CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP014765	Klebsiella pneumoniae strain KPNIH39 plasmid pKpQIL-9b8, complete sequence	0 crisprs	NA	0	1
NZ_CP014763	Klebsiella pneumoniae strain KPNIH39 plasmid pKPN-332, complete sequence	0 crisprs	csa3,RT	0	3
NZ_CP014762	Klebsiella pneumoniae strain KPNIH39 chromosome, complete genome	1 crisprs	RT,WYL,cas3,DEDDh,DinG,csa3	1	7
NZ_CP014764	Klebsiella pneumoniae strain KPNIH39 plasmid pKPN-704, complete sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

10758 : 56765

Escherichia_phage(27.78%)

transposase,integrase

attL 18921:18935|attR 58123:58137

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004152392.1\|10758_13788_+\|transposase	Tn3-like element Tn4401 family transposase	NA	NA	NA	NA
WP_004199214.1\|13894_14920_+\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	1.4e-87	50.3
WP_004152394.1\|14916_15696_+	IS21-like element ISKpn7 family helper ATPase IstB	A0A2L1IVB6	Escherichia_phage	2.5e-89	61.8
WP_004152396.1\|15983_16865_+	carbapenem-hydrolyzing class A beta-lactamase KPC-3	A0A1B0VBP7	Salmonella_phage	2.8e-73	52.2
WP_004152397.1\|17114_18434_-\|transposase	IS1182-like element ISKpn6 family transposase	Q9MBP7	Staphylococcus_prophage	1.9e-12	24.2
WP_004152398.1\|18710_19895_-\|transposase	ISAs1-like element ISKpn31 family transposase	NA	NA	NA	NA
18921:18935	attL	NA	NA	NA	NA
WP_004152400.1\|20398_20758_+	DUF305 domain-containing protein	A0A218MND9	uncultured_virus	3.6e-19	62.0
WP_004152401.1\|21414_21825_-	hypothetical protein	NA	NA	NA	NA
WP_004152402.1\|21923_22544_-	recombinase family protein	A0A219Y912	Aeromonas_phage	2.0e-09	31.5
WP_023307208.1\|22632_25530_-\|transposase	Tn3-like element Tn5403 family transposase	A0A1B0V7H9	Salmonella_phage	5.5e-182	37.8
WP_000509966.1\|25624_26230_+	recombinase family protein	A0A1S5Y2X8	uncultured_archaeal_virus	5.5e-20	35.3
WP_004194048.1\|26889_28071_+	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	1.9e-120	64.2
WP_000091613.1\|28497_28812_-	hypothetical protein	NA	NA	NA	NA
WP_000215515.1\|29066_29423_-	cupin domain-containing protein	NA	NA	NA	NA
WP_001293886.1\|29412_29814_-	DUF86 domain-containing protein	NA	NA	NA	NA
WP_001247892.1\|29810_30101_-	nucleotidyltransferase	NA	NA	NA	NA
WP_003100881.1\|30175_33142_+\|transposase	Tn3-like element ISPa38 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	73.2
WP_000427623.1\|33220_34225_+\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_004197809.1\|34406_34610_-	hypothetical protein	NA	NA	NA	NA
WP_004197808.1\|34623_34827_-	hemolysin expression modulator Hha	NA	NA	NA	NA
WP_004197807.1\|34860_35229_-	hypothetical protein	NA	NA	NA	NA
WP_020805591.1\|35272_35767_-	hypothetical protein	NA	NA	NA	NA
WP_020805590.1\|35797_36370_-	hypothetical protein	NA	NA	NA	NA
WP_000272716.1\|36366_36615_-	hypothetical protein	NA	NA	NA	NA
WP_020315560.1\|37051_37741_+	RES family NAD+ phosphorylase	NA	NA	NA	NA
WP_004193995.1\|37772_38462_-	hypothetical protein	NA	NA	NA	NA
WP_001568025.1\|39016_39235_+	type II toxin-antitoxin system antitoxin CcdA	NA	NA	NA	NA
WP_001568026.1\|39236_39542_+	type II toxin-antitoxin system toxin CcdB	NA	NA	NA	NA
WP_072158608.1\|39710_40106_+	hypothetical protein	NA	NA	NA	NA
WP_022644730.1\|40132_40456_+	hypothetical protein	NA	NA	NA	NA
WP_020315256.1\|40452_41469_+	hypothetical protein	NA	NA	NA	NA
WP_019705993.1\|41803_43072_-\|transposase	ISL3 family transposase	Q6V7R1	Burkholderia_virus	1.1e-59	34.4
WP_019705992.1\|43076_46334_-	type I restriction endonuclease subunit R	NA	NA	NA	NA
WP_032436768.1\|46334_47609_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_019706038.1\|47605_49633_-	SAM-dependent DNA methyltransferase	A0A220A2U5	Liberibacter_phage	2.1e-26	26.6
WP_004197635.1\|49786_50581_+\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	5.5e-52	88.7
WP_006788217.1\|51028_51208_-	hypothetical protein	NA	NA	NA	NA
WP_004197649.1\|51327_51954_-	ParA family plasmid-partitioning AAA ATPase	A0A222YXS3	Escherichia_phage	2.9e-40	43.6
WP_004197644.1\|52570_53446_-	RepB family plasmid replication initiator protein	Q71TL8	Escherichia_phage	1.1e-82	56.8
WP_004197646.1\|53857_55129_-	Y-family DNA polymerase	F1C5A5	Cronobacter_phage	5.2e-153	64.0
WP_001568036.1\|55128_55560_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	2.1e-29	53.3
WP_001568038.1\|55793_56765_+	hypothetical protein	A0A222YXF2	Escherichia_phage	1.1e-73	46.8
58123:58137	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP014763

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3779 : 74094

uncultured_Caudovirales_phage(25.0%)

integrase,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023205099.1\|3779_3920_+\|protease	ATP-dependent metalloprotease FtsH	NA	NA	NA	NA
WP_004118778.1\|4007_4466_+	small heat shock protein sHSP20-GI	NA	NA	NA	NA
WP_023280936.1\|4488_5403_+	heat resistance protein YfdX1	NA	NA	NA	NA
WP_013307890.1\|5505_6393_+	heat resistance protein YfdX2	NA	NA	NA	NA
WP_023329026.1\|6482_7124_+	heat resistance membrane protein HdeD-GI	NA	NA	NA	NA
WP_023280938.1\|7172_8318_+	hypothetical protein	NA	NA	NA	NA
WP_023280939.1\|8307_8748_+	heat resistance system thioredoxin Trx-GI	A0A023NHA9	Dinoroseobacter_phage	4.5e-11	34.7
WP_023280940.1\|8751_10467_+	heat resistance system K+/H+ antiporter KefB-GI	NA	NA	NA	NA
WP_023280941.1\|10463_10961_+	heat resistance protein PsiE-GI	NA	NA	NA	NA
WP_023280943.1\|11927_13079_+	trypsin-like peptidase domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	7.5e-26	30.3
WP_023280945.1\|13922_14918_+\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	3.5e-19	27.9
WP_048270273.1\|15051_17190_+	AAA family ATPase	NA	NA	NA	NA
WP_029497503.1\|17186_18971_+	ATP-dependent helicase	A7KV33	Bacillus_phage	9.6e-20	26.8
WP_003031967.1\|19501_20470_-\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	2.8e-13	29.1
WP_087759866.1\|21087_22208_-\|transposase	IS3-like element ISKpn34 family transposase	S5WIU1	Leptospira_phage	1.1e-50	43.3
WP_101677559.1\|23820_24333_-	tyrosine-protein phosphatase	NA	NA	NA	NA
WP_025714559.1\|24456_24966_-	arsenate reductase ArsC	A0A2H4J437	uncultured_Caudovirales_phage	1.7e-14	40.4
WP_025714558.1\|25038_25467_-	glutaredoxin-dependent arsenate reductase	A0A2H4J8T1	uncultured_Caudovirales_phage	1.2e-50	71.4
WP_032951259.1\|25524_26814_-	arsenic transporter	A0A2H4J144	uncultured_Caudovirales_phage	6.2e-170	72.5
WP_025714556.1\|26854_28621_-	arsenical pump-driving ATPase	NA	NA	NA	NA
WP_025714555.1\|28644_29010_-	arsenite efflux transporter metallochaperone ArsD	NA	NA	NA	NA
WP_025714554.1\|29034_29514_-	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	1.1e-36	52.6
WP_025714553.1\|29570_29924_-	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	2.6e-22	45.7
WP_009310076.1\|30168_31149_+\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	1.2e-184	98.5
WP_004149658.1\|31482_32199_+	EAL domain-containing protein	NA	NA	NA	NA
WP_000677445.1\|32233_32869_-	type 3 fimbria minor subunit MrkF	NA	NA	NA	NA
WP_064798502.1\|32882_33878_-	type 3 fimbria adhesin subunit MrkD	NA	NA	NA	NA
WP_000813718.1\|33868_36355_-	type 3 fimbria usher protein MrkC	NA	NA	NA	NA
WP_000820818.1\|36366_37068_-	type 3 fimbria chaperone MrkB	NA	NA	NA	NA
WP_000756959.1\|37163_37772_-	type 3 fimbria major subunit MrkA	NA	NA	NA	NA
WP_072196505.1\|38096_39065_+\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	4.5e-173	91.9
WP_020804663.1\|39260_39926_-	response regulator transcription factor	NA	NA	NA	NA
WP_004187025.1\|41014_41263_-	plasmid stabilization protein	NA	NA	NA	NA
WP_001189111.1\|42977_44486_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	3.6e-44	31.8
WP_000227969.1\|45027_46104_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_001000602.1\|46544_47696_+	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	6.7e-99	53.7
WP_001067855.1\|48272_48977_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_040217245.1\|49419_51867_-	glycogen phosphorylase	A0A140XAG6	Dickeya_phage	1.6e-25	70.5
WP_009653212.1\|51885_53319_-	glycogen synthase GlgA	NA	NA	NA	NA
WP_004099051.1\|53407_54691_-	glucose-1-phosphate adenylyltransferase	NA	NA	NA	NA
WP_004099052.1\|54820_57013_-	1,4-alpha-glucan branching enzyme	NA	NA	NA	NA
WP_004099053.1\|57385_58354_+\|transposase	IS5-like element IS903B family transposase	A0A1B0VFY5	Salmonella_phage	5.1e-185	98.8
WP_009309916.1\|59281_60160_+	restriction endonuclease	NA	NA	NA	NA
WP_020804312.1\|60200_60617_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_001261276.1\|60613_60844_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_004213562.1\|61772_62594_+	hypothetical protein	NA	NA	NA	NA
WP_004213560.1\|62590_63370_+\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	6.0e-51	89.4
WP_004213558.1\|63514_64444_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	5.6e-72	52.4
WP_077250517.1\|64756_64915_+	hypothetical protein	A0A0U2RK18	Escherichia_phage	2.2e-05	69.7
WP_040217012.1\|64893_66642_-	hypothetical protein	NA	NA	NA	NA
WP_032427877.1\|66830_67088_+	molecular chaperone DnaJ	NA	NA	NA	NA
WP_040118447.1\|67611_68478_+	ParA family protein	NA	NA	NA	NA
WP_004902347.1\|68477_69509_+	ParB/RepB/Spo0J family partition protein	S5WII0	Leptospira_phage	2.9e-08	26.1
WP_004902343.1\|69508_69946_+	hypothetical protein	NA	NA	NA	NA
WP_004902338.1\|69942_70266_+	hypothetical protein	NA	NA	NA	NA
WP_004214667.1\|72292_73075_-	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	3.0e-135	96.1
WP_040217490.1\|73071_74094_-\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	7.8e-184	90.6

DBSCAN-SWA_2

85074 : 122770

Salmonella_phage(33.33%)

transposase,protease,integrase

attL 74482:74495|attR 94473:94486

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
74482:74495	attL	NA	NA	NA	NA
WP_040217228.1\|85074_86091_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_040217224.1\|86996_87602_+	hypothetical protein	NA	NA	NA	NA
WP_040217223.1\|87588_87831_+	hypothetical protein	NA	NA	NA	NA
WP_064798504.1\|87878_88343_+	hypothetical protein	NA	NA	NA	NA
WP_040217219.1\|88352_88760_+	hypothetical protein	NA	NA	NA	NA
WP_040217217.1\|88802_89762_+	DNA replication protein	NA	NA	NA	NA
WP_032720851.1\|89758_90517_+	hypothetical protein	NA	NA	NA	NA
WP_040217214.1\|90513_90837_+	hypothetical protein	NA	NA	NA	NA
WP_012540152.1\|91052_91370_+	hypothetical protein	NA	NA	NA	NA
WP_064798505.1\|91435_92572_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_040217276.1\|92749_93004_+	hypothetical protein	NA	NA	NA	NA
WP_040215144.1\|94017_95550_+\|transposase	IS3-like element ISKpn38 family transposase	A0A1B1P773	Bacillus_phage	3.1e-51	39.8
94473:94486	attR	NA	NA	NA	NA
WP_052455510.1\|96032_96818_+	hypothetical protein	NA	NA	NA	NA
WP_004026560.1\|97138_98038_+	RepB family plasmid replication initiator protein	A0A1B0VDL5	Salmonella_phage	6.9e-67	49.0
WP_004026564.1\|100928_101864_+\|protease	omptin family outer membrane protease Kop	NA	NA	NA	NA
WP_004210306.1\|102335_102818_+	hypothetical protein	NA	NA	NA	NA
WP_017146616.1\|103061_103376_-	hypothetical protein	NA	NA	NA	NA
WP_004181742.1\|104318_104531_+	hypothetical protein	NA	NA	NA	NA
WP_040217023.1\|104624_104903_+	DUF1778 domain-containing protein	NA	NA	NA	NA
WP_001189111.1\|106275_107784_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	3.6e-44	31.8
WP_148721855.1\|109323_109821_-	carboxypeptidase regulatory-like domain-containing protein	NA	NA	NA	NA
WP_077268204.1\|110253_111222_-\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	2.7e-178	95.7
WP_064798507.1\|111491_112991_-	kinase	NA	NA	NA	NA
WP_064798508.1\|113018_114752_-	protein phosphatase 2C domain-containing protein	NA	NA	NA	NA
WP_004026583.1\|114751_115792_-	VWA domain-containing protein	NA	NA	NA	NA
WP_004026585.1\|115884_116523_-	VWA domain-containing protein	NA	NA	NA	NA
WP_040216808.1\|116523_117165_-	TerD family protein	A0A2P1N0C0	Streptomyces_phage	9.1e-05	24.1
WP_004026588.1\|117189_117828_-	VWA domain-containing protein	NA	NA	NA	NA
WP_040216810.1\|118142_118964_-	hypothetical protein	NA	NA	NA	NA
WP_040216811.1\|119039_119498_-	tellurium resistance protein TerW	NA	NA	NA	NA
WP_040216813.1\|119500_120724_-	DUF4236 domain-containing protein	NA	NA	NA	NA
WP_040216815.1\|120734_121691_-	HpcH/HpaI aldolase/citrate lyase family protein	NA	NA	NA	NA
WP_040216817.1\|121690_122770_-\|protease	cysteine protease StiP family protein	A0A172Q0S8	Acinetobacter_phage	1.7e-40	34.1

DBSCAN-SWA_3

167314 : 232320

Salmonella_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016530671.1\|167314_167593_-\|transposase	transposase	Q71TE9	Escherichia_phage	4.3e-28	68.2
WP_004118901.1\|168218_169211_-	DsbA family protein	NA	NA	NA	NA
WP_040216544.1\|169207_170797_-	AMP-binding protein	Q75ZG1	Hepacivirus	2.1e-34	25.0
WP_032413280.1\|170833_172240_-	cytosine permease	NA	NA	NA	NA
WP_064798510.1\|174287_175844_+	EAL domain-containing protein	NA	NA	NA	NA
WP_110570736.1\|177416_177626_+\|transposase	transposase	S5WIU1	Leptospira_phage	1.0e-13	54.8
WP_040216683.1\|179000_180368_-	formimidoylglutamate deiminase	NA	NA	NA	NA
WP_032413289.1\|180466_181228_+	histidine utilization repressor	NA	NA	NA	NA
WP_004118884.1\|181224_181782_+	HutD family protein	NA	NA	NA	NA
WP_162550805.1\|185297_186206_+	urocanate hydratase	NA	NA	NA	NA
WP_004118873.1\|186258_187650_+	cytosine permease	NA	NA	NA	NA
WP_064798512.1\|187661_188870_+	imidazolonepropionase	NA	NA	NA	NA
WP_004118865.1\|188862_189672_+	N-formylglutamate deformylase	NA	NA	NA	NA
WP_077256199.1\|191944_193543_+	GGDEF domain-containing protein	G3MA91	Bacillus_virus	8.6e-20	32.4
WP_077253754.1\|193634_193748_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	4.7e-10	81.1
WP_077268205.1\|195178_196147_-\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	1.2e-178	96.0
WP_040217049.1\|198627_200319_-	hypothetical protein	NA	NA	NA	NA
WP_052455511.1\|200315_201218_-	hypothetical protein	NA	NA	NA	NA
WP_040217047.1\|201359_202538_-	hypothetical protein	NA	NA	NA	NA
WP_040217046.1\|202659_202845_-	hypothetical protein	NA	NA	NA	NA
WP_117065219.1\|203186_203474_-	SEC-C domain-containing protein	NA	NA	NA	NA
WP_040217043.1\|203965_205702_+	AAA family ATPase	NA	NA	NA	NA
WP_040217041.1\|205691_207110_+	UvrD-helicase domain-containing protein	NA	NA	NA	NA
WP_142390228.1\|207169_207496_+	hypothetical protein	NA	NA	NA	NA
WP_016151349.1\|207521_208490_-\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	5.0e-180	96.3
WP_071953846.1\|208509_208695_+	DUF2188 domain-containing protein	E8ZD70	Streptococcus_phage	1.2e-10	61.4
WP_032413443.1\|209407_209851_+	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_040217285.1\|209847_210318_+	RES family NAD+ phosphorylase	NA	NA	NA	NA
WP_017901409.1\|210427_210688_-	hypothetical protein	NA	NA	NA	NA
WP_077268204.1\|212338_213307_-\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	2.7e-178	95.7
WP_040217080.1\|213736_214921_+	MFS transporter	NA	NA	NA	NA
WP_040217078.1\|214990_215875_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_040217075.1\|216847_217750_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	4.1e-11	24.3
WP_040217073.1\|218042_218762_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_040217071.1\|218828_220151_-	aminotransferase class III-fold pyridoxal phosphate-dependent enzyme	A0A1V0SKB7	Klosneuvirus	5.6e-17	28.1
WP_040217069.1\|220147_221614_-	APC family permease	NA	NA	NA	NA
WP_043875145.1\|221682_223053_-	glutamine synthetase	NA	NA	NA	NA
WP_040217077.1\|223224_224076_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_043875144.1\|224130_224880_+	N-formylglutamate amidohydrolase	NA	NA	NA	NA
WP_040217065.1\|224883_225531_+	cysteine hydrolase	NA	NA	NA	NA
WP_077268206.1\|225572_226541_+\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	1.6e-178	96.0
WP_040217144.1\|227696_228044_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	2.7e-59	95.7
WP_023288266.1\|228040_228379_-	IS66 family insertion sequence hypothetical protein	A0A0P0ZBP6	Stx2-converting_phage	2.3e-47	81.0
WP_011251285.1\|229134_229446_+	type II toxin-antitoxin system HigB family toxin	NA	NA	NA	NA
WP_011251286.1\|229442_229862_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_077268207.1\|230008_230977_+\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	1.6e-170	90.7
WP_001101446.1\|231294_232320_-\|transposase	IS110 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP014762

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP014762_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP014762_1

2364400-2364494

Orphan

Consensus_repeat	Method
GTGCAGGAGATTCACCAGGGGGTAGTGCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP014762_1

>merge|NZ_CP014762|1|2364400-2364494|CRISPRCasFinder
GTGCAGGAGATTCACCAGGGGGTAGTGCAAATCGTTCACTACCTGGTGCAACAGATTCACTACCTGGTGCAGGAGATTCACCAGGGGGTAGTGCA

>NZ_CP014762|1|1|2364400-2364494|CRISPRCasFinder
GTGCAGGAGATTCACCAGGGGGTAGTGCA	AATCGTTCACTACCTGGTGCAACAGATTCACTACCTG
GTGCAGGAGATTCACCAGGGGGTAGTGCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP014762.1\|WP_032430945.1\|2369076_2369334_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014762.1\|WP_019705436.1\|2361768_2361993_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014762.1\|WP_023328636.1\|2368140_2368923_+\|antitermination-protein	unknown	unknown	gnl\|CDD\|367572
NZ_CP014762.1\|WP_023304721.1\|2361402_2361768_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014762.1\|WP_032430925.1\|2363949_2364138_+\|DUF4222-domain-containing-protein	unknown	unknown	gnl\|CDD\|372855
NZ_CP014762.1\|WP_017145563.1\|2370249_2370645_+\|phage-holin-family-protein	unknown	unknown	gnl\|CDD\|374892
NZ_CP014762.1\|WP_023328645.1\|2361155_2361410_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014762.1\|WP_031280381.1\|2369239_2369686_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014762.1\|WP_071953780.1\|2363646_2363874_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|374243
NZ_CP014762.1\|WP_019705435.1\|2362163_2362358_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014762.1\|WP_023328647.1\|2360543_2360969_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014762.1\|WP_023328643.1\|2362814_2363522_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225484
NZ_CP014762.1\|WP_023328648.1\|2360358_2360547_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014762.1\|WP_023328640.1\|2365851_2367231_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|273206
NZ_CP014762.1\|WP_019705280.1\|2370631_2370913_+\|phage-holin-family-protein	unknown	unknown	gnl\|CDD\|368449
NZ_CP014762.1\|WP_023328641.1\|2364976_2365855_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|181180
NZ_CP014762.1\|WP_019705434.1\|2362347_2362656_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014762.1\|WP_023328639.1\|2367217_2367586_+\|RusA-family-crossover-junction-endodeoxyribonuclease	unknown	unknown	gnl\|CDD\|377564
NZ_CP014762.1\|WP_023304728.1\|2370912_2371542_+\|glycoside-hydrolase-family-19-protein	unknown	unknown	gnl\|CDD\|225720
NZ_CP014762.1\|WP_023328637.1\|2367667_2368144_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP014762.1\|WP_019705280.1\|2370631_2370913_+\|phage-holin-family-protein	gnl\|CDD\|368449	pfam05449, Phage_holin_3_7, Putative 3TM holin, Phage_holin_3. This is a family of putative proteobacterial phage three-transmembrane-domain holins.	4.38346e-22
NZ_CP014762.1\|WP_023304728.1\|2370912_2371542_+\|glycoside-hydrolase-family-19-protein	gnl\|CDD\|225720	COG3179, COG3179, Predicted chitinase [General function prediction only].	9.03114e-69
NZ_CP014762.1\|WP_017145563.1\|2370249_2370645_+\|phage-holin-family-protein	gnl\|CDD\|374892	pfam16931, Phage_holin_8, Putative phage holin.	3.84006e-36
NZ_CP014762.1\|WP_023328643.1\|2362814_2363522_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|225484	COG2932, COG2932, Predicted transcriptional regulator [Transcription].	2.01457e-35
NZ_CP014762.1\|WP_023328636.1\|2368140_2368923_+\|antitermination-protein	gnl\|CDD\|367572	pfam03589, Antiterm, Antitermination protein.	1.12913e-26
NZ_CP014762.1\|WP_023328641.1\|2364976_2365855_+\|ATP-binding-protein	gnl\|CDD\|181180	PRK07952, PRK07952, DNA replication protein DnaC; Validated.	3.5103e-37
NZ_CP014762.1\|WP_032430925.1\|2363949_2364138_+\|DUF4222-domain-containing-protein	gnl\|CDD\|372855	pfam13973, DUF4222, Domain of unknown function (DUF4222). This short protein is likely to be of phage origin. For example it is found in the Enterobacteria phage YYZ-2008. It is largely found in enteric bacteria. The molecular function of this protein is unknown.	2.10618e-15
NZ_CP014762.1\|WP_023328640.1\|2365851_2367231_+\|AAA-family-ATPase	gnl\|CDD\|273206	TIGR00665, DnaB, replicative DNA helicase. This model describes the helicase DnaB, a homohexameric protein required for DNA replication. The homohexamer can form a ring around a single strand of DNA near a replication fork. An intein of > 400 residues is found at a conserved location in DnaB of Synechocystis PCC6803, Rhodothermus marinus (both experimentally confirmed), and Mycobacterium tuberculosis. The intein removes itself by a self-splicing reaction. The seed alignment contains inteins so that the model built from the seed alignment will model a low cost at common intein insertion sites. [DNA metabolism, DNA replication, recombination, and repair].	3.25684e-106
NZ_CP014762.1\|WP_023328639.1\|2367217_2367586_+\|RusA-family-crossover-junction-endodeoxyribonuclease	gnl\|CDD\|377564	pfam05866, RusA, Endodeoxyribonuclease RusA. This family consists of several bacterial and phage Holliday junction resolvase (RusA) like proteins. The RusA protein of Escherichia coli is an endonuclease that can resolve Holliday intermediates and correct the defects in genetic recombination and DNA repair associated with inactivation of RuvAB or RuvC.	2.01957e-10
NZ_CP014762.1\|WP_071953780.1\|2363646_2363874_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|374243	pfam15943, YdaS_antitoxin, Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT. YdaS_antitoxin is a family of putative bacterial antitoxins, neutralising the toxin YdaT, family pfam06254.	1.16312e-19

>NZ_CP014762.1|WP_032430925.1|2363949_2364138_+|DUF4222-domain-containing-protein
MFPEAGSIKALDRLYHDPRGVVVHVTGWDREKQQVYFTRPDYPHECMQPVWKFQQYFTRVLV
>NZ_CP014762.1|WP_071953780.1|2363646_2363874_+|helix-turn-helix-domain-containing-protein
MITEPIDKAIRCTGSQGALAKQCGVSQATVWKWRHGKRVKAEHVLKIVAAANGQVAAYEIRPDLPELFPHPTQGE
>NZ_CP014762.1|WP_023328643.1|2362814_2363522_-|helix-turn-helix-transcriptional-regulator
MSKTTFAERLVESMKAAGFTQASLAAAVGMSQSSIWKLTSGAASGSRKTVELAKALHVRPEWLASGELPMNDNESNDLPTVYRQQRPVDPGIYRVDLLDVQVSAGPGVYLSSEFIKTVQAIEFTEEYARSMFGSRPASSIKVITVRGDSMEGTIDPGDYIFVDTSVNHFEGDGIYVFVFGKTIHIKRLQMQKNSLVVLSDNKLYSPWEIDACDEDQFHVLAKVLVKQSAAFKRFA
>NZ_CP014762.1|WP_019705434.1|2362347_2362656_-|hypothetical-protein
MATKNFIQLVDIPDYRFDKRATDIDYDGIACDCDSKTISILNAISHISLNVFSLVEESLVDKEKIADLSCIIADLAELAIATNKISQSASYLSGLKGDNNGA
>NZ_CP014762.1|WP_019705435.1|2362163_2362358_-|hypothetical-protein
MAHEISLEQAAEKAHQAEIICRMMEVYPNKMDCTEIEALSSLLRVLTGDVCAWLIEEQAVKNNK
>NZ_CP014762.1|WP_019705436.1|2361768_2361993_-|hypothetical-protein
MSIQRRQDIQCVTIKAEQLNFLMQTIFTHHKDFDCHQLDGVLGLAYDLAGEVYSWMEKEEKIVQQNEEHKRRGN
>NZ_CP014762.1|WP_023304721.1|2361402_2361768_-|hypothetical-protein
MSNLITTYRRRILKAALLRHQRKTGSSLLVIKLNKGGISTIELTEILLDGLLRKFERLALGEYGNVEGVKALKGIYSNSVDVNGSGEFLTESGKELIDELISELVEFVKKQKPVTAESGNE
>NZ_CP014762.1|WP_023328645.1|2361155_2361410_-|hypothetical-protein
MNNQQTMLYQGVLIPRPVLNVDLHVLPDFTGRVVVHIENGRVICDRQLFDDEHICSLTTFIEMAREMELRFEEVAGGTDSDTNS
>NZ_CP014762.1|WP_023328647.1|2360543_2360969_-|hypothetical-protein
MIDNRTVSAIDQALQKHPTPVGDLFAAIRHGRMKRCFSRDTAIRYLAFFMTSRAFGRSGFKQRYPDVPVIHPLNPELNSWQRGAVTTEYFNAHQRTVRRLRRILARKREMQKWCEKWDAMHDRYVKEREELQACKPGGLSR
>NZ_CP014762.1|WP_023328648.1|2360358_2360547_-|hypothetical-protein
MIAYLRIVLALVIAASVYGLFVPILISMKDTVAVASGVALAFLTPPCIYAIFKGLVIPKEKK
>NZ_CP014762.1|WP_023328641.1|2364976_2365855_+|ATP-binding-protein
MLNLNQLKEREDLRAQQAKLGDELAFAEEHKLPWGFEGCNSNHTSMASCPEHGDYEQFTLVGKDFRGAETFKHSRCPSCIRAEQTSVKSSLRKLHVTSLLNDAGITRRFGDCEFENYLELNPEASRNLAACRRYADNWPAVLEAGKSLVLTGSCGTGKNHLAVSLAKSIIRNHLASVELTDVMRLTRAVKSTWRHNAETTEESVLDHYSSLDLLVIDEVGVQFGSPAEMTILHEVINARYESVLPTILISNLPPEQLKEFISDRIFDRVTDGGRNYLVFNWASFRGNNGGHA
>NZ_CP014762.1|WP_023328640.1|2365851_2367231_+|AAA-family-ATPase
MTPVWRNDELEEAVIGALFLRGDDPEVLDVLSRLPASTFSVRQYREIYTGICRQARGGGVIDPLLLCESLPALQTTILAATRVSWAKSALLSYVDVLRRNAGVRDAEAALEKVLEQIRSARNGESALAALEAAKLTVSAIDISADTVQPVHISELLTAVADEVESRSQGKEETRCLLTGIEELDAMTGGIESTDLVFIAARPSMGKTELALDIIDKVSAQGHGVLFFSMEMSDTQITKRMVSAAGGMSMSRLKAVDKFEDEDWARFFNGMERMATRNIWITDATGLTIDQIQQTATRYQIAHPEIALVVIDYLALIKIQSTARYDLAVGEVSKGLKNLAKSNKTPVLALSQLSRGVESRPNKRPMNSDMKNSGEIEADADLILMLYRDEVYNPESPAKGIAEINVTKQRNGELGTIYRRFYNGHFLPIDQEEARQRSTPQPKAHQRRYTKGSRAGHEDF
>NZ_CP014762.1|WP_023328639.1|2367217_2367586_+|RusA-family-crossover-junction-endodeoxyribonuclease
MKIFNITPMGKPRMTRADKWKQREVVMRYRPFCDEVRLKNVAMPEQGGHIAFVVPMPKSWSQKKRVTMNGQAHQQKPDADNMIKALMDALFTDDAHIWDFRVTKRWGESGQILISDIGEVAA
>NZ_CP014762.1|WP_023328637.1|2367667_2368144_+|hypothetical-protein
MRSNNNEHNKYFSVDAGISSETITKAERLVMERYSNMYSNWKEKEKNYRQEVEDLRQKEIAGFKNILPAPFTLSDVTIEWDYWESVLRHRYKTQNGDGYVQINWDRRGWLTDLLCVMKPVTRAEALTVCKWLLACDYFEERDSLFDRIILNLVGECEE
>NZ_CP014762.1|WP_023328636.1|2368140_2368923_+|antitermination-protein
MKLEASLKHFSPQGMHISDDVKSTSPNRLTGTDVMAAIGTTSSRARFGLAAFLGKAGISKTDEQLAIQALAQFAIKNAPKNVRKAAGDKLGACMLTLAQFAFAEYSRSAATSATCHSCSGTGFISRHEDVIKHPGVFDADGVEVKAPKIRNELVKRVCGVCGGKKVIHARCRCGGKGEVLDRKATKELGAPVFKTCERCSGNGFSVVPSATVHRAILKRLPDLHQSSWSRNWKPFYEGLVDALCQGERQAAVEFEKATTY
>NZ_CP014762.1|WP_032430945.1|2369076_2369334_+|hypothetical-protein
MQQPYFFNPGMTTQQLEDWLGQQKIYLAHFNRLIAEKAALEERLSQISAEIGRVATDSFEGMLSFPWDPSPLVESPQQDSGQSAD
>NZ_CP014762.1|WP_031280381.1|2369239_2369686_-|hypothetical-protein
MSKYSDLLQVIKSRVCQNNNFPQTLLADSHSYRARQVWYRIGQIFTLECILDEYRKHFSSDYYYLDNDKALHHLIFEMTKWKPEEIRRLSLNDCLFIIASQLKPSYMSEDAAAVLASLNLPTGHYPVEDFPQEDWDPRENSAFLQSYQ
>NZ_CP014762.1|WP_017145563.1|2370249_2370645_+|phage-holin-family-protein
MSDPVSGTTVAAGGLMGASMFGLATGIDYGVVFGAFAGAVFYVATAVNISRLKLVGYFITSFIFGVIGAPLLGSYFSKWTGYSDRPLDALGAVIVAAIAIKLLTFVNSQDLGSLFGILSRLRGGGTSNGNK
>NZ_CP014762.1|WP_019705280.1|2370631_2370913_+|phage-holin-family-protein
MVTSDPSAIVNAVICAVIVGALMFYRRDGSRHRPMISLMAYFTVLVYASIPFRFLFGLYESSHWLVVLANILICGAVLWFRGNIARLVDALRH
>NZ_CP014762.1|WP_023304728.1|2370912_2371542_+|glycoside-hydrolase-family-19-protein
MNQSQFQKAAGISAGLAVRWFPHIAAAMKEFGITAPLDQAMFIAQMGHESGGFTRLVENLNYAADSLVPTFGKHRITAQQAAALGRTATQPANQRAIANLVYGGEWGKKNLGNQVAGDGWKYRGRGLKQVTGLSNYRSCGLALKLELVTQPELLERDDYAARSAAWFYVSHGCLLHSGDVERVTLLINGGRNGLDKRRALFNLAKSVLV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP014762_1	1.1\|2364429\|37\|NZ_CP014762\|CRISPRCasFinder	2364429-2364465	37	MH178096	Aeromonas phage AsXd-1, complete genome	10850-10886	5	0.865

1. spacer 1.1|2364429|37|NZ_CP014762|CRISPRCasFinder matches to MH178096 (Aeromonas phage AsXd-1, complete genome) position: , mismatch: 5, identity: 0.865

aatcgttcactacctggtgcaacagattcactacctg	CRISPR spacer
aatcgttcactacctggtgcagcagattcaccccgta	Protospacer
*********************.*********. * *.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

79814 : 156710

Enterobacteria_phage(42.11%)

portal,capsid,integrase,plate,tail,tRNA,head,protease,terminase

attL 83997:84038|attR 119232:119273

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002882894.1\|79814_80435_+	superoxide dismutase [Mn]	Q56AR7	Bacillus_thuringiensis_phage	3.5e-62	57.9
WP_004187877.1\|80507_81182_+	6-N-hydroxylaminopurine resistance protein	NA	NA	NA	NA
WP_002882898.1\|81249_82623_-	envelope stress sensor histidine kinase CpxA	W8CYF6	Bacillus_phage	1.4e-10	24.0
WP_002882901.1\|82619_83318_-	envelope stress response regulator transcription factor CpxR	Q6XM27	Feldmannia_irregularis_virus	4.0e-06	30.3
WP_004178004.1\|83467_83971_+	cell-envelope stress modulator CpxP	NA	NA	NA	NA
83997:84038	attL	NA	NA	NA	NA
WP_064798288.1\|84156_85137_-\|integrase	tyrosine-type recombinase/integrase	U5N0A8	Enterobacteria_phage	5.2e-153	82.7
WP_042944001.1\|85206_85500_-	helix-turn-helix transcriptional regulator	Q1JS21	Enterobacteria_phage	5.9e-36	76.3
WP_048272240.1\|85654_85927_+	hypothetical protein	Q1JS20	Enterobacteria_phage	6.3e-40	85.6
WP_049074458.1\|85953_86172_+	DUF4761 family protein	A0A0M5M1I3	Salmonella_phage	9.6e-07	49.1
WP_048756373.1\|86184_86424_+	DUF4754 family protein	NA	NA	NA	NA
WP_032415217.1\|86426_86699_+	hypothetical protein	NA	NA	NA	NA
WP_064798289.1\|86767_86992_+	hypothetical protein	NA	NA	NA	NA
WP_032414429.1\|86988_87567_+	3'-5' exoribonuclease	A0A192Y6E0	Salmonella_phage	9.3e-33	40.0
WP_064798290.1\|87575_88544_+	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A0M4QWR0	Salmonella_phage	6.0e-77	50.8
WP_023279599.1\|88530_88704_+	hypothetical protein	NA	NA	NA	NA
WP_153649041.1\|88714_88867_+	hypothetical protein	NA	NA	NA	NA
WP_023279597.1\|88889_89051_+	hypothetical protein	NA	NA	NA	NA
WP_064798291.1\|89027_89405_-	hypothetical protein	NA	NA	NA	NA
WP_064798292.1\|89403_91998_+	replication endonuclease	A0A0M4RTM8	Salmonella_phage	9.8e-199	53.0
WP_040172224.1\|92043_92844_+	trypsin-like peptidase domain-containing protein	A0A2H4JE36	uncultured_Caudovirales_phage	6.4e-32	36.0
WP_040172221.1\|93324_93825_+	hypothetical protein	NA	NA	NA	NA
WP_040172218.1\|93851_94904_-\|portal	phage portal protein	A0A0A7NPT9	Enterobacteria_phage	6.9e-143	69.1
WP_040172216.1\|94903_96625_-	helix-turn-helix domain-containing protein	A0A0A7NV54	Enterobacteria_phage	6.2e-226	66.0
WP_040172213.1\|96785_97619_+\|capsid	GPO family capsid scaffolding protein	A0A0A7NRY7	Enterobacteria_phage	3.2e-95	65.6
WP_040172210.1\|97643_98693_+\|capsid	phage major capsid protein, P2 family	A0A0M3ULA3	Salmonella_phage	1.5e-105	55.0
WP_040172207.1\|98740_99640_+\|terminase	terminase	B9A7B6	Serratia_phage	3.5e-87	77.0
WP_040172204.1\|99742_100240_+\|head	head completion/stabilization protein	B9A7B7	Serratia_phage	5.3e-61	71.5
WP_040172202.1\|100239_100440_+\|tail	tail protein X	A0A0A7NV57	Enterobacteria_phage	1.5e-14	64.6
WP_040172200.1\|100430_100712_+	hypothetical protein	B9A7B8	Serratia_phage	6.3e-19	58.4
WP_040172197.1\|100708_101260_+	lysozyme	Q1I0Z1	Pasteurella_virus	3.9e-28	40.2
WP_077268198.1\|101500_101800_+	peptidase	NA	NA	NA	NA
WP_040172192.1\|101796_102255_+\|tail	phage tail protein	A0A0A7NPU6	Enterobacteria_phage	3.7e-32	47.7
WP_040172190.1\|102251_102893_+	phage virion morphogenesis protein	A0A0A7NV60	Enterobacteria_phage	1.3e-43	47.3
WP_040172189.1\|102892_103477_+\|plate	phage baseplate assembly protein V	A0A0A7NRZ3	Enterobacteria_phage	3.9e-63	61.4
WP_032427152.1\|103473_103839_+	GPW/gp25 family protein	A0A0A7NQ90	Enterobacteria_phage	7.9e-30	58.3
WP_040172186.1\|103825_104725_+\|plate	baseplate J/gp47 family protein	A0A0A7NPY5	Enterobacteria_phage	4.9e-89	59.5
WP_040172183.1\|104717_105314_+\|tail	phage tail protein I	E5G6N9	Salmonella_phage	2.5e-41	48.8
WP_148721850.1\|105317_107120_+	hypothetical protein	S6C390	Klebsiella_phage	3.0e-53	29.6
WP_142908617.1\|107127_108807_+	hypothetical protein	A0A2H4YGX0	Raoultella_phage	9.5e-86	35.5
WP_032427147.1\|108813_109062_+	hypothetical protein	NA	NA	NA	NA
WP_040172173.1\|109110_110403_+\|tail	phage tail protein	Q858V4	Yersinia_virus	3.7e-45	47.1
WP_040172170.1\|110501_110990_-\|tail	phage tail protein	A0A0A7NV65	Enterobacteria_phage	3.1e-53	61.7
WP_064798294.1\|111002_113957_-\|tail	phage tail tape measure protein	A0A0A7NRZ9	Enterobacteria_phage	8.5e-215	45.8
WP_148721852.1\|113946_114120_-\|tail	GpE family phage tail protein	A0A0F7LCR6	Escherichia_phage	3.0e-11	68.8
WP_040172163.1\|114116_114416_-	hypothetical protein	B9A7B2	Serratia_phage	5.9e-31	76.0
WP_032424801.1\|114470_114986_-\|tail	phage major tail tube protein	A0A0A7NPV8	Enterobacteria_phage	1.5e-63	70.6
WP_040172159.1\|114985_116167_-\|tail	phage tail sheath subtilisin-like domain-containing protein	A0A0A7NV69	Enterobacteria_phage	1.6e-156	69.3
WP_064798295.1\|116320_117475_+	phage late control D family protein	B9A7A9	Serratia_phage	7.2e-178	80.9
WP_019724745.1\|117519_117768_+	ogr/Delta-like zinc finger family protein	NA	NA	NA	NA
WP_064798486.1\|117878_118211_+	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_064798296.1\|118215_119112_+	type VI secretion protein	NA	NA	NA	NA
WP_002882907.1\|119364_120267_+	CDF family cation-efflux transporter FieF	NA	NA	NA	NA
119232:119273	attR	NA	NA	NA	NA
WP_002882911.1\|120463_121426_+	6-phosphofructokinase	NA	NA	NA	NA
WP_002882913.1\|121487_121973_-	ribonuclease E activity regulator RraA	NA	NA	NA	NA
WP_002882914.1\|122065_122986_-	1,4-dihydroxy-2-naphthoate polyprenyltransferase	NA	NA	NA	NA
WP_002882917.1\|123055_124390_-	HslU--HslV peptidase ATPase subunit	W6AS21	Erwinia_phage	2.1e-43	29.5
WP_002882918.1\|124399_124930_-\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_002882919.1\|125021_125990_-	cell division protein FtsN	NA	NA	NA	NA
WP_002882921.1\|126083_127112_-	DNA-binding transcriptional regulator CytR	NA	NA	NA	NA
WP_004177997.1\|127262_129458_-	primosomal protein N'	NA	NA	NA	NA
WP_002882922.1\|129710_129923_+	50S ribosomal protein L31	NA	NA	NA	NA
WP_002882924.1\|130024_130342_-	met regulon transcriptional regulator MetJ	NA	NA	NA	NA
WP_004150388.1\|130609_131770_+	cystathionine gamma-synthase	NA	NA	NA	NA
WP_002882944.1\|131772_134205_+	bifunctional aspartate kinase/homoserine dehydrogenase II	NA	NA	NA	NA
WP_064798297.1\|134179_135316_-	cytoplasmic protein	NA	NA	NA	NA
WP_004187859.1\|135454_137011_+	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_002882947.1\|137048_137420_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_004187855.1\|137511_138420_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_002882952.1\|138648_139536_+	methylenetetrahydrofolate reductase	NA	NA	NA	NA
WP_004177983.1\|139679_140561_+	DMT family transporter	NA	NA	NA	NA
WP_004146274.1\|140624_141728_-	glycerol dehydrogenase	NA	NA	NA	NA
WP_004177977.1\|141782_142445_-	fructose-6-phosphate aldolase	M4SLG0	Cyanophage	4.6e-28	34.0
WP_004187845.1\|142650_143637_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_004177973.1\|143661_144312_+	metal-binding protein ZinT	NA	NA	NA	NA
WP_004181636.1\|144355_147007_-	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
WP_004177969.1\|147265_148417_-	acetylornithine deacetylase	NA	NA	NA	NA
WP_004181637.1\|148530_149535_+	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
WP_004187843.1\|149541_150318_+	acetylglutamate kinase	NA	NA	NA	NA
WP_004187840.1\|150417_151791_+	argininosuccinate lyase	NA	NA	NA	NA
WP_002883015.1\|152049_152967_+	DNA-binding transcriptional regulator OxyR	NA	NA	NA	NA
WP_002883016.1\|152949_154350_-	Si-specific NAD(P)(+) transhydrogenase	NA	NA	NA	NA
WP_004151856.1\|154546_155182_+	HTH-type transcriptional repressor FabR	NA	NA	NA	NA
WP_002883021.1\|155197_155557_+	YijD family membrane protein	NA	NA	NA	NA
WP_002883023.1\|155609_156710_-\|tRNA	tRNA (uridine(54)-C5)-methyltransferase TrmA	NA	NA	NA	NA

DBSCAN-SWA_2

1827900 : 1837363

Dickeya_phage(16.67%)

protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004191152.1\|1827900_1829016_+	macrolide transporter subunit MacA	A0A140XAI1	Dickeya_phage	1.3e-06	52.7
WP_004191149.1\|1829012_1830953_+	macrolide ABC transporter ATP-binding protein/permease MacB	G9BWD6	Planktothrix_phage	2.5e-37	40.5
WP_002896516.1\|1831029_1831251_-	cold shock-like protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	1.3e-16	61.2
WP_002896520.1\|1831576_1831894_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	2.0e-13	45.7
WP_002896522.1\|1831924_1834204_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.6e-165	42.0
WP_001040187.1\|1834323_1834542_-	translation initiation factor IF-1	NA	NA	NA	NA
WP_002898014.1\|1834895_1835597_-\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_004191145.1\|1835641_1837363_-	cysteine/glutathione ABC transporter ATP-binding protein/permease CydC	A0A2R8FG22	Brazilian_cedratvirus	1.2e-14	34.3

DBSCAN-SWA_3

2069596 : 2151138

Escherichia_phage(15.69%)

portal,capsid,holin,transposase,integrase,tail,tRNA,head,protease,terminase

attL 2061548:2061565|attR 2158592:2158609

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2061548:2061565	attL	NA	NA	NA	NA
WP_004190938.1\|2069596_2070088_+\|transposase	transposase	NA	NA	NA	NA
WP_004176560.1\|2070225_2071347_-	cupin domain-containing protein	NA	NA	NA	NA
WP_004147969.1\|2071432_2072899_-	two-component system sensor histidine kinase PhoQ	NA	NA	NA	NA
WP_004150807.1\|2072898_2073570_-	two-component system response regulator PhoP	NA	NA	NA	NA
WP_004179353.1\|2073852_2074659_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_023279125.1\|2074742_2075105_+	cupin domain-containing protein	NA	NA	NA	NA
WP_004190926.1\|2075159_2076530_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.7e-107	45.1
WP_004190923.1\|2076533_2077175_-	high frequency lysogenization protein HflD	NA	NA	NA	NA
WP_004190921.1\|2077229_2078336_-\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_004150802.1\|2078392_2078851_-	NUDIX hydrolase	NA	NA	NA	NA
WP_004150801.1\|2078867_2079518_-	23S rRNA pseudouridine(2457) synthase RluE	NA	NA	NA	NA
WP_004150800.1\|2079758_2081009_+	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	1.1e-19	92.6
WP_000741346.1\|2081121_2082264_-\|integrase	phage integrase Arm DNA-binding domain-containing protein	Q77Z02	Phage_21	9.1e-173	82.2
WP_000089156.1\|2082253_2082490_-	excisionase	NA	NA	NA	NA
WP_040176407.1\|2082790_2083009_-	hypothetical protein	G8C7S3	Escherichia_phage	3.5e-09	53.4
WP_040176408.1\|2083001_2083397_-	hypothetical protein	A0A077K9V6	Edwardsiella_phage	1.0e-06	33.8
WP_004864289.1\|2083393_2083909_-	hypothetical protein	A0A0P0ZBM8	Stx2-converting_phage	2.9e-70	76.4
WP_021314787.1\|2084252_2085329_-	DGQHR domain-containing protein	T1SBJ4	Salmonella_phage	2.8e-147	74.4
WP_032434886.1\|2085456_2086242_-	hypothetical protein	A4JX52	Burkholderia_virus	2.9e-61	50.6
WP_029497329.1\|2086241_2086541_-	hypothetical protein	NA	NA	NA	NA
WP_044067386.1\|2086630_2087548_-	recombination-associated protein RdgC	A0A1W6JP69	Morganella_phage	8.9e-46	36.5
WP_000690183.1\|2088340_2089036_-	helix-turn-helix transcriptional regulator	Q8HAA0	Salmonella_phage	2.7e-87	71.3
WP_001191665.1\|2089133_2089376_+	helix-turn-helix transcriptional regulator	A0A1C9IHV8	Salmonella_phage	1.3e-25	80.3
WP_064798339.1\|2089410_2089872_+	hypothetical protein	K7PJS5	Enterobacterial_phage	8.4e-69	87.5
WP_001208720.1\|2090109_2090289_+	DUF4222 domain-containing protein	S5M7S5	Escherichia_phage	4.6e-15	73.1
WP_024176409.1\|2090278_2091232_+	helix-turn-helix domain-containing protein	U5P0A0	Shigella_phage	3.7e-103	75.5
WP_064798340.1\|2091228_2092038_+	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1C9II58	Salmonella_phage	1.6e-110	70.0
WP_000779146.1\|2092047_2092425_+	RusA family crossover junction endodeoxyribonuclease	A0A1C9IIA0	Salmonella_phage	2.3e-48	73.6
WP_064164646.1\|2092437_2093418_+	DUF968 domain-containing protein	A0A291AWV9	Escherichia_phage	1.1e-134	67.2
WP_004899672.1\|2093431_2094010_+	DUF1133 family protein	A0A0U2S606	Escherichia_phage	7.6e-51	57.2
WP_009310076.1\|2094738_2095719_+\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	1.2e-184	98.5
WP_040221209.1\|2096289_2096856_+	hypothetical protein	S5FXQ0	Shigella_phage	5.6e-06	27.7
WP_017145563.1\|2097016_2097412_+\|holin	phage holin family protein	K7PHB9	Enterobacterial_phage	2.6e-63	98.5
WP_019705280.1\|2097398_2097680_+\|holin	phage holin family protein	K7PKN9	Enterobacterial_phage	3.9e-37	80.6
WP_023316711.1\|2097679_2098309_+	glycoside hydrolase family 19 protein	G8C7W0	Escherichia_phage	1.5e-105	90.4
WP_064798342.1\|2098316_2098592_+	hypothetical protein	G8C7W1	Escherichia_phage	3.2e-15	51.7
WP_032426434.1\|2098765_2098966_+	hypothetical protein	K7PHC3	Enterobacterial_phage	7.9e-16	65.1
WP_064172986.1\|2099030_2099276_+	DUF2560 family protein	A0A286N2R1	Klebsiella_phage	2.5e-19	64.2
WP_071953818.1\|2099787_2100138_+	HNH endonuclease	A0A1B5FP94	Escherichia_phage	6.0e-51	80.0
WP_023316719.1\|2100293_2100791_+\|terminase	phage terminase small subunit P27 family	K7PHI2	Enterobacteria_phage	1.9e-63	72.0
WP_004206689.1\|2100794_2102546_+\|terminase	terminase large subunit	A0A1P8DTK0	Proteus_phage	5.2e-252	72.2
WP_064798344.1\|2102693_2103920_+\|portal	phage portal protein	Q8SBI0	Shigella_phage	1.2e-207	84.8
WP_000999827.1\|2103912_2104512_+\|head,protease	HK97 family phage prohead protease	Q8SBH9	Shigella_phage	1.0e-90	82.5
WP_064798345.1\|2104521_2105760_+\|capsid	phage major capsid protein	Q8SBH8	Shigella_phage	1.0e-153	67.5
WP_023316722.1\|2105837_2106155_+\|head,tail	phage gp6-like head-tail connector protein	A0A1W6JNZ5	Morganella_phage	4.8e-23	52.0
WP_031592512.1\|2106163_2106502_+\|head	phage head closure protein	A0A2H4JHK5	uncultured_Caudovirales_phage	3.3e-38	67.9
WP_019705270.1\|2106498_2106948_+	HK97 gp10 family phage protein	Q9MCS9	Enterobacteria_phage	6.7e-63	82.6
WP_064798346.1\|2106944_2107292_+	DUF3168 domain-containing protein	K7PKL6	Enterobacterial_phage	3.1e-31	62.8
WP_064798347.1\|2107348_2108053_+	immunoglobulin domain-containing protein	K7PHL2	Enterobacterial_phage	9.5e-80	66.1
WP_040204832.1\|2108083_2108488_+\|tail	phage tail protein	Q9MCS5	Enterobacteria_phage	5.0e-33	56.2
WP_040204831.1\|2108490_2108796_+	DUF4035 domain-containing protein	Q9MCS5	Enterobacteria_phage	3.3e-29	67.7
WP_064798348.1\|2108869_2109103_+	hypothetical protein	K7PH16	Enterobacteria_phage	1.4e-08	48.6
WP_064798349.1\|2109162_2112549_+\|tail	phage tail tape measure protein	A0A0P0ZCJ4	Stx2-converting_phage	5.2e-301	57.6
WP_004177132.1\|2112569_2113043_+	hypothetical protein	A0A286S298	Klebsiella_phage	1.4e-55	62.1
WP_004864228.1\|2113029_2113506_+	DUF1833 family protein	A0A286S2B1	Klebsiella_phage	4.8e-51	65.8
WP_031592495.1\|2113518_2113899_+	nitrite transporter	A0A286S2A6	Klebsiella_phage	5.3e-61	84.1
WP_064798350.1\|2113895_2116973_+	kinase	A0A286S259	Klebsiella_phage	0.0e+00	62.3
WP_064798351.1\|2119091_2119964_+	hypothetical protein	A0A2H4N7C5	Pectobacterium_phage	2.1e-12	26.5
WP_023284988.1\|2121784_2122156_+	hypothetical protein	K7PGV5	Enterobacterial_phage	8.3e-27	51.9
WP_004892953.1\|2122334_2122487_+	isocitrate dehydrogenase	Q77Z09	Phage_21	3.8e-18	92.0
WP_004190918.1\|2122759_2123473_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_004190914.1\|2123469_2123862_-	hypothetical protein	NA	NA	NA	NA
WP_004150797.1\|2123854_2124178_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_020805510.1\|2124297_2124474_-	hypothetical protein	NA	NA	NA	NA
WP_004140530.1\|2124627_2124855_-	DUF1272 domain-containing protein	NA	NA	NA	NA
WP_004190910.1\|2124967_2126161_-	glutathione-dependent formaldehyde dehydrogenase	NA	NA	NA	NA
WP_004190907.1\|2126228_2126564_-	hypothetical protein	NA	NA	NA	NA
WP_004150795.1\|2126783_2126969_+	general stress protein	NA	NA	NA	NA
WP_004148027.1\|2127059_2127554_+	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_004190904.1\|2127580_2128087_+	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_004179357.1\|2128103_2128991_+	manganese catalase family protein	NA	NA	NA	NA
WP_004140511.1\|2129046_2130453_+	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_004183659.1\|2130449_2131460_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_004140506.1\|2131575_2131773_-	hypothetical protein	NA	NA	NA	NA
WP_004190902.1\|2132339_2132972_+	DNA-binding protein	NA	NA	NA	NA
WP_015958198.1\|2133011_2133182_+	hypothetical protein	NA	NA	NA	NA
WP_004150790.1\|2133580_2134267_+	EAL domain-containing protein	NA	NA	NA	NA
WP_004140498.1\|2134379_2134544_-	hypothetical protein	NA	NA	NA	NA
WP_004140497.1\|2134577_2136086_-	UbiD family decarboxylase	NA	NA	NA	NA
WP_004150788.1\|2136206_2137097_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004190899.1\|2137103_2138888_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	5.8e-17	36.1
WP_004190896.1\|2138960_2140169_-	HD domain-containing protein	NA	NA	NA	NA
WP_004150784.1\|2140471_2141515_+	type II asparaginase	NA	NA	NA	NA
WP_064798352.1\|2142176_2143091_+	kdo(2)-lipid IV(A) palmitoleoyltransferase	A0A1W6JP29	Morganella_phage	2.5e-72	50.0
WP_004150783.1\|2143180_2143819_+	leucine efflux protein LeuE	NA	NA	NA	NA
WP_004190891.1\|2143949_2144213_+	DUF2534 family protein	NA	NA	NA	NA
WP_004140488.1\|2144272_2144398_-	hypothetical protein	NA	NA	NA	NA
WP_004213093.1\|2144515_2144590_-	protein YoaJ	NA	NA	NA	NA
WP_004150782.1\|2144589_2144691_-	YoaK family small membrane protein	NA	NA	NA	NA
WP_004176549.1\|2144748_2145762_-	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.9e-12	29.0
WP_004190888.1\|2146062_2146302_+	DUF333 domain-containing protein	NA	NA	NA	NA
WP_072196459.1\|2146291_2146630_-	DUF488 family protein	NA	NA	NA	NA
WP_004190885.1\|2146634_2147144_-	DUF523 domain-containing protein	NA	NA	NA	NA
WP_004140471.1\|2147289_2147982_+	CTP synthase	NA	NA	NA	NA
WP_072200170.1\|2148013_2149189_-	CynX/NimT family MFS transporter	NA	NA	NA	NA
WP_004140469.1\|2149296_2150091_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002901080.1\|2150074_2150521_-	DUF441 domain-containing protein	NA	NA	NA	NA
WP_002901088.1\|2150637_2151138_-\|tRNA	YbaK/prolyl-tRNA synthetase associated domain-containing protein	NA	NA	NA	NA
2158592:2158609	attR	NA	NA	NA	NA

DBSCAN-SWA_4

2242636 : 2310334

Salmonella_phage(20.0%)

holin,integrase,tail,protease,terminase

attL 2253714:2253730|attR 2277102:2277118

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002901758.1\|2242636_2243683_+\|protease	protease SohB	NA	NA	NA	NA
WP_002901761.1\|2243730_2243982_-	YciN family protein	NA	NA	NA	NA
WP_002901763.1\|2244388_2246986_+	type I DNA topoisomerase	A0A2K9L5F8	Tupanvirus	2.9e-89	35.6
WP_002901772.1\|2247331_2248306_+	HTH-type transcriptional regulator CysB	NA	NA	NA	NA
WP_002901776.1\|2248551_2248719_+	YmiA family putative membrane protein	NA	NA	NA	NA
WP_004176472.1\|2249107_2251780_+	aconitate hydratase AcnA	NA	NA	NA	NA
WP_002901778.1\|2251826_2252429_-	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.2e-43	49.5
WP_002901779.1\|2252592_2253360_+	phosphatidylglycerophosphatase B	NA	NA	NA	NA
WP_002901780.1\|2253495_2253804_+	LapA family protein	NA	NA	NA	NA
2253714:2253730	attL	NA	NA	NA	NA
WP_002901781.1\|2253810_2254980_+	lipopolysaccharide assembly protein LapB	NA	NA	NA	NA
WP_004151907.1\|2255171_2255909_+	orotidine-5'-phosphate decarboxylase	NA	NA	NA	NA
WP_004190739.1\|2255908_2256235_+	stress response translation initiation inhibitor YciH	NA	NA	NA	NA
WP_002901783.1\|2256366_2256585_-	osmotically-inducible lipoprotein OsmB	NA	NA	NA	NA
WP_002901785.1\|2256860_2257610_-	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_002901786.1\|2257681_2257861_-	hypothetical protein	NA	NA	NA	NA
WP_002901787.1\|2258019_2259954_-	exoribonuclease II	A0A2H4UVB7	Bodo_saltans_virus	7.0e-08	24.6
WP_020802459.1\|2260035_2261193_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_004140277.1\|2261383_2262172_-	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_023279113.1\|2262370_2262913_-	HutD family protein	NA	NA	NA	NA
WP_031593531.1\|2263160_2264540_+	cytosine permease	NA	NA	NA	NA
WP_004140269.1\|2264584_2265394_-	peptide ABC transporter ATP-binding protein SapF	A0A2H4PQG7	Staphylococcus_phage	2.1e-14	28.9
WP_004140266.1\|2265395_2266388_-	peptide ABC transporter ATP-binding protein SapD	G9BWD6	Planktothrix_phage	3.0e-07	27.2
WP_004151901.1\|2266387_2267278_-	peptide ABC transporter permease SapC	NA	NA	NA	NA
WP_064798354.1\|2267424_2268642_+\|integrase	site-specific integrase	K7PGY1	Enterobacteria_phage	3.3e-120	51.6
WP_004892750.1\|2268862_2269102_-	DUF4060 family protein	M9P0E0	Enterobacteria_phage	8.0e-23	70.1
WP_012542038.1\|2269109_2269418_-	hypothetical protein	I6PD68	Cronobacter_phage	4.2e-24	56.9
WP_064798355.1\|2269414_2270080_-	hypothetical protein	M1F3E2	Salmonella_phage	1.5e-66	62.2
WP_064798356.1\|2270114_2271224_-	recombinase RecT	H6WRX0	Salmonella_phage	3.1e-186	88.1
WP_064798357.1\|2271236_2274287_-	PD-(D/E)XK nuclease-like domain-containing protein	H6WRX1	Salmonella_phage	5.2e-292	56.9
WP_016946289.1\|2274424_2274580_-	DNA breaking-rejoining protein	H6WRX3	Salmonella_phage	2.6e-14	74.5
WP_004179600.1\|2274588_2274780_-	YebW family protein	NA	NA	NA	NA
WP_050485525.1\|2275168_2275603_-	helix-turn-helix domain-containing protein	H6WRX4	Salmonella_phage	2.3e-15	39.0
WP_023320775.1\|2275707_2275935_+	helix-turn-helix domain-containing protein	H6WRX5	Salmonella_phage	3.4e-15	50.0
WP_023301222.1\|2275937_2276474_+	toxin YdaT domain-containing protein	M9NZI6	Enterobacteria_phage	2.4e-59	68.3
WP_064798358.1\|2276485_2276749_+	hypothetical protein	NA	NA	NA	NA
WP_064798359.1\|2276826_2277747_+	replication protein	K7PGZ0	Enterobacteria_phage	1.7e-92	61.3
2277102:2277118	attR	NA	NA	NA	NA
WP_064798360.1\|2277743_2278487_+	Replication protein P	A0A0K2FIT1	Enterobacteria_phage	1.4e-70	58.1
WP_064798361.1\|2278479_2278848_+	DUF977 family protein	H6WRX9	Salmonella_phage	4.9e-11	43.0
WP_004216517.1\|2279039_2279294_+	hypothetical protein	S5MQM0	Escherichia_phage	5.3e-09	50.7
WP_004216515.1\|2279596_2280511_+	hypothetical protein	NA	NA	NA	NA
WP_004216513.1\|2280507_2281248_+	HIRAN domain-containing protein	NA	NA	NA	NA
WP_124060728.1\|2281542_2281920_+	hypothetical protein	NA	NA	NA	NA
WP_077254392.1\|2282827_2283052_+	hypothetical protein	NA	NA	NA	NA
WP_105166445.1\|2283125_2283725_+	DUF1367 family protein	K7PKS6	Enterobacteria_phage	5.6e-89	78.4
WP_032418472.1\|2283933_2284230_+	DUF1364 domain-containing protein	A0A0U2KD41	Escherichia_phage	4.6e-36	71.9
WP_023282412.1\|2284226_2284583_+	RusA family crossover junction endodeoxyribonuclease	K7P6W0	Enterobacteria_phage	1.5e-41	64.1
WP_023282413.1\|2284698_2285520_+	antitermination protein	K7PKS8	Enterobacteria_phage	4.0e-98	67.1
WP_001294159.1\|2286213_2286600_+\|holin	phage holin family protein	A0A192Y8P2	Salmonella_phage	1.6e-57	90.6
WP_071603196.1\|2286586_2286868_+\|holin	phage holin family protein	K7PKN9	Enterobacterial_phage	2.4e-18	47.3
WP_023282414.1\|2286867_2287497_+	glycoside hydrolase family 19 protein	F1C591	Cronobacter_phage	9.3e-87	74.4
WP_064798364.1\|2287499_2287775_+	hypothetical protein	G8C7W1	Escherichia_phage	4.2e-07	38.2
WP_032418475.1\|2287725_2287920_+	hypothetical protein	A0A286SGR9	Klebsiella_phage	2.2e-26	90.6
WP_023282416.1\|2287916_2288210_+	hypothetical protein	G8C7W3	Escherichia_phage	1.3e-30	71.1
WP_023282417.1\|2288664_2288886_+	hypothetical protein	NA	NA	NA	NA
WP_023282418.1\|2288958_2289153_+	hypothetical protein	A0A1L6Z528	Klebsiella_phage	3.3e-19	73.3
WP_064798365.1\|2289556_2289802_+	DUF2560 family protein	A0A286N2R1	Klebsiella_phage	2.7e-34	95.1
WP_023325165.1\|2290150_2291146_+\|terminase	terminase small subunit	Q5QF76	Pseudomonas_virus	1.1e-38	45.5
WP_016946682.1\|2291129_2292443_+\|terminase	terminase	A0A0S2SYF1	Pseudomonas_phage	2.2e-183	73.6
WP_047694609.1\|2292444_2293845_+	DUF4055 domain-containing protein	A0A1B0VMH0	Pseudomonas_phage	4.1e-127	53.5
WP_040221886.1\|2293828_2294941_+	phage Mu F like family protein	I6PD76	Cronobacter_phage	2.8e-110	55.2
WP_016946679.1\|2295025_2295811_+	hypothetical protein	A0A1B0VMG1	Pseudomonas_phage	1.0e-66	63.9
WP_064798366.1\|2295821_2296775_+	Ig domain-containing protein	A0A1B0VMF8	Pseudomonas_phage	1.9e-131	74.0
WP_158237057.1\|2296783_2297056_+	Ig-like domain-containing protein	NA	NA	NA	NA
WP_023300922.1\|2297096_2297492_+	hypothetical protein	A0A0S2SYB7	Pseudomonas_phage	3.3e-13	43.3
WP_004190649.1\|2297493_2297748_+	hypothetical protein	J9Q7U0	Salmonella_phage	8.0e-21	52.4
WP_004190646.1\|2297757_2297991_+	hypothetical protein	A0A2H4J0Y9	uncultured_Caudovirales_phage	5.8e-10	47.1
WP_064798367.1\|2297977_2298361_+	hypothetical protein	A0A0S2SYG4	Pseudomonas_phage	9.2e-21	45.2
WP_064798368.1\|2298362_2298914_+	hypothetical protein	G8C7Q1	Escherichia_phage	1.5e-27	39.3
WP_004190640.1\|2298910_2299303_+	electron transfer flavoprotein subunit beta	NA	NA	NA	NA
WP_064798369.1\|2299326_2300499_+	Ig domain-containing protein	A0A0D4DBN5	Acinetobacter_phage	2.1e-23	27.0
WP_008807841.1\|2300552_2301035_+	hypothetical protein	NA	NA	NA	NA
WP_016946674.1\|2301172_2301379_+	hypothetical protein	NA	NA	NA	NA
WP_004217333.1\|2301455_2301812_+	hypothetical protein	A0A1V0E5P9	Salmonella_phage	1.1e-44	75.0
WP_050495392.1\|2301922_2302291_+	zinc ribbon domain-containing protein	I6PDJ9	Cronobacter_phage	1.9e-15	42.9
WP_064798370.1\|2302364_2305019_+\|tail	phage tail length tape measure family protein	A0A2D1GPC9	Escherichia_phage	6.7e-86	34.5
WP_031591816.1\|2305102_2305438_+	hypothetical protein	NA	NA	NA	NA
WP_031591815.1\|2305751_2306216_+	hypothetical protein	A0A286S298	Klebsiella_phage	6.7e-58	67.8
WP_064185972.1\|2306396_2306879_+	DUF1833 family protein	A0A286S2B1	Klebsiella_phage	2.2e-80	94.4
WP_064798371.1\|2306888_2307269_+	hypothetical protein	A0A286S2A6	Klebsiella_phage	4.0e-69	94.4
WP_064798372.1\|2307265_2310334_+	hypothetical protein	A0A286S259	Klebsiella_phage	0.0e+00	98.0

DBSCAN-SWA_5

2352625 : 2430236

Klebsiella_phage(57.89%)

portal,capsid,holin,integrase,plate,transposase,tail,head,protease,terminase

attL 2346767:2346782|attR 2379358:2379373

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2346767:2346782	attL	NA	NA	NA	NA
WP_004176437.1\|2352625_2353387_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	6.3e-21	32.5
WP_032427976.1\|2353603_2355136_+	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	1.5e-21	30.0
WP_016197745.1\|2355334_2355883_-	DJ-1/PfpI family protein	NA	NA	NA	NA
WP_023328653.1\|2356079_2357261_+\|integrase	site-specific integrase	A0A0M4QX09	Salmonella_phage	3.1e-200	83.5
WP_004198241.1\|2357241_2357433_-	hypothetical protein	A0A0M4RTZ2	Salmonella_phage	3.9e-20	73.8
WP_023328651.1\|2357568_2357970_-	hypothetical protein	NA	NA	NA	NA
WP_023328650.1\|2357966_2358191_-	hypothetical protein	A0A286S2B3	Klebsiella_phage	8.3e-30	91.9
WP_032428838.1\|2358180_2358906_-	Rha family transcriptional regulator	A0A286S260	Klebsiella_phage	3.4e-109	85.0
WP_032430926.1\|2358911_2359430_-	hypothetical protein	A0A286S1S7	Klebsiella_phage	5.5e-93	97.1
WP_023304718.1\|2359534_2360362_-	hypothetical protein	Q8W654	Enterobacteria_phage	9.3e-111	84.0
WP_023328648.1\|2360358_2360547_-	hypothetical protein	NA	NA	NA	NA
WP_023328647.1\|2360543_2360969_-	hypothetical protein	A0A286S1S2	Klebsiella_phage	5.9e-53	77.9
WP_023328645.1\|2361155_2361410_-	hypothetical protein	A0A286SGR4	Klebsiella_phage	3.2e-38	92.9
WP_023304721.1\|2361402_2361768_-	hypothetical protein	A0A286S1Q6	Klebsiella_phage	5.8e-57	97.5
WP_019705436.1\|2361768_2361993_-	hypothetical protein	NA	NA	NA	NA
WP_019705435.1\|2362163_2362358_-	hypothetical protein	A0A286S1P8	Klebsiella_phage	4.5e-08	50.0
WP_019705434.1\|2362347_2362656_-	hypothetical protein	A0A286S1T9	Klebsiella_phage	3.9e-22	56.3
WP_023328643.1\|2362814_2363522_-	helix-turn-helix transcriptional regulator	G8C7U1	Escherichia_phage	1.5e-53	49.8
WP_071953780.1\|2363646_2363874_+	helix-turn-helix domain-containing protein	A0A0N7C1T6	Escherichia_phage	1.5e-15	60.0
WP_032430925.1\|2363949_2364138_+	DUF4222 domain-containing protein	NA	NA	NA	NA
WP_023328642.1\|2364134_2364965_+	helix-turn-helix domain-containing protein	A5LH71	Enterobacteria_phage	1.1e-79	66.2
WP_023328641.1\|2364976_2365855_+	ATP-binding protein	Q8W641	Enterobacteria_phage	1.4e-85	63.9
WP_023328640.1\|2365851_2367231_+	AAA family ATPase	Q8W640	Enterobacteria_phage	8.1e-160	64.7
WP_023328639.1\|2367217_2367586_+	RusA family crossover junction endodeoxyribonuclease	G8C7V6	Escherichia_phage	5.2e-37	58.6
WP_023328637.1\|2367667_2368144_+	hypothetical protein	A0A286N2Q1	Klebsiella_phage	1.1e-68	77.8
WP_023328636.1\|2368140_2368923_+	antitermination protein	F1C595	Cronobacter_phage	7.7e-115	79.5
WP_032430945.1\|2369076_2369334_+	hypothetical protein	A0A286N2Q3	Klebsiella_phage	5.4e-41	97.6
WP_031280381.1\|2369239_2369686_-	hypothetical protein	NA	NA	NA	NA
WP_017145563.1\|2370249_2370645_+\|holin	phage holin family protein	K7PHB9	Enterobacterial_phage	2.6e-63	98.5
WP_019705280.1\|2370631_2370913_+\|holin	phage holin family protein	K7PKN9	Enterobacterial_phage	3.9e-37	80.6
WP_023304728.1\|2370912_2371542_+	glycoside hydrolase family 19 protein	G8C7W0	Escherichia_phage	6.9e-106	90.9
WP_031591484.1\|2371549_2371825_+	hypothetical protein	G8C7W1	Escherichia_phage	4.7e-11	44.4
WP_031591489.1\|2372060_2372345_-	hypothetical protein	NA	NA	NA	NA
WP_023304730.1\|2372477_2372750_+	hypothetical protein	NA	NA	NA	NA
WP_032408647.1\|2373074_2373311_+	DUF2560 family protein	A0A286N2R1	Klebsiella_phage	1.6e-31	94.9
WP_023301206.1\|2373391_2373598_+	DUF551 domain-containing protein	A0A286N2R2	Klebsiella_phage	5.1e-34	97.1
WP_017880218.1\|2373669_2373960_+	HNH endonuclease	A0A286N2R3	Klebsiella_phage	1.4e-53	99.0
WP_017880219.1\|2373972_2374182_+	hypothetical protein	A0A286N2R4	Klebsiella_phage	7.0e-31	100.0
WP_004143905.1\|2374304_2374739_+	hypothetical protein	A0A286S1P9	Klebsiella_phage	6.2e-74	100.0
WP_064798377.1\|2374748_2376281_+\|terminase	terminase	A0A286S1M9	Klebsiella_phage	1.1e-295	99.6
WP_064798378.1\|2376283_2377561_+\|portal	phage portal protein	A0A286S1N5	Klebsiella_phage	1.8e-246	99.5
WP_004216821.1\|2377566_2378247_+\|head,protease	HK97 family phage prohead protease	A0A286S1N1	Klebsiella_phage	1.6e-124	100.0
WP_064798379.1\|2378258_2379422_+\|capsid	phage major capsid protein	A0A286S1R4	Klebsiella_phage	2.9e-211	99.2
2379358:2379373	attR	NA	NA	NA	NA
WP_044067369.1\|2379458_2379701_+	hypothetical protein	NA	NA	NA	NA
WP_040229903.1\|2379648_2379975_+\|head,tail	phage gp6-like head-tail connector protein	A0A286S294	Klebsiella_phage	1.7e-55	99.1
WP_040229906.1\|2380035_2380248_+	hypothetical protein	A0A286S2A5	Klebsiella_phage	3.2e-15	74.3
WP_040213580.1\|2380249_2380582_+\|head	phage head closure protein	A0A286S2A2	Klebsiella_phage	2.0e-56	98.2
WP_031591507.1\|2380574_2381114_+	HK97 gp10 family phage protein	A0A286S249	Klebsiella_phage	2.8e-92	95.5
WP_000561415.1\|2381110_2381476_+	DUF3168 domain-containing protein	A0A286S1R1	Klebsiella_phage	3.9e-61	92.6
WP_040221233.1\|2381532_2382024_+\|tail	phage major tail protein	A0A286S1Q8	Klebsiella_phage	5.0e-88	99.4
WP_023339171.1\|2382067_2382421_+\|tail	phage tail assembly chaperone family protein, TAC	A0A286S1N4	Klebsiella_phage	2.4e-60	98.3
WP_040229635.1\|2382453_2382717_+	hypothetical protein	A0A286S1P2	Klebsiella_phage	3.4e-43	97.7
WP_042346245.1\|2382780_2383173_+	hypothetical protein	A0A286S1N7	Klebsiella_phage	3.6e-20	42.2
WP_040229637.1\|2383242_2385678_+\|tail	phage tail length tape measure protein	A0A286S1S3	Klebsiella_phage	0.0e+00	89.3
WP_004899614.1\|2385677_2386157_+	hypothetical protein	A0A286S298	Klebsiella_phage	1.7e-93	98.7
WP_023328628.1\|2386143_2386626_+	DUF1833 family protein	A0A286S2B1	Klebsiella_phage	6.3e-83	96.2
WP_017880229.1\|2386635_2387016_+	hypothetical protein	A0A286S2A6	Klebsiella_phage	4.6e-73	100.0
WP_023328626.1\|2387012_2390081_+	hypothetical protein	A0A286S259	Klebsiella_phage	0.0e+00	97.5
WP_023328624.1\|2392200_2393073_+	hypothetical protein	A0A2H4N7C5	Pectobacterium_phage	2.8e-12	26.4
WP_023328623.1\|2393175_2393415_+	hypothetical protein	K7P7N3	Enterobacteria_phage	9.5e-16	53.2
WP_023328622.1\|2393414_2393732_+	hypothetical protein	K7PGV5	Enterobacterial_phage	6.9e-22	51.0
WP_019705237.1\|2395095_2395344_-	DinI-like family protein	S5MQI1	Escherichia_phage	1.0e-25	70.4
WP_004176434.1\|2396189_2396681_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_032427977.1\|2396723_2398268_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_015958243.1\|2398277_2399621_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_004190548.1\|2399617_2400307_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_023328620.1\|2400303_2402010_+	OmpA family protein	NA	NA	NA	NA
WP_002902160.1\|2402014_2402506_+	type VI secretion system effector Hcp	NA	NA	NA	NA
WP_064798380.1\|2402770_2405425_+	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	1.3e-97	33.6
WP_064798381.1\|2407930_2409145_+	hypothetical protein	NA	NA	NA	NA
WP_050484415.1\|2409145_2409532_+	hypothetical protein	NA	NA	NA	NA
WP_063666504.1\|2409596_2411948_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	6.9e-18	32.2
WP_009310076.1\|2413687_2414668_+\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	1.2e-184	98.5
WP_004190528.1\|2415093_2415354_+	hypothetical protein	NA	NA	NA	NA
WP_004190525.1\|2415340_2416108_+	hypothetical protein	NA	NA	NA	NA
WP_004179560.1\|2416287_2416809_+	hypothetical protein	NA	NA	NA	NA
WP_023279043.1\|2417001_2418099_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	7.4e-47	41.0
WP_153831088.1\|2418273_2418798_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_023279041.1\|2419544_2420753_+	hypothetical protein	NA	NA	NA	NA
WP_175327209.1\|2420701_2424208_+	type VI secretion protein VasK	NA	NA	NA	NA
WP_004190512.1\|2424204_2425803_+	type VI secretion system protein TssA	NA	NA	NA	NA
WP_004190510.1\|2425833_2426889_+	PAAR domain-containing protein	NA	NA	NA	NA
WP_004190508.1\|2426885_2427356_+	hypothetical protein	NA	NA	NA	NA
WP_004212348.1\|2427432_2429187_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_023279038.1\|2429150_2430236_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA

DBSCAN-SWA_6

2635273 : 2646160

Escherichia_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023300966.1\|2635273_2635894_-	aldolase	A0A077SK32	Escherichia_phage	4.0e-114	99.5
WP_004183946.1\|2635886_2637152_-	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	6.6e-233	99.3
WP_002903955.1\|2637163_2638066_-	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	2.6e-159	99.7
WP_002210513.1\|2638326_2639088_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.9e-134	100.0
WP_004176269.1\|2639108_2639969_-	class A broad-spectrum beta-lactamase SHV-11	A0A077SL40	Escherichia_phage	2.2e-155	99.3
WP_004176262.1\|2640266_2640527_+	hypothetical protein	A0A077SK33	Escherichia_phage	5.4e-41	98.8
WP_001620097.1\|2640613_2641702_+	AAA family ATPase	A0A077SLJ9	Escherichia_phage	8.0e-211	100.0
WP_004176258.1\|2641732_2642998_-	MFS transporter	NA	NA	NA	NA
WP_021440086.1\|2643052_2646160_-	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	59.6

DBSCAN-SWA_7

3645822 : 3652729

Bacillus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004149058.1\|3645822_3647301_+	two-component system sensor histidine kinase BaeS	W8CYF6	Bacillus_phage	8.5e-30	28.3
WP_004175198.1\|3647297_3648020_+	two-component system response regulator BaeR	W8CYM9	Bacillus_phage	8.3e-31	33.2
WP_004144192.1\|3648338_3649700_+\|tRNA	tRNA 5-hydroxyuridine modification protein YegQ	Q6DW11	Phage_TP	1.8e-207	94.8
WP_004151134.1\|3649942_3650839_+	lipid kinase YegS	A0A1V0SBJ0	Catovirus	6.1e-15	29.8
WP_004899467.1\|3651081_3651855_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.9e-26	36.7
WP_023278799.1\|3651865_3652729_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.7e-10	27.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP014765

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP014763

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP014762

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection