis protein RfbH	H8ZJ36	Ostreococcus_tauri_virus	3.1e-52	34.9
WP_185762019.1\|2856563_2857646_-	CDP-glucose 4,6-dehydratase	A0A0P0YNH4	Yellowstone_lake_phycodnavirus	1.3e-06	24.7

DBSCAN-SWA_6

2863729 : 2870648

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_064626031.1\|2863729_2865070_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.0e-10	25.0
WP_064626032.1\|2865084_2865891_-	ABC transporter permease	NA	NA	NA	NA
WP_064626033.1\|2866047_2866593_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	5.3e-54	57.5
WP_064626034.1\|2866595_2867483_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.3e-38	36.1
WP_064626035.1\|2867479_2868358_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	6.4e-110	67.6
WP_064626036.1\|2868381_2869446_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.6e-102	54.0
WP_064626037.1\|2869706_2870648_+	ADP-glyceromanno-heptose 6-epimerase	E3SL51	Synechococcus_phage	6.6e-36	38.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP011461

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

133926 : 178921

Staphylococcus_phage(11.11%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_026027704.1\|133926_134958_+\|transposase	IS630-like element ISVa15 family transposase	NA	NA	NA	NA
WP_185762063.1\|135168_136569_+	sphingomyelin phosphodiesterase	A0A1P8L6H7	Staphylococcus_phage	2.6e-60	45.0
WP_081265567.1\|136639_139552_-	TMAO reductase system sensor histidine kinase/response regulator TorS	A0A1V0SGX0	Hokovirus	1.3e-58	34.3
WP_064626218.1\|139625_140627_+	TMAO reductase system periplasmic protein TorT	NA	NA	NA	NA
WP_064626219.1\|140699_141134_+	methylglyoxal synthase	NA	NA	NA	NA
WP_064626220.1\|141241_143305_-	DNA helicase IV	A7KV33	Bacillus_phage	7.7e-21	24.5
WP_064626221.1\|143487_145641_+	TIGR01666 family membrane protein	NA	NA	NA	NA
WP_064626222.1\|145779_146004_+	hypothetical protein	NA	NA	NA	NA
WP_013867906.1\|146071_146371_+	hypothetical protein	NA	NA	NA	NA
WP_064626223.1\|146458_147718_+	hydroxymethylglutaryl-CoA reductase	NA	NA	NA	NA
WP_064626224.1\|147903_149448_+	glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_064626225.1\|149591_150257_+	flagellar brake protein	NA	NA	NA	NA
WP_064626083.1\|151080_152217_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_064626227.1\|154072_155173_-	autoinducer 2-binding periplasmic protein LuxP	NA	NA	NA	NA
WP_017046397.1\|155397_156549_-	conjugal transfer protein TraF	NA	NA	NA	NA
WP_064626228.1\|156644_156968_-	GIY-YIG nuclease family protein	W8W2G4	Invertebrate_iridovirus	3.0e-12	49.3
WP_064626229.1\|156968_157622_-	YceH family protein	NA	NA	NA	NA
WP_026028336.1\|157679_157883_-	hypothetical protein	NA	NA	NA	NA
WP_010319897.1\|158073_158391_+	DUF496 family protein	NA	NA	NA	NA
WP_013867916.1\|158700_158952_+	YgjV family protein	A0A248SJ16	Salicola_phage	1.6e-05	40.3
WP_026029114.1\|159100_160621_-	glycerol kinase GlpK	NA	NA	NA	NA
WP_010319894.1\|160673_161528_-	aquaporin family protein	M1HJ75	Acanthocystis_turfacea_Chlorella_virus	2.9e-14	29.3
WP_064626230.1\|162057_163707_+	anaerobic glycerol-3-phosphate dehydrogenase subunit A	NA	NA	NA	NA
WP_064626231.1\|163703_165017_+	glycerol-3-phosphate dehydrogenase subunit GlpB	NA	NA	NA	NA
WP_064626232.1\|165013_166240_+	anaerobic glycerol-3-phosphate dehydrogenase subunit C	NA	NA	NA	NA
WP_064626233.1\|166329_167421_-	ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_081265568.1\|167610_167844_+	thioredoxin	NA	NA	NA	NA
WP_076611988.1\|168203_169373_+\|transposase	ISL3-like element ISVa10 family transposase	A0A0A8WEF4	Clostridium_phage	2.3e-06	20.7
WP_064626234.1\|169594_172309_-	ATP-binding protein	NA	NA	NA	NA
WP_064626235.1\|173103_174576_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.2e-129	49.7
WP_064624465.1\|174847_176155_-\|transposase	IS4-like element ISVa16 family transposase	NA	NA	NA	NA
WP_185762030.1\|176460_177583_+\|transposase	IS3 family transposase	Q6H9S3	Enterobacteria_phage	1.9e-26	31.8
WP_064626236.1\|177940_178921_+\|transposase	IS5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

185904 : 238326

Vibrio_phage(10.0%)

transposase,protease,integrase

attL 185096:185111|attR 226905:226920

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
185096:185111	attL	NA	NA	NA	NA
WP_064626241.1\|185904_186405_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_064626242.1\|187141_188050_-\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	1.0e-102	60.5
WP_064626243.1\|188701_190012_+	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_064626244.1\|190304_191171_-	acetyl-CoA carboxylase carboxyltransferase subunit beta	NA	NA	NA	NA
WP_064626245.1\|191279_192185_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_064626246.1\|192468_193923_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_081265569.1\|193919_194450_-	hypothetical protein	NA	NA	NA	NA
WP_064626248.1\|194446_196915_-	hypothetical protein	NA	NA	NA	NA
WP_064626249.1\|196908_199269_-	hypothetical protein	NA	NA	NA	NA
WP_064626250.1\|199392_199647_+	thioredoxin TrxC	NA	NA	NA	NA
WP_026027460.1\|199849_201001_+	MFS transporter	NA	NA	NA	NA
WP_013867924.1\|201017_201473_-	nitrous oxide-stimulated promoter family protein	NA	NA	NA	NA
WP_064626251.1\|201519_201720_+	DUF2986 domain-containing protein	NA	NA	NA	NA
WP_010319683.1\|201708_202182_-	NYN domain-containing protein	NA	NA	NA	NA
WP_064626252.1\|202245_203001_-	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_029189754.1\|203069_203882_-	formate/nitrite transporter family protein	NA	NA	NA	NA
WP_064626253.1\|204024_204360_-	nitrite reductase small subunit NirD	NA	NA	NA	NA
WP_064626254.1\|204362_206951_-	nitrite reductase large subunit	NA	NA	NA	NA
WP_064626255.1\|207590_208190_-	cysteine hydrolase	NA	NA	NA	NA
WP_064626256.1\|208398_209796_+	lysine decarboxylase	NA	NA	NA	NA
WP_064626257.1\|209799_212307_+	AMP-binding protein	NA	NA	NA	NA
WP_064626258.1\|212353_213214_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_017037465.1\|213599_214025_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_064626259.1\|214041_214800_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_064626260.1\|215037_215349_-\|transposase	IS3 family transposase	Q716C1	Shigella_phage	5.9e-26	64.3
WP_064626261.1\|215552_216941_+\|transposase	IS4 family transposase	Q9JMP3	Wolbachia_phage	4.2e-47	27.8
WP_064626262.1\|217083_217872_+	lipase	Q6XLV5	Feldmannia_irregularis_virus	1.1e-07	30.2
WP_019283198.1\|218476_219922_-	ATPase RavA stimulator ViaA	NA	NA	NA	NA
WP_064626263.1\|219931_221590_-	DUF3763 domain-containing protein	A0A2H4PB07	Aphanizomenon_phage	8.6e-31	27.4
WP_017048791.1\|221867_222383_+	NUDIX hydrolase	Q5ULM8	Lactobacillus_virus	3.0e-06	30.5
WP_064626264.1\|222492_223497_+	low-specificity L-threonine aldolase	NA	NA	NA	NA
WP_013867941.1\|223620_224331_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_064626265.1\|224341_225607_-	DEAD/DEAH box helicase	A0A1V0SIR5	Klosneuvirus	3.7e-58	37.0
WP_017047351.1\|226213_227431_+	amino acid permease	NA	NA	NA	NA
226905:226920	attR	NA	NA	NA	NA
WP_064626266.1\|227617_229045_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.3e-11	48.5
WP_029189705.1\|229140_230157_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	8.0e-80	46.5
WP_088721589.1\|230365_231109_+	LamB/YcsF family protein	NA	NA	NA	NA
WP_064626268.1\|231162_231882_+	allophanate hydrolase subunit 1	NA	NA	NA	NA
WP_064626269.1\|231878_232808_+	biotin-dependent carboxyltransferase	NA	NA	NA	NA
WP_064626270.1\|232852_234301_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_064626271.1\|234609_237051_-	ABC transporter permease	NA	NA	NA	NA
WP_064626272.1\|237050_237725_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.7e-23	34.9
WP_064626273.1\|237723_238326_+\|protease	multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1	NA	NA	NA	NA

DBSCAN-SWA_3

326637 : 345950

Vibrio_phage(36.36%)

transposase,terminase,tail,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001900911.1\|326637_327366_-	helix-turn-helix transcriptional regulator	A0A2I7S9A5	Vibrio_phage	1.8e-28	33.2
WP_032481898.1\|327552_327771_+	helix-turn-helix domain-containing protein	A0A2I7S995	Vibrio_phage	2.4e-18	66.2
WP_064626322.1\|327781_329836_+\|transposase	Mu transposase C-terminal domain-containing protein	M4M9R2	Vibrio_phage	3.5e-74	29.6
WP_001900914.1\|329832_330765_+	AAA family ATPase	A0A0C4UQR3	Shigella_phage	9.7e-32	30.8
WP_001900877.1\|330767_331166_+	hypothetical protein	NA	NA	NA	NA
WP_064626323.1\|331162_331381_+	hypothetical protein	NA	NA	NA	NA
WP_064626324.1\|331380_331632_+	hypothetical protein	NA	NA	NA	NA
WP_064626325.1\|331628_332279_+	DUF3164 family protein	Q6QIE4	Burkholderia_phage	1.1e-08	27.1
WP_064626326.1\|332289_332511_+	hypothetical protein	NA	NA	NA	NA
WP_064626327.1\|332797_333946_-	restriction endonuclease subunit S	A0A2H4J4K4	uncultured_Caudovirales_phage	2.0e-34	53.8
WP_064626328.1\|333957_335979_-	N-6 DNA methylase	A0A2H4JBT5	uncultured_Caudovirales_phage	3.1e-240	62.0
WP_185762058.1\|336276_336552_+	hypothetical protein	NA	NA	NA	NA
WP_064626330.1\|336548_336998_+	regulatory protein GemA	NA	NA	NA	NA
WP_048615421.1\|336982_337258_+	hypothetical protein	NA	NA	NA	NA
WP_185762059.1\|337392_337725_-	hypothetical protein	NA	NA	NA	NA
WP_064626974.1\|337666_338029_-	hypothetical protein	NA	NA	NA	NA
WP_064626332.1\|338030_338570_-	lysozyme	E5G6N1	Salmonella_phage	1.4e-27	43.7
WP_064626333.1\|338566_338827_-	hypothetical protein	NA	NA	NA	NA
WP_064626334.1\|338851_340018_-\|plate	baseplate J/gp47 family protein	A0A059WFM2	Vibrio_phage	8.1e-44	34.0
WP_064626335.1\|340019_341051_-	hypothetical protein	Q6QIA2	Burkholderia_phage	4.7e-19	27.4
WP_064626336.1\|341041_341260_-\|tail	tail protein X	NA	NA	NA	NA
WP_064626337.1\|341256_341655_-\|tail	phage tail protein	NA	NA	NA	NA
WP_064626338.1\|341656_342244_-	hypothetical protein	NA	NA	NA	NA
WP_064626339.1\|342240_342879_-	hypothetical protein	NA	NA	NA	NA
WP_001900923.1\|343018_343570_+	DUF3486 family protein	NA	NA	NA	NA
WP_064626340.1\|343566_345219_+\|terminase	phage terminase large subunit	A0A2K9VGU9	Faecalibacterium_phage	1.0e-36	30.2
WP_064626341.1\|345227_345950_+\|plate	phage baseplate assembly protein V	NA	NA	NA	NA

DBSCAN-SWA_4

1088564 : 1152731

Vibrio_phage(30.77%)

tail,lysis,integrase,plate,portal,transposase,protease,terminase,tRNA

attL 1108695:1108723|attR 1147974:1148002

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_064626718.1\|1088564_1089761_+\|integrase	site-specific integrase	A0A1P8DTG6	Proteus_phage	3.0e-57	31.0
WP_064626720.1\|1090147_1091038_+	hypothetical protein	NA	NA	NA	NA
WP_064626723.1\|1091067_1092408_-	site-specific DNA-methyltransferase	A0A222ZMD5	Mycobacterium_phage	1.9e-49	33.4
WP_017042942.1\|1093045_1093249_-	hypothetical protein	NA	NA	NA	NA
WP_064626729.1\|1093326_1093710_-	hypothetical protein	NA	NA	NA	NA
WP_017042096.1\|1093706_1093964_-	hypothetical protein	NA	NA	NA	NA
WP_064626732.1\|1094111_1094804_-	hypothetical protein	Q6JII4	Burkholderia_virus	1.1e-11	26.9
WP_064626735.1\|1094874_1095135_-	hypothetical protein	NA	NA	NA	NA
WP_064626738.1\|1095273_1095990_-	Cro/Cl family transcriptional regulator	K7PLZ5	Enterobacterial_phage	1.4e-30	42.5
WP_064626741.1\|1096095_1096350_+	hypothetical protein	NA	NA	NA	NA
WP_017042100.1\|1096389_1096938_+	hypothetical protein	NA	NA	NA	NA
WP_064626744.1\|1097113_1097914_+	hypothetical protein	A0A067ZIA1	Vibrio_phage	1.6e-35	54.9
WP_064626747.1\|1097916_1098654_+	ATP-binding protein	S4TNF5	Salmonella_phage	1.8e-41	43.5
WP_064626750.1\|1098666_1099251_+	hypothetical protein	NA	NA	NA	NA
WP_064626753.1\|1099442_1100492_-	site-specific DNA-methyltransferase	Q6UAT0	Klebsiella_phage	5.5e-108	63.0
WP_064626756.1\|1100654_1100870_-	hypothetical protein	NA	NA	NA	NA
WP_064626759.1\|1101096_1102071_+	hypothetical protein	NA	NA	NA	NA
WP_017050076.1\|1102057_1102492_+	hypothetical protein	NA	NA	NA	NA
WP_064626762.1\|1103147_1105628_+	DEAD/DEAH box helicase family protein	NA	NA	NA	NA
WP_064626765.1\|1107516_1108053_+	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_064626768.1\|1108236_1108404_+	YjzC family protein	NA	NA	NA	NA
WP_064626771.1\|1108430_1108664_+	hypothetical protein	NA	NA	NA	NA
WP_185762048.1\|1108656_1108779_+	DUF3265 domain-containing protein	NA	NA	NA	NA
1108695:1108723	attL	NA	NA	NA	NA
WP_064626774.1\|1108806_1109442_+	hypothetical protein	NA	NA	NA	NA
WP_064626776.1\|1109596_1110295_+	hypothetical protein	NA	NA	NA	NA
WP_185762066.1\|1110318_1110441_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_064626779.1\|1110471_1110822_+	hypothetical protein	NA	NA	NA	NA
WP_064626781.1\|1110983_1112912_+	DUF3696 domain-containing protein	Q2P9X8	Enterobacteria_phage	1.1e-16	40.8
WP_064626783.1\|1112899_1113922_+	hypothetical protein	NA	NA	NA	NA
WP_017042796.1\|1115198_1115393_+	hypothetical protein	A0A1V1FD92	Vibrio_phage	1.4e-14	64.5
WP_064626785.1\|1115376_1115865_+	lysozyme	A0A1U9GSH3	Vibrio_phage	5.0e-80	90.7
WP_064626787.1\|1115837_1116329_+\|lysis	lysis protein	A0A1V0E843	Vibrio_phage	1.4e-16	39.0
WP_017042799.1\|1116667_1117138_+	DUF1441 family protein	NA	NA	NA	NA
WP_064626789.1\|1117118_1119206_+\|terminase	phage terminase large subunit family protein	A0A219YAX2	Aeromonas_phage	2.6e-125	37.5
WP_064626791.1\|1119202_1119421_+	hypothetical protein	NA	NA	NA	NA
WP_064626793.1\|1119413_1120913_+\|portal	phage portal protein	A0A0A0YUB7	Pseudomonas_phage	2.1e-76	34.2
WP_017042803.1\|1120905_1123086_+\|protease	Clp protease ClpP	A0A0K2CYC6	Paenibacillus_phage	1.2e-24	32.7
WP_064626795.1\|1123161_1123500_+	hypothetical protein	NA	NA	NA	NA
WP_064626797.1\|1123502_1123838_+	hypothetical protein	NA	NA	NA	NA
WP_064626799.1\|1123815_1124340_+	hypothetical protein	NA	NA	NA	NA
WP_064626801.1\|1124305_1124812_+	hypothetical protein	NA	NA	NA	NA
WP_064626992.1\|1124822_1125473_+\|plate	phage baseplate assembly protein V	A2I2X5	Vibrio_virus	1.1e-16	39.2
WP_064626803.1\|1125469_1125805_+	hypothetical protein	NA	NA	NA	NA
WP_064626805.1\|1125801_1126791_+\|plate	baseplate J/gp47 family protein	Q6R4V6	Vibrio_virus	7.1e-57	38.8
WP_064626807.1\|1126774_1127389_+\|tail	phage tail protein	NA	NA	NA	NA
WP_064626809.1\|1127381_1128590_+\|tail	phage tail protein	A0A1V0E875	Vibrio_phage	3.2e-11	61.3
WP_064626811.1\|1128586_1129150_+	hypothetical protein	R9TMQ2	Vibrio_phage	1.5e-35	71.4
WP_064626813.1\|1129207_1129447_+	hypothetical protein	NA	NA	NA	NA
WP_064626815.1\|1129446_1130616_+\|tail	phage tail protein	Q6R4W2	Vibrio_virus	2.1e-84	43.4
WP_064626817.1\|1130608_1131085_+\|tail	phage major tail tube protein	NA	NA	NA	NA
WP_081265611.1\|1131149_1131872_+	hypothetical protein	NA	NA	NA	NA
WP_064626818.1\|1131983_1134713_+\|tail	phage tail tape measure protein	A2I2Y1	Vibrio_virus	2.5e-43	35.4
WP_017043789.1\|1134715_1135081_+\|tail	phage tail protein	NA	NA	NA	NA
WP_017043788.1\|1135080_1135284_+	hypothetical protein	NA	NA	NA	NA
WP_064626820.1\|1135283_1136261_+	hypothetical protein	A2I2Y5	Vibrio_virus	1.0e-52	35.2
WP_064626822.1\|1136260_1137508_+\|integrase	site-specific integrase	A0A067ZJC5	Vibrio_phage	9.0e-57	34.6
WP_010319593.1\|1138324_1140253_+\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	3.8e-123	36.6
WP_080569453.1\|1140256_1140808_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	1.2e-13	39.0
WP_010319591.1\|1140911_1141106_+	50S ribosomal protein L35	NA	NA	NA	NA
WP_010319590.1\|1141147_1141501_+	50S ribosomal protein L20	NA	NA	NA	NA
WP_017043784.1\|1141572_1142535_-\|integrase	integron integrase	A0A1P8DJJ6	Virus_Rctr41k	7.6e-56	40.8
WP_064626825.1\|1142776_1143349_+	hypothetical protein	NA	NA	NA	NA
WP_064626827.1\|1144008_1144677_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_064626834.1\|1145474_1146836_+	hypothetical protein	R9TRQ8	Vibrio_phage	3.9e-29	26.3
WP_064626835.1\|1147495_1147951_+	hypothetical protein	NA	NA	NA	NA
WP_081265612.1\|1147947_1148058_+	DUF3265 domain-containing protein	NA	NA	NA	NA
1147974:1148002	attR	NA	NA	NA	NA
WP_081265634.1\|1148418_1148541_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_064626837.1\|1148563_1149226_+	hypothetical protein	NA	NA	NA	NA
WP_064626839.1\|1149380_1149776_+	DUF3465 domain-containing protein	NA	NA	NA	NA
WP_081265635.1\|1150722_1150845_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_064626843.1\|1150903_1151347_+	hypothetical protein	NA	NA	NA	NA
WP_064626083.1\|1151594_1152731_-\|transposase	ISAs1 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP011460

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP011461

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection