CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid unnamed, complete sequence	0 crisprs	WYL	0	0	4	0
NZ_CP015850	Ralstonia solanacearum strain YC40-M chromosome, complete genome	2 crisprs	cas3,WYL,csa3,DEDDh,DinG	4	2	10	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

356531 : 368623

Ralstonia_phage(42.86%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020829487.1\|356531_359333_-	toprim domain-containing protein	A0A1S5NPU9	Burkholderia_phage	7.0e-251	50.6
WP_016722318.1\|359343_359667_-	DUF1484 domain-containing protein	NA	NA	NA	NA
WP_016722316.1\|360183_360411_-	ogr/Delta-like zinc finger family protein	E5E3T8	Burkholderia_phage	2.8e-09	54.7
WP_020829484.1\|360458_360677_-	hypothetical protein	NA	NA	NA	NA
WP_016722315.1\|360700_361420_-	hypothetical protein	NA	NA	NA	NA
WP_020829482.1\|361437_361704_-	AlpA family transcriptional regulator	Q7M299	Enterobacteria_phage	1.7e-13	51.9
WP_020829481.1\|362327_362594_-	PAAR domain-containing protein	R9U4D0	Rhizobium_phage	3.1e-07	56.5
WP_016722308.1\|362602_362923_-	hypothetical protein	NA	NA	NA	NA
WP_020829479.1\|362919_365151_-	DUF3274 domain-containing protein	A0A077K801	Ralstonia_phage	0.0e+00	84.7
WP_038962083.1\|365147_365963_-	hypothetical protein	A0A077KEQ4	Ralstonia_phage	7.8e-94	68.7
WP_043897980.1\|365965_368623_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	0.0e+00	85.4

DBSCAN-SWA_2

538136 : 608944

Bacillus_phage(25.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016721870.1\|538136_539123_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_086005097.1\|539280_540430_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	5.9e-95	60.7
WP_043898158.1\|540686_542867_+	hypothetical protein	NA	NA	NA	NA
WP_016725055.1\|543005_543737_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.3e-28	35.4
WP_019719841.1\|543743_545060_+	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	3.6e-16	25.0
WP_016725057.1\|545222_546695_+\|protease	DegQ family serine endoprotease	A0A1B1IT49	uncultured_Mediterranean_phage	1.6e-25	29.3
WP_011004797.1\|546884_547247_+	hypothetical protein	NA	NA	NA	NA
WP_016725058.1\|547343_547865_+	DUF2059 domain-containing protein	NA	NA	NA	NA
WP_011004795.1\|548028_548358_+	hypothetical protein	NA	NA	NA	NA
WP_011004794.1\|548515_549028_-	DUF1993 family protein	NA	NA	NA	NA
WP_016725060.1\|549254_549470_-	hypothetical protein	NA	NA	NA	NA
WP_071653919.1\|558121_558598_+	hypothetical protein	NA	NA	NA	NA
WP_038937983.1\|558630_559203_-	DUF4291 domain-containing protein	NA	NA	NA	NA
WP_016721870.1\|559497_560484_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_064820789.1\|560992_563533_+	filamentous hemagglutinin N-terminal domain-containing protein	A0A0R6PJK4	Moraxella_phage	2.0e-15	29.1
WP_064048023.1\|563544_565296_+	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_064048022.1\|565313_566153_+	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_016725440.1\|566392_566779_+	hypothetical protein	NA	NA	NA	NA
WP_016725441.1\|566778_567246_+	DUF2846 domain-containing protein	NA	NA	NA	NA
WP_043885670.1\|567860_570008_+	multicopper oxidase family protein	NA	NA	NA	NA
WP_020830521.1\|570122_571160_-	isopenicillin N synthase family oxygenase	NA	NA	NA	NA
WP_020830520.1\|571533_572031_+	hypothetical protein	NA	NA	NA	NA
WP_020830519.1\|572193_573444_-	HupE/UreJ family protein	NA	NA	NA	NA
WP_019719859.1\|573469_574795_-	DUF3500 domain-containing protein	A0A0H3UCT5	Escherichia_phage	7.4e-09	51.3
WP_043898156.1\|575369_577079_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_043898155.1\|577278_578796_-	GGDEF domain-containing protein	NA	NA	NA	NA
WP_014632055.1\|579141_579330_+	hypothetical protein	NA	NA	NA	NA
WP_011004769.1\|579662_582314_+	bifunctional lysylphosphatidylglycerol flippase/synthetase MprF	NA	NA	NA	NA
WP_020830516.1\|582310_584134_+	virulence factor family protein	NA	NA	NA	NA
WP_020830515.1\|584248_584947_+	hypothetical protein	NA	NA	NA	NA
WP_020830514.1\|584955_586659_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	4.9e-13	28.1
WP_028854659.1\|586766_587303_-	hypothetical protein	NA	NA	NA	NA
WP_020371801.1\|587745_589656_+	metallophosphoesterase	NA	NA	NA	NA
WP_020830511.1\|590789_591434_+	transcriptional regulator	NA	NA	NA	NA
WP_020830510.1\|591430_592402_+	threo-3-hydroxy-L-aspartate ammonia-lyase	NA	NA	NA	NA
WP_011004762.1\|592398_592791_+	RidA family protein	NA	NA	NA	NA
WP_020830509.1\|592867_593752_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011004760.1\|593865_594303_+	multidrug/biocide efflux PACE transporter	NA	NA	NA	NA
WP_020830508.1\|594384_595083_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011004758.1\|595190_595409_-	DUF1059 domain-containing protein	NA	NA	NA	NA
WP_019719870.1\|595594_596998_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	2.3e-21	38.6
WP_011004757.1\|597496_597895_-	DUF488 domain-containing protein	NA	NA	NA	NA
WP_020830507.1\|597928_598969_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011004755.1\|599016_599913_-	ABC transporter permease	NA	NA	NA	NA
WP_011004754.1\|599902_600688_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.0e-34	38.3
WP_016723583.1\|600746_601469_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_011004752.1\|601727_603998_-	nitric-oxide reductase large subunit	NA	NA	NA	NA
WP_011004751.1\|604041_604344_-	DUF2249 domain-containing protein	NA	NA	NA	NA
WP_020830505.1\|604621_606115_+	nitrite reductase, copper-containing	NA	NA	NA	NA
WP_020830504.1\|606134_606926_+	formylglycine-generating enzyme family protein	NA	NA	NA	NA
WP_016723579.1\|606922_607507_+	SCO family protein	NA	NA	NA	NA
WP_016721735.1\|607978_608944_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.6e-178	98.1

DBSCAN-SWA_3

1236876 : 1257155

Vibrio_phage(33.33%)

plate,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019719429.1\|1236876_1238223_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_043898101.1\|1238266_1238941_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_011004040.1\|1239215_1239863_+	hypothetical protein	NA	NA	NA	NA
WP_016724835.1\|1239899_1240412_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_011004042.1\|1240404_1241895_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_011004043.1\|1241983_1242487_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_016724834.1\|1242547_1243021_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_016726997.1\|1243083_1244934_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_020371627.1\|1244897_1245989_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_020830186.1\|1246021_1248739_+	type VI secretion system ATPase TssH	A0A2I7SAX5	Vibrio_phage	4.5e-85	32.0
WP_020830185.1\|1248759_1251516_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	2.1e-37	25.6
WP_043898209.1\|1251533_1252667_+	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_020830182.1\|1254951_1255776_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_020830181.1\|1255847_1257155_-\|transposase	IS4 family transposase	Q9JMP3	Wolbachia_phage	2.3e-55	30.3

DBSCAN-SWA_4

1504363 : 1574635

uncultured_Caudovirales_phage(25.0%)

integrase,transposase

attL 1500512:1500530|attR 1549192:1549210

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1500512:1500530	attL	NA	NA	NA	NA
WP_043898066.1\|1504363_1505335_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011004392.1\|1505409_1505580_+	hypothetical protein	NA	NA	NA	NA
WP_011004393.1\|1506122_1506911_+	trehalose-phosphatase	NA	NA	NA	NA
WP_011004394.1\|1506907_1508305_+	alpha,alpha-trehalose-phosphate synthase (UDP-forming)	NA	NA	NA	NA
WP_011004395.1\|1508369_1508831_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_016726129.1\|1508977_1509403_+	organic hydroperoxide resistance protein	NA	NA	NA	NA
WP_020829911.1\|1509449_1510469_+	alpha/beta hydrolase	M1PGN2	Moumouvirus	5.2e-55	37.6
WP_020829910.1\|1510559_1511333_-	hypothetical protein	NA	NA	NA	NA
WP_019719712.1\|1511437_1512385_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_020829908.1\|1512666_1513731_+	alpha/beta hydrolase	S4W4Z4	Pandoravirus	3.5e-17	33.2
WP_043898065.1\|1514035_1515352_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_011004402.1\|1515388_1518598_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	7.6e-68	22.1
WP_020829906.1\|1518617_1520144_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_011004404.1\|1520320_1521133_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_020829905.1\|1521345_1522443_+	low specificity L-threonine aldolase	NA	NA	NA	NA
WP_011004407.1\|1523371_1523779_-	DUF2000 family protein	NA	NA	NA	NA
WP_011004408.1\|1523856_1524345_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_019719704.1\|1524411_1524909_+	MaoC family dehydratase	NA	NA	NA	NA
WP_043898064.1\|1525332_1526037_-	YafY family transcriptional regulator	A0A1B0RXM1	Streptococcus_phage	6.1e-10	31.8
WP_020829900.1\|1526039_1526972_-	NAD(P)-dependent alcohol dehydrogenase	NA	NA	NA	NA
WP_016726919.1\|1526992_1527361_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_029240567.1\|1527508_1528513_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_016726922.1\|1528750_1529050_+	hypothetical protein	NA	NA	NA	NA
WP_020829897.1\|1529073_1530138_+	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L7I1	Tupanvirus	1.4e-79	42.2
WP_020829896.1\|1530134_1530824_+	type 1 glutamine amidotransferase domain-containing protein	NA	NA	NA	NA
WP_020829895.1\|1530825_1531806_+	amidohydrolase	NA	NA	NA	NA
WP_016726915.1\|1531922_1532300_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_019719696.1\|1532980_1533718_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_016724507.1\|1534529_1535123_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_016724506.1\|1535334_1536423_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_043898062.1\|1536504_1537425_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_011004413.1\|1537448_1538516_-	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L7I1	Tupanvirus	3.2e-87	47.2
WP_020829889.1\|1538864_1539836_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_016724502.1\|1540008_1540674_-	aquaporin family protein	NA	NA	NA	NA
WP_011004417.1\|1540679_1541174_-	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	3.5e-28	48.4
WP_028861809.1\|1541271_1541595_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_020829886.1\|1541917_1543342_+	hypothetical protein	NA	NA	NA	NA
WP_011004420.1\|1543372_1543780_-	hypothetical protein	NA	NA	NA	NA
WP_043898061.1\|1543844_1544423_-	suppressor of fused domain protein	NA	NA	NA	NA
WP_052328826.1\|1544529_1544955_-	hypothetical protein	NA	NA	NA	NA
WP_081263847.1\|1545106_1545481_-	hypothetical protein	NA	NA	NA	NA
WP_081263846.1\|1545801_1546323_-	DUF4303 domain-containing protein	NA	NA	NA	NA
WP_020829883.1\|1546335_1550889_-	PAAR domain-containing protein	NA	NA	NA	NA
1549192:1549210	attR	NA	NA	NA	NA
WP_020829882.1\|1550902_1551325_-	DcrB-related protein	NA	NA	NA	NA
WP_016726151.1\|1551376_1553659_-	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_020829879.1\|1554180_1555182_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_081263831.1\|1556046_1557681_-	glycoside hydrolase family 6 protein	NA	NA	NA	NA
WP_020829875.1\|1558483_1559020_-	hypothetical protein	A0A2H4JCL4	uncultured_Caudovirales_phage	7.2e-72	80.3
WP_020829874.1\|1559117_1559339_+	hypothetical protein	NA	NA	NA	NA
WP_043898193.1\|1560753_1561104_+	hypothetical protein	NA	NA	NA	NA
WP_173940848.1\|1561689_1561959_+	hypothetical protein	A0A2H4JI44	uncultured_Caudovirales_phage	1.9e-17	55.1
WP_016721870.1\|1564653_1565640_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_081263830.1\|1565790_1566363_+	mannose-binding lectin protein	NA	NA	NA	NA
WP_043885814.1\|1566837_1567320_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_020829705.1\|1567316_1567670_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_020829706.1\|1567702_1569259_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	7.0e-75	36.6
WP_064820709.1\|1570119_1570434_+	transcriptional regulator	NA	NA	NA	NA
WP_043898030.1\|1570777_1571218_-	hypothetical protein	NA	NA	NA	NA
WP_019719041.1\|1572440_1573460_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_086004752.1\|1573832_1574635_-\|transposase	IS5-like element IS1421 family transposase	A0A0M5M147	Mycobacterium_phage	3.6e-27	35.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP015850

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP015850_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015850_1

2244568-2244678

Orphan

Consensus_repeat	Method
GCGGACGGCTCGGGACGAATATAGGGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015850_1

>merge|NZ_CP015850|1|2244568-2244678|CRISPRCasFinder
GCGGACGGCTCGGGACGAATATAGGGATGGGAAGCGCTGTTGGCGGCGCGCCCGGACGGGGCGCCCTGCTCCGGCAGCGGAGGCGCGGACGGCTCGGGACGAACATAGGGA

>NZ_CP015850|1|1|2244568-2244678|CRISPRCasFinder
GCGGACGGCTCGGGACGAATATAGGGA	TGGGAAGCGCTGTTGGCGGCGCGCCCGGACGGGGCGCCCTGCTCCGGCAGCGGAGGC
GCGGACGGCTCGGGACGAACATAGGGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015850.1\|WP_020831876.1\|2248095_2249841_-\|thiamine-pyrophosphate-binding-protein	unknown	unknown	gnl\|CDD\|181285
NZ_CP015850.1\|WP_020831875.1\|2249925_2250738_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225818
NZ_CP015850.1\|WP_020831893.1\|2233225_2233957_-\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-dimerization-subunit-type-1-TsaB	unknown	unknown	gnl\|CDD\|274750
NZ_CP015850.1\|WP_020371745.1\|2240396_2240831_+\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
NZ_CP015850.1\|WP_011001297.1\|2254683_2255667_-\|CysB-family-HTH-type-transcriptional-regulator	unknown	unknown	gnl\|CDD\|237172
NZ_CP015850.1\|WP_011001310.1\|2239144_2239366_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015850.1\|WP_020831877.1\|2247561_2248068_-\|ribonuclease-E-activity-regulator-RraA	unknown	unknown	gnl\|CDD\|236487
NZ_CP015850.1\|WP_020831881.1\|2245112_2246978_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|275380
NZ_CP015850.1\|WP_020831891.1\|2234430_2235894_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP015850.1\|WP_043897909.1\|2236567_2238148_-\|malate-synthase-A	unknown	unknown	gnl\|CDD\|236432
NZ_CP015850.1\|WP_020831887.1\|2240962_2242267_-\|isocitrate-lyase	unknown	unknown	gnl\|CDD\|237893
NZ_CP015850.1\|WP_020831871.1\|2251985_2252279_-\|2TM-domain-containing-protein	unknown	unknown	gnl\|CDD\|379083
NZ_CP015850.1\|WP_020831866.1\|2255701_2256817_-\|sulfate-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213263
NZ_CP015850.1\|WP_011001313.1\|2235990_2236461_-\|DUF1857-family-protein	unknown	unknown	gnl\|CDD\|176872
NZ_CP015850.1\|WP_043897698.1\|2250741_2251986_-\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|225519
NZ_CP015850.1\|WP_011001309.1\|2239390_2240320_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP015850.1\|WP_016722033.1\|2234109_2234379_+\|acyl-CoA-binding-protein	unknown	unknown	gnl\|CDD\|226731
NZ_CP015850.1\|WP_016722040.1\|2247155_2247569_-\|gamma-glutamylcyclotransferase	unknown	unknown	gnl\|CDD\|225016
NZ_CP015850.1\|WP_011001311.1\|2238232_2238934_-\|haloacid-dehalogenase-type-II	unknown	unknown	gnl\|CDD\|130495
NZ_CP015850.1\|WP_043897697.1\|2252477_2254535_-\|type-III-effector-protein	unknown	unknown	gnl\|CDD\|339245

Protein	Function_ID	Function_description	E-value
NZ_CP015850.1\|WP_020831876.1\|2248095_2249841_-\|thiamine-pyrophosphate-binding-protein	gnl\|CDD\|181285	PRK08199, PRK08199, thiamine pyrophosphate protein; Validated.	0
NZ_CP015850.1\|WP_020831893.1\|2233225_2233957_-\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-dimerization-subunit-type-1-TsaB	gnl\|CDD\|274750	TIGR03725, T6A_YeaZ, tRNA threonylcarbamoyl adenosine modification protein YeaZ. This family describes a protein family, YeaZ, now associated with the threonylcarbamoyl adenosine (t6A) tRNA modification. Members of this family may occur as fusions with ygjD (previously gcp) or the ribosomal protein N-acetyltransferase rimI, and is frequently encoded next to rimI. [Protein synthesis, tRNA and rRNA base modification].	6.15465e-56
NZ_CP015850.1\|WP_011001309.1\|2239390_2240320_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.22847e-92
NZ_CP015850.1\|WP_020371745.1\|2240396_2240831_+\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	5.66819e-31
NZ_CP015850.1\|WP_011001297.1\|2254683_2255667_-\|CysB-family-HTH-type-transcriptional-regulator	gnl\|CDD\|237172	PRK12683, PRK12683, transcriptional regulator CysB-like protein; Reviewed.	0
NZ_CP015850.1\|WP_020831891.1\|2234430_2235894_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.32105e-68
NZ_CP015850.1\|WP_020831877.1\|2247561_2248068_-\|ribonuclease-E-activity-regulator-RraA	gnl\|CDD\|236487	PRK09372, PRK09372, ribonuclease E inhibitor RraA.	5.28194e-95
NZ_CP015850.1\|WP_020831881.1\|2245112_2246978_-\|hypothetical-protein	gnl\|CDD\|275380	sd00033, LRR_RI, leucine-rich repeats, ribonuclease inhibitor (RI)-like subfamily. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.	1.63521e-33
NZ_CP015850.1\|WP_020831875.1\|2249925_2250738_-\|response-regulator-transcription-factor	gnl\|CDD\|225818	COG3279, LytT, Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms].	9.38409e-65
NZ_CP015850.1\|WP_043897909.1\|2236567_2238148_-\|malate-synthase-A	gnl\|CDD\|236432	PRK09255, PRK09255, malate synthase; Validated.	0
NZ_CP015850.1\|WP_020831887.1\|2240962_2242267_-\|isocitrate-lyase	gnl\|CDD\|237893	PRK15063, PRK15063, isocitrate lyase; Provisional.	0
NZ_CP015850.1\|WP_020831871.1\|2251985_2252279_-\|2TM-domain-containing-protein	gnl\|CDD\|379083	pfam13239, 2TM, 2TM domain. This short region contains two transmembrane alpha helices that are found associated with a wide range of other domains. This domain may be involved in cell lysis or peptidoglycan turnover.	4.07664e-14
NZ_CP015850.1\|WP_020831866.1\|2255701_2256817_-\|sulfate-ABC-transporter-ATP-binding-protein	gnl\|CDD\|213263	cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter. Part of the ABC transporter complex cysAWTP involved in sulfate import. Responsible for energy coupling to the transport system. The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	1.25589e-167
NZ_CP015850.1\|WP_011001313.1\|2235990_2236461_-\|DUF1857-family-protein	gnl\|CDD\|176872	cd08863, SRPBCC_DUF1857, DUF1857, an uncharacterized ligand-binding domain of the SRPBCC domain superfamily. Uncharacterized family of the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands. SRPBCC domains include the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD1-STARD15, the C-terminal catalytic domains of the alpha oxygenase subunit of Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs_alpha_C), Class I and II phosphatidylinositol transfer proteins (PITPs), Bet v 1 (the major pollen allergen of white birch, Betula verrucosa), CoxG, CalC, and related proteins. Other members of the superfamily include PYR/PYL/RCAR plant proteins, the aromatase/cyclase (ARO/CYC) domains of proteins such as Streptomyces glaucescens tetracenomycin, and the SRPBCC domains of Streptococcus mutans Smu.440 and related proteins.	2.21381e-54
NZ_CP015850.1\|WP_043897698.1\|2250741_2251986_-\|sensor-histidine-kinase	gnl\|CDD\|225519	COG2972, COG2972, Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms].	4.69366e-88
NZ_CP015850.1\|WP_016722040.1\|2247155_2247569_-\|gamma-glutamylcyclotransferase	gnl\|CDD\|225016	COG2105, COG2105, Uncharacterized conserved protein [Function unknown].	8.89773e-29
NZ_CP015850.1\|WP_016722033.1\|2234109_2234379_+\|acyl-CoA-binding-protein	gnl\|CDD\|226731	COG4281, ACB, Acyl-CoA-binding protein [Lipid metabolism].	2.01415e-46
NZ_CP015850.1\|WP_011001311.1\|2238232_2238934_-\|haloacid-dehalogenase-type-II	gnl\|CDD\|130495	TIGR01428, Haloacetate_dehalogenase, 2-haloalkanoic acid dehalogenase, type II. Catalyzes the hydrolytic dehalogenation of small L-2-haloalkanoic acids to yield the corresponding D-2-hydroxyalkanoic acids. Belongs to the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases (pfam00702), class (subfamily) I. Note that the Type I HAD enzymes have not yet been fully characterized, but clearly utilize a substantially different catalytic mechanism and are thus unlikely to be related.	1.61219e-91
NZ_CP015850.1\|WP_043897697.1\|2252477_2254535_-\|type-III-effector-protein	gnl\|CDD\|339245	pfam14496, NEL, C-terminal novel E3 ligase, LRR-interacting. This NEL or novel E3 ligase domain is found at the C-terminus of bacterial virulence factors. Its sequence is different from those of the eukaryotic HECT and RING-finger E3 ligases, and it subverts the host ubiquitination process. At the N-terminus of the family-members there is a series of LRR repeats, and the NEL domain interacts with the most N-terminal repeat. The key residue for the ligation step is the cysteine, eg found at position 386 in UniProtKB:E7K2H2. The LRR section sequesters this active site until invasion has occurred.	2.25428e-50

>NZ_CP015850.1|WP_020831887.1|2240962_2242267_-|isocitrate-lyase
MSRELEVKALQQEWDTNPRWKGIKRGYSAQDVVRLRGSLQIEHTLARRGAEKLWTLMNSEPFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAGDANSNGEMYPDQSLYSVDSVPKVVKRINNTFQRADQIQWSEGKDDVDFFAPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFEDQLAAVKKCGHMGGKVLVPTREAVSKLVAARLAADVMGVPTVLIARTDAEAADLLTADVDDNDRPFCTGERTVEGFYRTKPGLQQAIARGLAYADYADLVWCETGKPDLEYAKKFAEAIHAKFPGKMLAYNCSPSFNWKKNLDDATIAKFQKELGAMGYKFQFITLAGFHALNYSMFNLAHGYARNQMSAFVELQEAEFAAAEKGFTAVKHQREVGTGYFDAVTQTIERDASTTALKGSTEDEQFFEEKAHAKKVA
>NZ_CP015850.1|WP_020371745.1|2240396_2240831_+|universal-stress-protein
MFQHILIPTDGSELSRKAVAGALDFAKTLGARLTAYTCLEEYPYTPFSEIVVETPQAFKERVEAQARVVLKDVEDTARAAGIDCDTDMSCFAVPYMGIIDAAERHGCDVIFMASHGRRGLAGLLLGSETQKVLTHTAIPVIVYR
>NZ_CP015850.1|WP_011001309.1|2239390_2240320_+|LysR-family-transcriptional-regulator
MAHFKQLETFVAVATRGSLSAAAAAEGVAPAIIGRRIDALEERLGVKLLVRTTRRITLTFEGSAFLEDCQRILNDLHNAEASVSAGGVKASGHLRVTAPAGFGRRHVAPMVPDFLAAHPDVSITLDLGDRIVDLVNEGFDCAIRLGDLPDSSLVSIRLWENRRVVVAAPAYLERRGRPEQLEQLAGHNCLAFGASANVQRGWVFQQGGKTVTVKVGGTMECTDGAVLREWCLQGHGLAWRSWWEVGHDIATGRLVTVLDAFEAPPIGIHAVFPQRKHLPLRVRLLIDFLKNTYGNPAYWRRADPTLLTD
>NZ_CP015850.1|WP_011001310.1|2239144_2239366_+|hypothetical-protein
MSLWPQIACVAQRVPAGKIGADGGAAWLAGVAAGALAAWAWLRGRFRLAPAVLEIGVAPWRLRRPSTPAGMPA
>NZ_CP015850.1|WP_011001311.1|2238232_2238934_-|haloacid-dehalogenase-type-II
MTSIRAVVFDAYGTLFDVYSVAARAEQLFPGKGEALSVLWRDRQIDYTRIRSLAGPSGEHYKPFWDVTVDALRYACARLNLPLGNHAEATLMREYACLSAFPENVPVLRQLREMGLPLGILSNGNPQMLEIAVKSAGMSGLFDHVLSVDAVRLYKTAPAAYALAPRAFGVPAAQILFVSSNGWDACGATWHGFTTFWINRLGHPPEALDVAPAAAGHDMRDLLQFVQARQSMR
>NZ_CP015850.1|WP_043897909.1|2236567_2238148_-|malate-synthase-A
MELTLPQGMEIKAEILPAYEDILTPEALALVARLHRAFEPRRQQLLAERAERVKRLDAGERPDFLPETRHIREGDWTIAPIPPALECRRVEITGPVEAKMVINAFNSGADSYMTDFEDSNAPSWHNQIQGQVNLKAAIRRTLTLESGGKSYKLNDKIATLQVRPRGWHLDEKHVTVDGQRVSGGIFDFALFLFHNAREQLARGAGPFFYLPKMESHLEARLWNDVFIAAQDALGLPRGTIKATVLIETILAAFEMDEILYELREHSAGLNAGRWDYIFSCIKKFKVDQNFCLADRAKVTMTSPFMRAYALLLLKTCHKRNAPAMGGMSALIPIKNDPEKNAIAMQGIINDKKRDATDGYDGGWVAHPGLVEAAMKEFVDVLGDAPNQIGKQRPDVNVAAADLLNFQPEQPITEAGLRMNINVGIHYLGAWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGTLEDGTKVTAELVRKLIPEELAKVKADGAVGHFDRAAQIFEQMSTSESFSEFLTLPLYEEL
>NZ_CP015850.1|WP_011001313.1|2235990_2236461_-|DUF1857-family-protein
MRFEHLVEVNDPLNPLMDALTLNQIWQGLVLRVLEPTEFVEGLDEGIITARGEGWVERELRFGKARIQDRVTLEPHQRVTYTTAATGEHAGGSLTMTIETNEANAAFIRFVYDTTLPSADETGDTRYAEIVKSAYREADIDTVRRIREFAAIGRLG
>NZ_CP015850.1|WP_020831891.1|2234430_2235894_-|DHA2-family-efflux-MFS-transporter-permease-subunit
MATFTPTLETLRARHGERFKWLVLFTLTVGTVSSIISATIVNVAIPDLSRHFVLGQERAQWVSASFMVAMTLAMLLTPWLLLRFGLRRTFIGALLLLGVGGLVGGLSPTYGVMIAMRVVGGVAAGIMQPLPNILILRVFPEREQGKAFGLFGFGVVLAPALGPSLGGFLVELFGWRSIFFVVVPFTLLGWAMARRFMAINSSMAGEPKPLDWRGLLLVGAATVALLNGLVELHADVTRGVALMAVSAVCLAMFLFWQRRVESPLLDLRLFSYRQFAMGAVVAFIYGAGLYGSTYLLPVYMQVALAYTPSSAGLVLLPPGLALAATIVVAGRLTSRIEPYRLVSFGLAALAVSFLLMTTNTRATGYLLLIGIAAIGRVGLGFVLPSLSLGAMRGVDFTLIPQGSSAVNFLRQLGGAIGVSATGIFLQWRLAARGIGAVGGVAVDPEARIVACDETFVFLGVLCALAVAAAWRMRRREPAAVVSAGVGP
>NZ_CP015850.1|WP_016722033.1|2234109_2234379_+|acyl-CoA-binding-protein
MSDLQTRFEQAQTDVKSLSERPSNMTLLRLYALFKQGSEGDAHGDKPGFTDIVGRYKYEAWAGLKGLSQDDARQKYIDLVEELKSGATT
>NZ_CP015850.1|WP_020831893.1|2233225_2233957_-|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-dimerization-subunit-type-1-TsaB
MPWILAFDTSTEFCSVALGDGTRTLFRHEHTGARSSSRVLPAAGELLAEAGIALGDCAAIAFGAGPGSFTGLRTACGVAQGLAFGAGLPMVPVNSLMACAEQTRAALPAGTAVTVALDARMDECYWASFVPVAEDASGWHALSAVQVSAPQAVAPPQQPYWLAGNAAAVFGDRLAAATGAAAVLPDVAPHAREIVTLGLRLLAAGHTVRPEDAAPLYVRDKVALTIEERQAVQQAKAAAGARA
>NZ_CP015850.1|WP_020831881.1|2245112_2246978_-|hypothetical-protein
MVSRIPTGNRGQGNGIEQSASSHATEATPWLGVNLPYGHWLPSSARSVVSRASSLLGGLANFRWGGPSASARPAPNIRSAAIAPAQQTLPPELWQQIATLAGARPRRAMREVSLELRNASRAVVTHLTISDPAMFRQLSLYPALKSVRFKGELTLEALKALPPTLEHLEIGRCTGSAISAEGLAHLASMPLKSLNLNGIEIGVEGARTLATSKSLVSLSLIGCGIGDRAAQALAASRSIRSLDLSVNMIGCDGAQALADAPLVSLNLYSNEIGDDGARALATSQTLTSLELRRNGIGNAGAGAFANNTVLRKLNLANNMIDKRGARVLAGNTSLTELDLGGNRLGDKGARALAGNRSLLSLKVDHNEISDEGVQALAQHATLRSLDLSFNFVGLQGAGALGGNTRLSELNLSLCGINSYSASALARNKSLASLYLNGNRIGDDGARALAKNSTLTLLDLSRNNIQNAGAEALGGNQALISLKLAGNGIDDDGAAALARHPRLTTLDLSQNRIGSEGARHLAQSATLAELDLSENRIGPEGAKALSLSTVLTTLKVIDNVIGEDGARALADSTSLTSLDARRNGIGEAGAKVLEANTRITGTLQNPNFLAEDVPRPDVRWRD
>NZ_CP015850.1|WP_016722040.1|2247155_2247569_-|gamma-glutamylcyclotransferase
MTEAIHVFAYGTLRAGEANDLRVAASRRGIAEPKLIGHATLHGRLYDFGAYPGLVPDPTGTAVRGDVYRIDPGLVPVLDTIEAVYPGGEALFLRETHTVMLGSEPLDCIVYPVSAGQVAGRHVITGGDWVAYRLARG
>NZ_CP015850.1|WP_020831877.1|2247561_2248068_-|ribonuclease-E-activity-regulator-RraA
MTTMMIPVTDLCDAHEDQLASGAVRVLAPVFHSFGARAAFAGPAATLKVFEDNGLVRAMLEQPGEGRVLVVDGGGSLRCALVGGNLAKLAEDNGWEGVLVNGCVRDTRELAACNVGVHALVAHPRKSFKKNQGERDIGVQMPGAYIHPGEWIYGDEDGVLVSRERLHD
>NZ_CP015850.1|WP_020831876.1|2248095_2249841_-|thiamine-pyrophosphate-binding-protein
METAVARPVSTGPTDSTDSGSRPVPRHGGQILVDALIAHGTDLAFGVPGESYLAVLEGFYQRRDRARFIVCRQEGGAATMADAHGKLTGRPGIVFCTRGPGATNASIGVHTAFQDSTPLILFIGQVGRDCVDREAFQEIDYRRMFGQMAKWVAQIDSVERIPEYIARAFQTATAGRPGPVVLALPEDMLTQVATVADVPPMPRAMAWPAPHDLARLKALLGRAERPLLLLGGAGWTPQAAARLQAFAERWRLPVGCVFRRQDLFDNRHPNYAGDVGIAINPKLAARVREADVVLAIGTRLGEMATSGYTLFDVPRPRQTLIHVHAGAEELGRVYQADLMIHAAMPAIAEALDGVAPDAPPRWQAWTEAAHADYLANIAPPPFAGRGIDLARAMQWLRERLPRNAILTNGAGNYATWLHRFYQYGPLAAGSRTQLAPTSGAMGYGAPAAVAAKIACPQTPVICLAGDGCFLMNGQELATAMQYDAPVIFIVVNNGMYGTIRMHQERAYPEHVSGTELRNPDFAALARAYGAEGHTVRSLEGFQAAVEAALAAPVATVIEVQTDPEIISPRATLQSLRAQARG
>NZ_CP015850.1|WP_020831875.1|2249925_2250738_-|response-regulator-transcription-factor
MPIAPRLLIADDEPALADSLIAELAALWPGARIAPAVHDGQSALDAIDRPRAGEAPDVVFLDIRMPGLSGIEVARELAGRAQRPLVVFVTAYDQFALDAFEQAAVDYVLKPVQTERLAATVRRLKARLAERPDGGAAADSAQTLAQLVERLAGLPAAGGANGAYLRFIKALVGQEIRFIPVEEVLYLEATDKYVNVVTHAGASLIRTSLRELLSQLDPQHFWQVHRGTVVNVAHVASAVHLSLGRLALKIRGRTETLPVARQYAHLFRQM
>NZ_CP015850.1|WP_043897698.1|2250741_2251986_-|sensor-histidine-kinase
MRDRPRFDPATPSSKIGRMLANVSLPPLAECLRIAMRWLRAFAWIVAINTGIAAVLAFGIKPDDTFWHDLVYSQAIGLSMWLLIDIPRHLLWGNGSPSRKILPWIVVAAVLIGVPFGQWVARRILCTGDQPWRADSLRMSFIIAMLAALGAMYFYWSRGKLATLQRQAALDALEREEAEKQVVRAQLMALQAQIEPHFLFNALAHVDVLIARDPAGARRLLQHLIGFLRTSLAHARAEQCTLAQEFALLRAYLDIQALRFGARLRFSLALDDAIAGLVVPPMLIQPLVENAVVHGIEPSREGGTIALSARREGDRLRLEVRDTGIGFGRGAAPGKDSGMGLTHVRERLARLFDADARLTIAETMPHGVTVTVELPLAHDAAGADASGAPVPQWRCRFSRPAVAPALAPRAPAGT
>NZ_CP015850.1|WP_020831871.1|2251985_2252279_-|2TM-domain-containing-protein
MSATAFPASDDAALLHRARRRAGARMGLRIHLLAFLAVNLMLAAMALSHGQSWFVWPLLAWGVGLAVHGLGLAWALGSGYRRLVDRELARLRNQAGR
>NZ_CP015850.1|WP_043897697.1|2252477_2254535_-|type-III-effector-protein
MPTRVPSPTLGRSHPVTGAASTATSTAATATRSGPATAPASGRSREGLLAELPTGRTARTPSVSAAGAHAGRPAWNVQGAIEAMAALSPEREKRLFKKSASPQYRYAKGLTAEQRGQLESALEQRFRNPAAPAEARDSALAMWLSVQQARLRTHTAGHRNHHNLEQFQLAALSVPIPLLALGYRRQRRRYYSSPLRPEYRTAFNNFMRVIGDPSLSEAVRQTVAQRLEYHRRSEETIARHERQLLGEHGVMGLAESGYQIGTNYDHVNLTALEREAVVESRGSGVPPALHIQALQTERSRVESGALRHQWLTRELRDAQARAGQGEAVAGSDGPSSVRQVDAAESSAAAARLRRDTANDIRRLRRPLAAEIKQWLKLADMKPLPNPKAFDNELYANAFARLLERRRPLSLISYFARWDPVVVDGAKVIQAVAKDANLRKEVFAAAETALGTCGDNVADGFANIVTMVDTHQLVDDVRSGKLDQPALEAWGRQRYRLDSLITEVNQWMASRRRQAGQHSIMTERRVAREPLETMLHAKVALKTVLDLPKNLPSSMRHRLASALKPDDLKRLAETVQAKEADPVELARYLLSNDAWRGAMKALHPAAFAALRKRFAPEKDALAKEIPPQPTDPEGLEFLDERMAYAERTDAFTQKCRAAEDTLLLSLAGRYALVPAVVGAGPSQGSR
>NZ_CP015850.1|WP_011001297.1|2254683_2255667_-|CysB-family-HTH-type-transcriptional-regulator
MNFQQLRSIREAVRRQFNLTEVANALYTSQPGVSRQIRELEDELGVEIFERYGKRLTGLTEPGREIVRIVERLLLEAENLRQAGEEFSGRQSGRLTVATTHTQARYALPKVVQAFRKAYPHVTLALQEASPSHIVELLLTGQADIGVATEAVASEPGLTSFEAYRWRHVLVVSPDHPLTKNPLPALEDVAQYPLITYDAGFTGRRNIDAAFAGAGLQPEIVLTAMDADVIKTYVALDVGVGIIASMAYDGRKDDNLVCIGADHLFEPNTTRVAVRRGAYLRGYAHDFIGMFAPHLSREAVAEAVASTVVAQPARPALVASPRQTLAA
>NZ_CP015850.1|WP_020831866.1|2255701_2256817_-|sulfate-ABC-transporter-ATP-binding-protein
MSIQVQHVTKRFGNFVALDDVSLAFRQGELTALLGPSGCGKTTLLRIIAGLEHADAGTILLNGEDASDRHVRERQVGFVFQHYALFKHMTVFENVAFGLRVKPRAQRPSEAQIRAKVKALLELVQLDWLAERYPPQLSGGQRQRIALARALAVEPRVLLLDEPFGALDAKVRKELRRWLRRLHDDLHVTSLFVTHDQEEALEVADSVVLMNRGQVEQVGSPDAVYNTPATPFVYGFLGNVNLFHGRLEAGEGGSVLHVGETALSVPPGGVDASRADQAVAFVRPHEIDLERYAPGAEGIPVTLRRALTLGAVAQLELERTDSDDIIEVSLPIERFRAQGLREGETLVVRPRAIRVFAQGQGSEHAAAAQAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP015850_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015850_2

3729958-3730324

Orphan

Consensus_repeat	Method
CGGNGGCGCCGGCAACGAC	CRT

6 spacers

The CRISPR arrays of NZ_CP015850_2

>merge|NZ_CP015850|2|3729958-3730324|CRT
CGGTACCGCCGGCGACGACACCATCAACGGCTGGCAGGGCGACGATATCCTCATCGGTGGTGACGGCAACGACACCCTAGTCGCCAATGGCGGTAACGACCAACTTTACGGCGGCGCCGGCAACGACTCCCTGCGCATCAACGACAACGCCACCGCCTCTGTCGACGGTGGCGACGGCAACGACACCATCTCCGCCGACAGCGGCACCACCTCCACCATCTCTGCCGGCAACGGCGATGACATCGTCCAAATCGGTGCCTGGTCCTTCCGGAGCACCATCGATGGCGGCGCCGGCAACGACATCATCAAGATCGACACCTACGGTGCCTCTCAAGGCGCCGACATCACCGGTGGCACTGGCGACGAC

>NZ_CP015850|2|1|3729958-3730324|CRT
CGGTACCGCCGGCGACGAC	ACCATCAACGGCTGGCAGGGCGACGATATCCTCAT
CGGTGGTGACGGCAACGAC	ACCCTAGTCGCCAATGGCGGTAACGACCAACTTTA
CGGCGGCGCCGGCAACGAC	TCCCTGCGCATCAACGACAACGCCACCGCCTCTGTCGA
CGGTGGCGACGGCAACGAC	ACCATCTCCGCCGACAGCGGCACCACCTCCAC
CATCTCTGCCGGCAACGGC	GATGACATCGTCCAAATCGGTGCCTGGTCCTTCCGGAGCACCATCGA
TGGCGGCGCCGGCAACGAC	ATCATCAAGATCGACACCTACGGTGCCTCTCAAGGCGCCGACATCAC
CGGTGGCACTGGCGACGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015850.1\|WP_011000068.1\|3731185_3731548_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015850.1\|WP_020830868.1\|3733359_3734793_-\|alkaline-phosphatase	unknown	unknown	gnl\|CDD\|224699
NZ_CP015850.1\|WP_038938143.1\|3735159_3735591_+\|L,D-transpeptidase	unknown	unknown	gnl\|CDD\|341130
NZ_CP015850.1\|WP_013213874.1\|3716935_3717163_+\|sulfur-carrier-protein-ThiS	unknown	unknown	gnl\|CDD\|180768
NZ_CP015850.1\|WP_043897616.1\|3723639_3724464_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015850.1\|WP_043897618.1\|3722492_3723317_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015850.1\|WP_086004752.1\|3719838_3720641_+\|IS5-like-element-IS1421-family-transposase	unknown	unknown	gnl\|CDD\|379129
NZ_CP015850.1\|WP_019717357.1\|3724787_3725606_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015850.1\|WP_011000061.1\|3735587_3736139_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015850.1\|WP_043897615.1\|3731582_3732488_-\|bifunctional-hydroxymethylpyrimidine-kinase/phosphomethylpyrimidine-kinase	unknown	unknown	gnl\|CDD\|223428
NZ_CP015850.1\|WP_011000059.1\|3737878_3738220_+\|phage-holin-family-protein	unknown	unknown	gnl\|CDD\|224861
NZ_CP015850.1\|WP_011000058.1\|3738233_3739064_+\|methylenetetrahydrofolate-reductase-[NAD(P)H]	unknown	unknown	gnl\|CDD\|273212
NZ_CP015850.1\|WP_020830869.1\|3732558_3733278_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015850.1\|WP_011000060.1\|3736387_3737812_+\|adenosylhomocysteinase	unknown	unknown	gnl\|CDD\|377487
NZ_CP015850.1\|WP_043897620.1\|3715799_3716939_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274092
NZ_CP015850.1\|WP_016726789.1\|3719281_3719761_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319910
NZ_CP015850.1\|WP_011000057.1\|3739072_3739531_+\|TfoX/Sxy-family-protein	unknown	unknown	gnl\|CDD\|225612
NZ_CP015850.1\|WP_020830875.1\|3717996_3719154_+\|thiamine-phosphate-synthase	unknown	unknown	gnl\|CDD\|237041
NZ_CP015850.1\|WP_020830876.1\|3717172_3718000_+\|thiazole-synthase	unknown	unknown	gnl\|CDD\|234687
NZ_CP015850.1\|WP_020829879.1\|3720775_3721777_+\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|226077

Protein	Function_ID	Function_description	E-value
NZ_CP015850.1\|WP_020830868.1\|3733359_3734793_-\|alkaline-phosphatase	gnl\|CDD\|224699	COG1785, PhoA, Alkaline phosphatase [Inorganic ion transport and metabolism].	8.66204e-159
NZ_CP015850.1\|WP_011000058.1\|3738233_3739064_+\|methylenetetrahydrofolate-reductase-[NAD(P)H]	gnl\|CDD\|273212	TIGR00676, 510-methylenetetrahydrofolate_reductase., 5,10-methylenetetrahydrofolate reductase, prokaryotic form. The enzyme activities methylenetetrahydrofolate reductase (EC 1.5.1.20) and 5,10-methylenetetrahydrofolate reductase (FADH) (EC 1.7.99.5) differ in that 1.5.1.20 (assigned in many eukaryotes) is defined to use NADP+ as an acceptor, while 1.7.99.5 (assigned in many bacteria) is flexible with respect to the acceptor; both convert 5-methyltetrahydrofolate to 5,10-methylenetetrahydrofolate. From a larger set of proteins assigned as 1.5.1.20 and 1.7.99.5, this model describes the subset of proteins found in bacteria, and currently designated 1.7.99.5. This protein is an FAD-containing flavoprotein. [Amino acid biosynthesis, Aspartate family].	2.91618e-141
NZ_CP015850.1\|WP_038938143.1\|3735159_3735591_+\|L,D-transpeptidase	gnl\|CDD\|341130	cd16913, YkuD_like, L,D-transpeptidases/carboxypeptidases similar to Bacillus YkuD. Members of the YkuD-like family of proteins are found in a range of bacteria. The best studied member Bacillus YkuD has been shown to act as an L,D-transpeptidase that gives rise to an alternative pathway for peptidoglycan cross-linking. Another member Helicobacter pylori Csd6 functions as an L,D-carboxypeptidase and regulates helical cell shape and motility. The conserved region contains a conserved histidine and cysteine, with the cysteine thought to be an active site residue.	8.37095e-26
NZ_CP015850.1\|WP_013213874.1\|3716935_3717163_+\|sulfur-carrier-protein-ThiS	gnl\|CDD\|180768	PRK06944, PRK06944, sulfur carrier protein ThiS; Provisional.	1.69525e-23
NZ_CP015850.1\|WP_086004752.1\|3719838_3720641_+\|IS5-like-element-IS1421-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	7.67518e-30
NZ_CP015850.1\|WP_011000060.1\|3736387_3737812_+\|adenosylhomocysteinase	gnl\|CDD\|377487	pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hydrolase.	0
NZ_CP015850.1\|WP_043897615.1\|3731582_3732488_-\|bifunctional-hydroxymethylpyrimidine-kinase/phosphomethylpyrimidine-kinase	gnl\|CDD\|223428	COG0351, ThiD, Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [Coenzyme metabolism].	3.75391e-115
NZ_CP015850.1\|WP_011000059.1\|3737878_3738220_+\|phage-holin-family-protein	gnl\|CDD\|224861	COG1950, COG1950, Predicted membrane protein [Function unknown].	7.22347e-22
NZ_CP015850.1\|WP_011000057.1\|3739072_3739531_+\|TfoX/Sxy-family-protein	gnl\|CDD\|225612	COG3070, TfoX, Regulator of competence-specific genes [Transcription].	8.15875e-38
NZ_CP015850.1\|WP_020829879.1\|3720775_3721777_+\|IS110-family-transposase	gnl\|CDD\|226077	COG3547, COG3547, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	7.34272e-37
NZ_CP015850.1\|WP_016726789.1\|3719281_3719761_+\|VOC-family-protein	gnl\|CDD\|319910	cd07246, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.68514e-50
NZ_CP015850.1\|WP_020830875.1\|3717996_3719154_+\|thiamine-phosphate-synthase	gnl\|CDD\|237041	PRK12290, thiE, thiamine phosphate synthase.	2.01357e-68
NZ_CP015850.1\|WP_020830876.1\|3717172_3718000_+\|thiazole-synthase	gnl\|CDD\|234687	PRK00208, thiG, thiazole synthase; Reviewed.	1.87668e-150
NZ_CP015850.1\|WP_043897620.1\|3715799_3716939_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|274092	TIGR02352, Glycine_oxidase, glycine oxidase ThiO. This family consists of the homotetrameric, FAD-dependent glycine oxidase ThiO, from species such as Bacillus subtilis that use glycine in thiamine biosynthesis. In general, members of this family will not be found in species such as E. coli that instead use tyrosine and the ThiH protein. [Biosynthesis of cofactors, prosthetic groups, and carriers, Thiamine].	8.67713e-63

>NZ_CP015850.1|WP_019717357.1|3724787_3725606_+|hypothetical-protein
MKLKKKVVIPLFIVLLLATAWTALFKPRLLPKPIQRHLFADWMIQEERRTDPAVGHLGGIPVSIPRPYAHFLEYDGDPGFTEPRKGPRPERTFESGIRSFGFEVHYPDMEVASITNLDKQKHESIYTTTWLTVGISSNNDYPGQYYPEGQVLGIDNRHYKYERISASEHGLETYIPINVDQEARKKGGGAANMFDYNIYYYRNSSGRIDAYITCSNVTHEAAVCRQHFNLFPDMKASVTVSYRRGLLKDWREIQSSISKIIFGFKTTNNQNN
>NZ_CP015850.1|WP_043897616.1|3723639_3724464_+|hypothetical-protein
MKLKKKVVIPLFIVLLLATAWMALFKPRLLPKPIQRHLFADWMIQEERRTDPAVGHLGGIPVSIPRPYAHFLEYDGDPGFTEPRKGPRPERTFDSGIRSFGFEMHYPDMEVASAINLDKQVRKNIYTSPLLRVGINSNSFYGGKDFPLGSVQTIKFKKYRYERSDKKNYELETYIPINVDENERHKGGGAADMFDYNIYYHKDATGRVDTYIKCINASHETAPCEQVFNLFPKIAADVSVTYRRGLLKDWREIQSSVSKVIFGFKKTNTQDQRN
>NZ_CP015850.1|WP_043897618.1|3722492_3723317_+|hypothetical-protein
MKLKKKVVIPLFIVLLLATTWMALFKPRLLPKPIQRHLFADWMIQEERRTDPAVGHLGGIPVSIPRPYAHFLEYDGDPGFTEPRKGPRPERTFESGIRSFGFKVHYPDMEVASAANLDKQKSESIYTSTWLSIGISSNSDYPGQHYPEGQVLGMGNRHYKYKQTNTSEYGLETYVPINVDETARKKGSGAADMFDYNIYYYKNSSGRIDAYITCINVKHEAAICEHQFNLFPDMKAGVSINYRRSLLKDWREIQSSVSKVIFGFRTTNTQDQHN
>NZ_CP015850.1|WP_020829879.1|3720775_3721777_+|IS110-family-transposase
MKLTVIGMDIAKHVFQLHAVNPSTGEIERIKLRRSQLLEFFAKRERSLVAMEACGGAHHWARELLQLGHDVKLICPRSVRPFVLRNKSDAADARAIWTAVQQPEARLVAVKSEAQQTILALHRLRAQLMKFRIMQTNALRGLLHEFGEALPEGYQALSKEIPAALAKVSDRLPAMLIDSLREQWARVQATDKDINLLEHRLKLALRDSQQCQRIAEIPGIGLLTATAAVATIGDPHTFRSGREFAAWLGLVPKQVGTGGKVRQLGLSKRGDTYLRTLLMHGARSVITRGTRSPWLDGLLARRPFNVVVAALANKLARTIWAVLSRGTPYHGAA
>NZ_CP015850.1|WP_086004752.1|3719838_3720641_+|IS5-like-element-IS1421-family-transposase
MARKKISNELWKALQPLLPVVEPSTKGGRPRVDDRAALNGILFVLHTGIPWEDLPKELGFGSGMTCWRRLREWQANGVWERLHLALLKRLREHDQIDWSRASVDGATVAKPPGGEQTGPNPTDRGKLGSKRHLVVDRRGVPLALMVTGANRHDSVVFEVLVDAIPSVPGLDGRPRCRPDKLHADKGYDFARCRRHLRKRGMTPRIARRGIEKNDRLGKHRWVVERTHAWLAGFGKLRIRFERSLQTHLALLTLACAVICGRFVDRFC
>NZ_CP015850.1|WP_016726789.1|3719281_3719761_+|VOC-family-protein
MAVKPIPEGYHSVTPYLSIKGADKALDFYKQAFGATEIMRMAGPNGAIAHAEIRIGDSPVMMADEMPNMSCASPDTLQSTSVGLMIYVKNVDAVFANAIKTGATEVRPVQNQFYGDRSGTLKDPFGHVWTISTHVEDVAPDEMKRRMDKWTQEQAGATA
>NZ_CP015850.1|WP_020830875.1|3717996_3719154_+|thiamine-phosphate-synthase
MSASALRFASAWPDAAALADRLIDRHADAFGRAPHAWSVTDRADDAATAAVLLTTDAAQAERARAAGAAVVLSEARNGERIDTVHDRLGTYRFAAPATGAVFGERFVAMFGAALALAFEPRDALCVARAWIAEAAADALAWPARFDALPRVLEPALPCAASPDLAFAPCPPRLGVYAVVPDAEWVERLVALKVPTVQLRVKSDDARAVAGQVRRAAAAAAARGSQTRLFINDHWRVALDVHAQTPDSGLYGIHLGQEDIDDADLAAIRASGLRLGISTHGYAEMLRVAALNPSYLALGAVFATPTKTMPTVPQGLGRLFAHAAAMRSRVPAPPLVAIGGIDLAAMPRVLESGVGGVAVVRAITQAEDVPAAVQALRATFAAHARA
>NZ_CP015850.1|WP_020830876.1|3717172_3718000_+|thiazole-synthase
MTTTNLSALADPLRLYDEVFGSRLLLGTARYPSPQSLEDAVRACSPAMLTVALRRQSAGAPEGGAGFWKMLRALGVPVLPNTAGCYSADEAYTLAQMSREVFETDWIKLEVIGDDYTLQPDTLALPAAAERLIRDGFKVLPYCTEDLVLCRRLLDVGCRTLMPWAAPIGTGRGPTNPYGLRLLRERLPDVPLIVDAGLGVPSHATQVMEWGYDGVLLNTAVAQAGDPVAMARAFAMATQAGRLARLSGPMPERDVAQASTPVVGLPFWHADKNSA
>NZ_CP015850.1|WP_013213874.1|3716935_3717163_+|sulfur-carrier-protein-ThiS
MTLNVTLNDLSLALPAGSTLADAIAFVTTTAAPQLQIAPPFAASVNGDFVPKARHAQHALRSGDRIALVQPVVGG
>NZ_CP015850.1|WP_043897620.1|3715799_3716939_+|FAD-dependent-oxidoreductase
MPTPFDVTILGGGLAGRLCAWQLAQTGVPPARIAVVERGARDGSGSAAYVAAAMLAPLAEAAVADRFVVELGLASLTLWRDWLPMLRTPVFFQQAGTLVVWHPADRGEASLFANHVRAATPPERIAADLRAVDAEGIGTLEPALAQRFSQGLYLAGEGQLDNRAVLDALATELEALGVQLHWNTAVADPHPQALAAAGLGARLVLDCRGLGAKPQWPQLRGLRGEVARIHAPDVTLTRPVRMLHPRYPIYIAPKPGHVYVIGATEIESDDMSPVSVRSTLELLSAAYAVHPAFGEARVLELCTQCRPTLPDHRPAIRWDGAGTLSVNGLYRHGYMIAPAVAQAAVAAAHALLDGRAIDAPASAWPGLFAAPASPEPVLP
>NZ_CP015850.1|WP_011000068.1|3731185_3731548_-|hypothetical-protein
MTSARITLSRCLAGTALCLLAGACDVGFVAVIGSTLSIGGTVTGLPANQSLVLLDNGRDALTITANGPFVFAATVPFNGGYTVTIGTQPSSASCAVSNGSGIATADVTSVVVTCQPVGSA
>NZ_CP015850.1|WP_043897615.1|3731582_3732488_-|bifunctional-hydroxymethylpyrimidine-kinase/phosphomethylpyrimidine-kinase
MTITDPTLAIVAPASHVPRVLTIAGSDSGGGAGIQADLKTFAALGCYGMSAITAVTAQNTLGVAAVESLTPDIVGAQIDAVAQDIGVDAAKTGMLGSPAVVEAIVSALARHPIAALVVDPVMVSTSGAQLGSDATAQAMAKWLFPRALLITPNLPEASALLGRAVRTADDMLPAARDLLTLGSRAVLLKGGHLADVSIPGEDGVLQDVLVTADGIERIYTHTQIDTPHTHGTGCTLSAAIAAHLARGEPLEAAVELSLDYLLHAIGAGRHLALGRGAGPLNHGFAPRPLAAPRAVDVGDAD
>NZ_CP015850.1|WP_020830869.1|3732558_3733278_-|hypothetical-protein
MHPIRLTILPLLLAASLAHAADKAPAAPAVPAAPVTAPMTVLRVEHHLAALGADGVQRDVRFAERVYRQGGRVWIARELPAAALHADPDHDSPHAGHKHVETDTAPRWIERGADGALTVRVVSEAQQKAYRVEPAEYGNIGFDGAWATAYHLLDPASLKAMRTEGPVHRGVQTYRARQGERTVTVDWDVAGQYPRRVESRNADGTQRKLTRVSVLPAPAVAPWTRAQRYPSADYTDLMD
>NZ_CP015850.1|WP_020830868.1|3733359_3734793_-|alkaline-phosphatase
MHRLSLLSVAALAALALVACGSDGTSTGVATPDAGAITTGPTRNVVFFLGDGMGLATMTAARIYKVGEDGELTMDTLPETGFVRTFSNNAQVTDSAPSMSAYMTGVKMNNEVISMSPDTAAFDAGGKDYVSGADSTCPASGNGKPVTTLLELMKAAGYGTGVVTTTRVTHATPAATYSHLCHRDGENQIAAQGTPGNALYNAALKDGLDVLLGGGRRHFLPQGTTGSKRTDTTDLIAQFQAASYTYVSTGTQLAAVDPAATTRLLGLFNLDHMNYELDRVNKRVDEPSLADMTEKAIRILQKNGNGYFLMVEGGRIDHALHGTNAKRALEDTVAFDEAIKRALSLVDRGNTLIVVTADHDHTMTINGYAHRGNPILGLSTDLKTRQPQLAADGLPYTTLVFGNGGNTRKATRDNLAAVDTTADDYLQDVGVQLGNPGSETHGGGDVMLFSSGPGSAPLKGTLDNTRVFGAVRSAMGL
>NZ_CP015850.1|WP_038938143.1|3735159_3735591_+|L,D-transpeptidase
MPTPTKKPSTKSRPKAPRTLKTIKVNLTSQIVEAFDSNNRVFRFECVSGDRDHPTDRGIFRVLWKAESHRSRAYDVQMDYALFFTNDGKALHQYHGVAPLALIRAARGNISEWFGSHGCVRLAEADAKALFAWASIGTIVQVS
>NZ_CP015850.1|WP_011000061.1|3735587_3736139_+|hypothetical-protein
MITAMKRFLMIGVALLVGCLIGAGVAHWAFSAAHPTSHVIDPGTDALSILDEEIMSITYATHRLTVTAQRTKPADRFAVQVTFSDGSPARQCIASPMLNGLLPGMATLTAKRQIPLDQVAVAFPKPLGRLEFRNRETVELISPVEFRTTAANSAVLAVFSGMAFEVAAPIDFQKLEALCAQRH
>NZ_CP015850.1|WP_011000060.1|3736387_3737812_+|adenosylhomocysteinase
MNAVTDLKHDYLVADIKLADWGRKEIAIAETEMPGLMAIRDEFAASQPLKGARIAGSLHMTIQTAVLIETLKALGADVRWASCNIFSTQDHAAAAIAASGTPVFAFKGESLKEYWDFTHRIFEWADGGTPNMILDDGGDATLLLHLGAKAEQDASVIAKPGSEEETFLFAAIKEKLAKDATFYSRNLDAIKGVTEETTTGVHRLYQMAQRGELRFPAINVNDSVTKSKFDNLYGCRESLVDGIKRATDVMIAGKVAVVAGYGDVGKGSAQALRALSAQVWVTEIDPICALQAAMEGYRVVTMDYAAEHGDIFVTCTGNYHVITHDHMAKMKDQAIVCNIGHFDNEIDIASVEQYQWEEIKPQVDHVIFPDGKKIIILAKGRLVNLGCATGHPSYVMSSSFANQTIAQIELWTEAQKGSSKYPVGVYTLPKHLDEKVARLQLKKLNAQLTVLTDKQAAYIGVSKEGPYKADHYRY
>NZ_CP015850.1|WP_011000059.1|3737878_3738220_+|phage-holin-family-protein
MRLLAVWVINALALLLVAYLLNGIHVNGFTSALIAALVLGLVNTLIRPILVILTLPVTVLTLGLFIFVINALLFMFVGNVLAGFHVASFGAALLGSVLYSVISWLLSSLLLRD
>NZ_CP015850.1|WP_011000058.1|3738233_3739064_+|methylenetetrahydrofolate-reductase-[NAD(P)H]
MQDRQFSFEFFPPKTAEGAEKLRNTRAQLSPLKPRFISVTFGAGGTTQQGTLDAVVEIQREGIEAAPHLSCVGSSRESIRAILDTYREHGIRRIVALRGDMPSGMGEIGEFRFANELVEFIRKEMNDTFHIEVAAYPEYHPQARSSRQDLENFARKVKAGANSAITQYFFNADAYFQFVDDARKLGVDVPIVPGIMPITNSSQLMRFSEMCGAEIPRWIAKRLESFGDDRESIRAFGLDVVTALCDRLLAGGAPGLHFYTLNAAAATRAIWQRLGL
>NZ_CP015850.1|WP_011000057.1|3739072_3739531_+|TfoX/Sxy-family-protein
MATAPDPLIAWLLDELQPLAAQIGEIRARRMFGGAGLYHDDIVFALVIRGTCYLRVDDATRARFAAEGGTPFQYEREGRTITMTGYLSTPADALDGGQPLRDWVRLAIEAARRAANAKAARPKRAPAKSAAAGQAGAQKKAPARKTTARAKR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP015850_2	2.1\|3729977\|35\|NZ_CP015850\|CRT	3729977-3730011	35	NZ_CP015850.1	3728636-3728670	0	1.0
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP015850.1	3728801-3728832	1	0.969
NZ_CP015850_2	2.2\|3730031\|35\|NZ_CP015850\|CRT	3730031-3730065	35	NZ_CP015850.1	3728690-3728724	2	0.943
NZ_CP015850_2	2.3\|3730085\|38\|NZ_CP015850\|CRT	3730085-3730122	38	NZ_CP015850.1	3729413-3729450	2	0.947

1. spacer 2.1|3729977|35|NZ_CP015850|CRT matches to position: 3728636-3728670, mismatch: 0, identity: 1.0

accatcaacggctggcagggcgacgatatcctcat	CRISPR spacer
accatcaacggctggcagggcgacgatatcctcat	Protospacer
***********************************

2. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to position: 3728801-3728832, mismatch: 1, identity: 0.969

accatctccgccgacagcggcaccacctccac	CRISPR spacer
accatctccgctgacagcggcaccacctccac	Protospacer
***********.********************

3. spacer 2.2|3730031|35|NZ_CP015850|CRT matches to position: 3728690-3728724, mismatch: 2, identity: 0.943

accctagtcgccaatggcggtaacgaccaacttta	CRISPR spacer
accctagtcgccaacggcggtaacgaccagcttta	Protospacer
**************.**************.*****

4. spacer 2.3|3730085|38|NZ_CP015850|CRT matches to position: 3729413-3729450, mismatch: 2, identity: 0.947

tccctgcgcatcaacgacaacgccaccgcctctgtcga	CRISPR spacer
tccctgcgcatcaacaacaacgccaccgcctctgccga	Protospacer
***************.******************.***

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP015850_1	1.1\|2244595\|57\|NZ_CP015850\|CRISPRCasFinder	2244595-2244651	57	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1200220-1200276	0	1.0
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	171477-171508	5	0.844
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	2016115-2016146	7	0.781
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP015867	Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence	294232-294263	7	0.781
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	AP021850	Deinococcus grandis ATCC 43672 plasmid: pDEGR-1 DNA, complete genome	347010-347041	7	0.781
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	628735-628766	7	0.781
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NC_007959	Nitrobacter hamburgensis X14 plasmid 1, complete sequence	263925-263956	7	0.781
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NC_007959	Nitrobacter hamburgensis X14 plasmid 1, complete sequence	270844-270875	7	0.781
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP054841	Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence	382989-383020	8	0.75
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP020371	Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence	118315-118346	8	0.75
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	JX042579	Mycobacterium virus MacnCheese, complete genome	1170-1201	8	0.75
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP014073	Klebsiella quasipneumoniae strain FDAARGOS_93 plasmid unnamed2, complete sequence	120464-120495	8	0.75
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP029448	Serratia marcescens strain CAV1761 plasmid pCAV1761-205, complete sequence	186257-186288	8	0.75
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP031811	Klebsiella pneumoniae strain INF014-sc-2279884 plasmid unnamed1, complete sequence	158787-158818	8	0.75
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	MN310379	Klebsiella quasipneumoniae strain A2508 plasmid pA2508-NR, complete sequence	179268-179299	8	0.75
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	MN310380	Raoultella ornithinolytica strain 170602815 plasmid p602815-NR, complete sequence	152399-152430	8	0.75
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP009275	Klebsiella variicola strain DX120E plasmid pKV1, complete sequence	64724-64755	8	0.75
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP029598	Klebsiella quasipneumoniae subsp. similipneumoniae strain ATCC 700603 plasmid pDA33145-152, complete sequence	149614-149645	8	0.75
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP038276	Raoultella ornithinolytica strain WLK218 plasmid pWLK-107717, complete sequence	25590-25621	8	0.75
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	638322-638353	8	0.75
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP011641	Serratia marcescens strain CAV1492 plasmid pCAV1492-199, complete sequence	128680-128711	8	0.75
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP024510	Klebsiella pneumoniae strain KSB2_1B plasmid unnamed4, complete sequence	48060-48091	8	0.75
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP014697	Klebsiella quasipneumoniae strain ATCC 700603 isolate K6 plasmid pKQPS1, complete sequence	40793-40824	8	0.75
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP018361	Klebsiella oxytoca strain CAV1752 plasmid pCAV1752-278, complete sequence	255316-255347	8	0.75
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP013986	Klebsiella variicola strain LMG 23571 plasmid unnamed, complete sequence	14472-14503	8	0.75
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP035211	Klebsiella pneumoniae strain TH164 plasmid pTH164-2, complete sequence	124635-124666	8	0.75
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP024543	Klebsiella pneumoniae strain INF042 plasmid unnamed1, complete sequence	58171-58202	8	0.75
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP045691	Klebsiella pneumoniae strain TK421 plasmid pTK421_1, complete sequence	68892-68923	8	0.75
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_LT882698	Klebsiella pneumoniae strain Klebsiella pneumoniae KLPN57 isolate KLPN57 plasmid I, complete sequence	259691-259722	8	0.75
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP032357	Klebsiella variicola strain 15WZ-82 plasmid p15WZ-82_res, complete sequence	170248-170279	8	0.75
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_MG462728	Escherichia coli strain AMA1416 plasmid pAMA1416, complete sequence	179386-179417	8	0.75
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP054255	Klebsiella variicola strain FH-1 plasmid unnamed, complete sequence	95222-95253	8	0.75
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	MK524488	Mycobacterium phage Patt, complete genome	25089-25120	9	0.719
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP049029	Fluviibacterium aquatile strain SC52 plasmid pSC52_1, complete sequence	340918-340949	9	0.719
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	528488-528519	9	0.719
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	518076-518107	9	0.719
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NC_012523	Rhodococcus opacus B4 plasmid pKNR, complete sequence	24899-24930	9	0.719
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4233193-4233224	9	0.719
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	483407-483438	9	0.719
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP024936	Paraburkholderia graminis strain PHS1 plasmid pPHS1_P, complete sequence	419996-420027	9	0.719
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	528525-528556	9	0.719
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	528525-528556	9	0.719
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	528517-528548	9	0.719
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	419523-419554	10	0.688
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	705655-705686	10	0.688
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	1234106-1234137	10	0.688
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	898267-898298	10	0.688
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	KY783914	Mycobacterium phage GardenSalsa, complete genome	17575-17606	10	0.688
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	MT658802	Mycobacterium phage Aziz, complete genome	17602-17633	10	0.688
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	MF319184	Mycobacterium phage GenevaB15, complete genome	17602-17633	10	0.688
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	KY223999	Mycobacterium phage MrMagoo, complete genome	17575-17606	10	0.688
NZ_CP015850_2	2.4\|3730142\|32\|NZ_CP015850\|CRT	3730142-3730173	32	NC_015724	Cupriavidus necator N-1 plasmid pBB2, complete sequence	277342-277373	10	0.688

1. spacer 1.1|2244595|57|NZ_CP015850|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 0, identity: 1.0

tgggaagcgctgttggcggcgcgcccggacggggcgccctgctccggcagcggaggc	CRISPR spacer
tgggaagcgctgttggcggcgcgcccggacggggcgccctgctccggcagcggaggc	Protospacer
*********************************************************

2. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.844

accatctccgccgacagcggcaccacctccac	CRISPR spacer
accatctccgccgaccgcggcagcaccagcgc	Protospacer
*************** ****** ****  *.*

3. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 7, identity: 0.781

accatctccgccgacagcggcaccacctccac	CRISPR spacer
acgatcgccgccgacagcggcaccatccgctt	Protospacer
** *** ******************.*. * .

4. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP015867 (Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence) position: , mismatch: 7, identity: 0.781

accatctccgccgacagcggcaccacctccac	CRISPR spacer
accatctccgcggaccgcggcaccgcaagcgc	Protospacer
*********** *** ********.*   *.*

5. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to AP021850 (Deinococcus grandis ATCC 43672 plasmid: pDEGR-1 DNA, complete genome) position: , mismatch: 7, identity: 0.781

accatctccgccgacagcggcaccacctccac	CRISPR spacer
agccttctcgccgcctgcggcaccacctccac	Protospacer
* * *...***** * ****************

6. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 7, identity: 0.781

accatctccgccgacagcggcaccacc-tccac	CRISPR spacer
cgcgtctccgccgacacccgcaccaccgtgca-	Protospacer
  *.************ * ******** * **

7. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NC_007959 (Nitrobacter hamburgensis X14 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

accatctccgccgacagcggcaccacctccac	CRISPR spacer
agcagcagcgccgccagcggcaccaccgccat	Protospacer
* ** *  ***** ************* ***.

8. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NC_007959 (Nitrobacter hamburgensis X14 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

accatctccgccgacagcggcaccacctccac	CRISPR spacer
agcagcagcgccgccagcggcaccaccgccat	Protospacer
* ** *  ***** ************* ***.

9. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP054841 (Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ggcggcgccgccgacagcggcatcacctccga	Protospacer
. *. * ***************.*******.

10. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP020371 (Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
agcatctccgccaacggcggcaccaccaatgg	Protospacer
* **********.**.***********  ..

11. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to JX042579 (Mycobacterium virus MacnCheese, complete genome) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
gcggcgcccgccgacggcggcaccccctccac	Protospacer
.* .. .********.******** *******

12. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP014073 (Klebsiella quasipneumoniae strain FDAARGOS_93 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

13. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP029448 (Serratia marcescens strain CAV1761 plasmid pCAV1761-205, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

14. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP031811 (Klebsiella pneumoniae strain INF014-sc-2279884 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

15. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to MN310379 (Klebsiella quasipneumoniae strain A2508 plasmid pA2508-NR, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

16. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to MN310380 (Raoultella ornithinolytica strain 170602815 plasmid p602815-NR, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

17. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP009275 (Klebsiella variicola strain DX120E plasmid pKV1, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

18. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP029598 (Klebsiella quasipneumoniae subsp. similipneumoniae strain ATCC 700603 plasmid pDA33145-152, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

19. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP038276 (Raoultella ornithinolytica strain WLK218 plasmid pWLK-107717, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

20. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
gcgatctccgccgacttcggcaccaccgtgtc	Protospacer
.* ************  ********** .  *

21. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP011641 (Serratia marcescens strain CAV1492 plasmid pCAV1492-199, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

22. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP024510 (Klebsiella pneumoniae strain KSB2_1B plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

23. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP014697 (Klebsiella quasipneumoniae strain ATCC 700603 isolate K6 plasmid pKQPS1, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

24. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP018361 (Klebsiella oxytoca strain CAV1752 plasmid pCAV1752-278, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

25. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP013986 (Klebsiella variicola strain LMG 23571 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

26. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP035211 (Klebsiella pneumoniae strain TH164 plasmid pTH164-2, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

27. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP024543 (Klebsiella pneumoniae strain INF042 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

28. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP045691 (Klebsiella pneumoniae strain TK421 plasmid pTK421_1, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

29. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_LT882698 (Klebsiella pneumoniae strain Klebsiella pneumoniae KLPN57 isolate KLPN57 plasmid I, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

30. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP032357 (Klebsiella variicola strain 15WZ-82 plasmid p15WZ-82_res, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

31. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_MG462728 (Escherichia coli strain AMA1416 plasmid pAMA1416, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

32. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP054255 (Klebsiella variicola strain FH-1 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

33. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to MK524488 (Mycobacterium phage Patt, complete genome) position: , mismatch: 9, identity: 0.719

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ggcatctccgccgccggcggcaccacaggcgg	Protospacer
. *********** *.**********   *.

34. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP049029 (Fluviibacterium aquatile strain SC52 plasmid pSC52_1, complete sequence) position: , mismatch: 9, identity: 0.719

accatctccgccgacagcggcaccacctccac	CRISPR spacer
aatctcgccgccgacagcggccccaccagcgt	Protospacer
* . ** ************** *****  *..

35. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

accatctccgccgacagcggcaccacctccac	CRISPR spacer
gcgttgcgcgccgacagcggcaccagcaccat	Protospacer
.*  * . ***************** * ***.

36. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 9, identity: 0.719

accatctccgccgacagcggcaccacctccac	CRISPR spacer
gcgttgcgcgccgacagcggcaccagcaccat	Protospacer
.*  * . ***************** * ***.

37. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NC_012523 (Rhodococcus opacus B4 plasmid pKNR, complete sequence) position: , mismatch: 9, identity: 0.719

accatctccgccgacagcggcaccacctccac	CRISPR spacer
gagaccgccgccgacggcgccaccacctcccg	Protospacer
.  *.* ********.*** **********

38. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

accatctccgccgacagcggcaccacctccac	CRISPR spacer
cccgcctccgccgacagcgtgaccaccttgtg	Protospacer
 **..**************  *******.

39. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

accatctccgccgacagcggcaccacctccac	CRISPR spacer
gcgttgcgcgccgacagcggcaccagcaccat	Protospacer
.*  * . ***************** * ***.

40. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP024936 (Paraburkholderia graminis strain PHS1 plasmid pPHS1_P, complete sequence) position: , mismatch: 9, identity: 0.719

accatctccgccgacagcggcaccacctccac	CRISPR spacer
acgatctccgccgacaccggcacgtcgagatc	Protospacer
** ************* ******  *     *

41. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

accatctccgccgacagcggcaccacctccac	CRISPR spacer
gcgttgcgcgccgacagcggcaccagcaccat	Protospacer
.*  * . ***************** * ***.

42. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

accatctccgccgacagcggcaccacctccac	CRISPR spacer
gcgttgcgcgccgacagcggcaccagcaccat	Protospacer
.*  * . ***************** * ***.

43. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

accatctccgccgacagcggcaccacctccac	CRISPR spacer
gcgttgcgcgccgacagcggcaccagcaccat	Protospacer
.*  * . ***************** * ***.

44. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 10, identity: 0.688

accatctccgccgacagcggcaccacctccac	CRISPR spacer
acctgctccgccgacagcggcacgcgggcgga	Protospacer
***  ******************     * .

45. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 10, identity: 0.688

accatctccgccgacagcggcaccacctccac	CRISPR spacer
acctgctccgccgacagcggcacgcgggcgga	Protospacer
***  ******************     * .

46. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 10, identity: 0.688

accatctccgccgacagcggcaccacctccac	CRISPR spacer
acctgctccgccgacagcggcacgcgggcgga	Protospacer
***  ******************     * .

47. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 10, identity: 0.688

accatctccgccgacagcggcaccacctccac	CRISPR spacer
acctgctccgccgacagcggcacgcgggcgga	Protospacer
***  ******************     * .

48. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to KY783914 (Mycobacterium phage GardenSalsa, complete genome) position: , mismatch: 10, identity: 0.688

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ggcatcgccgccgacagcgccaccactagtca	Protospacer
. **** ************ ******.  .

49. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to MT658802 (Mycobacterium phage Aziz, complete genome) position: , mismatch: 10, identity: 0.688

accatctccgccgacagcggcaccacctccac	CRISPR spacer
gacatcgccgccgacagcgccaccactagtca	Protospacer
. **** ************ ******.  .

50. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to MF319184 (Mycobacterium phage GenevaB15, complete genome) position: , mismatch: 10, identity: 0.688

accatctccgccgacagcggcaccacctccac	CRISPR spacer
gacatcgccgccgacagcgccaccactagtca	Protospacer
. **** ************ ******.  .

51. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to KY223999 (Mycobacterium phage MrMagoo, complete genome) position: , mismatch: 10, identity: 0.688

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ggcatcgccgccgacagcgccaccactagtca	Protospacer
. **** ************ ******.  .

52. spacer 2.4|3730142|32|NZ_CP015850|CRT matches to NC_015724 (Cupriavidus necator N-1 plasmid pBB2, complete sequence) position: , mismatch: 10, identity: 0.688

accatctccgccgacagcggcaccacctccac	CRISPR spacer
gtgttctccggcgccagcggcaccaccgagcc	Protospacer
..  ****** ** *************    *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

222325 : 289512

Acidithiobacillus_phage(43.59%)

head,tail,transposase,portal,capsid,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023470373.1\|222325_223309_-	ATP-binding protein	R4TQL5	Phaeocystis_globosa_virus	5.1e-15	27.7
WP_021154669.1\|224065_226303_-	hypothetical protein	K4I1D0	Acidithiobacillus_phage	1.5e-288	66.0
WP_021154670.1\|226352_226814_-	helix-turn-helix domain-containing protein	K4ICM4	Acidithiobacillus_phage	2.0e-46	64.1
WP_089190378.1\|227043_227307_+	DNA-binding protein	K4I3X3	Acidithiobacillus_phage	5.3e-20	69.3
WP_021154671.1\|227317_227800_+	hypothetical protein	K4HZ96	Acidithiobacillus_phage	1.4e-45	58.8
WP_139233340.1\|227796_228348_+	HNH endonuclease	A0A172JFU7	Citrobacter_phage	2.2e-23	39.2
WP_011003123.1\|228319_229225_+	ATP-binding protein	K4HZX9	Acidithiobacillus_phage	2.4e-104	68.2
WP_016725624.1\|229221_229869_+	hypothetical protein	K4ICM8	Acidithiobacillus_phage	7.9e-81	72.6
WP_038937632.1\|229876_230389_+	hypothetical protein	K4I3X7	Acidithiobacillus_phage	4.6e-52	66.9
WP_081282079.1\|230388_230937_+	HNH endonuclease	W6PP19	Citrobacter_phage	2.4e-22	39.9
WP_011003119.1\|230923_231682_+	hypothetical protein	K4HZA0	Acidithiobacillus_phage	1.3e-82	62.1
WP_016725627.1\|231678_231939_+	DNA-binding protein	K4I1D6	Acidithiobacillus_phage	8.4e-18	76.8
WP_064047872.1\|231935_234224_+	hypothetical protein	K4HZY1	Acidithiobacillus_phage	7.1e-286	63.4
WP_016725339.1\|234354_234819_+	hypothetical protein	K4ICN3	Acidithiobacillus_phage	1.0e-53	67.6
WP_016725629.1\|234820_235030_+	hypothetical protein	NA	NA	NA	NA
WP_011003114.1\|235022_235406_+	hypothetical protein	NA	NA	NA	NA
WP_016725341.1\|235460_235727_+	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
WP_016725630.1\|235726_236026_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_071654065.1\|235979_236195_+	hypothetical protein	NA	NA	NA	NA
WP_023470374.1\|236676_238077_+	site-specific DNA-methyltransferase	K4I3Y2	Acidithiobacillus_phage	5.0e-165	62.8
WP_020833017.1\|238073_239294_+	site-specific DNA-methyltransferase	A0A2H4JGF1	uncultured_Caudovirales_phage	1.4e-192	80.5
WP_020371857.1\|239336_239702_-	hypothetical protein	A0A2H4JI44	uncultured_Caudovirales_phage	8.5e-32	58.0
WP_016726852.1\|239926_240115_-	hypothetical protein	K4HZY7	Acidithiobacillus_phage	1.2e-13	66.0
WP_020833014.1\|240236_240752_-	DUF3489 domain-containing protein	A0A2H4JE21	uncultured_Caudovirales_phage	2.3e-22	68.7
WP_107523986.1\|240857_241196_-	hypothetical protein	NA	NA	NA	NA
WP_020833012.1\|241215_241752_+	hypothetical protein	A0A2H4JCL4	uncultured_Caudovirales_phage	5.5e-72	81.5
WP_064820674.1\|241751_243734_+\|terminase	phage terminase large subunit family protein	A0A2H4JIC6	uncultured_Caudovirales_phage	0.0e+00	85.4
WP_020833054.1\|243777_244287_+	hypothetical protein	A0A0F6WCR7	Sinorhizobium_phage	1.3e-25	45.0
WP_064820675.1\|244297_244690_+	hypothetical protein	NA	NA	NA	NA
WP_020833052.1\|244690_244912_+	hypothetical protein	A0A2H4JCJ9	uncultured_Caudovirales_phage	3.8e-11	56.2
WP_043897861.1\|244911_246480_+\|portal	phage portal protein	A0A1B2LRR5	Wolbachia_phage	4.3e-149	57.1
WP_064820676.1\|246491_247733_+	S49 family peptidase	K4HZZ6	Acidithiobacillus_phage	1.0e-60	48.9
WP_020833005.1\|247742_248120_+\|head	head decoration protein	A0A1B2LRT0	Wolbachia_phage	1.4e-24	48.8
WP_020833004.1\|248128_249133_+\|capsid	major capsid protein	A0A1B2LRS0	Wolbachia_phage	7.3e-110	67.2
WP_020833003.1\|249135_249438_+	hypothetical protein	NA	NA	NA	NA
WP_043897849.1\|249443_249890_+	hypothetical protein	NA	NA	NA	NA
WP_020833001.1\|250016_250790_+	hypothetical protein	A0A2D2W2E0	Stenotrophomonas_phage	5.2e-47	43.6
WP_020833000.1\|250798_251188_+	hypothetical protein	NA	NA	NA	NA
WP_020832999.1\|251184_251406_+	hypothetical protein	NA	NA	NA	NA
WP_020832998.1\|251380_252025_+	hypothetical protein	NA	NA	NA	NA
WP_016723655.1\|252067_252358_-	H-NS histone family protein	NA	NA	NA	NA
WP_020832996.1\|252543_254010_-	type III secretion system YopJ family effector PopP2	NA	NA	NA	NA
WP_023470090.1\|254619_255747_+	DNA cytosine methyltransferase	Q6J1P4	Burkholderia_virus	1.1e-98	53.5
WP_064820677.1\|255812_259916_+\|tail	phage tail tape measure protein	A0A0P0ZCJ4	Stx2-converting_phage	1.3e-24	27.5
WP_020832994.1\|259921_260317_+	hypothetical protein	A0A0M4UTA7	Ralstonia_phage	1.6e-31	52.3
WP_064820678.1\|260317_263908_+	hypothetical protein	A0A0M4U447	Ralstonia_phage	0.0e+00	53.3
WP_020832992.1\|263919_265086_+	hypothetical protein	NA	NA	NA	NA
WP_043885695.1\|265089_265572_+	hypothetical protein	A0A0M4TU90	Ralstonia_phage	1.5e-12	42.7
WP_043885696.1\|265568_265967_+	hypothetical protein	NA	NA	NA	NA
WP_020832989.1\|265971_267816_+	hypothetical protein	A0A0M4UKC5	Ralstonia_phage	8.2e-107	46.0
WP_020832988.1\|267825_268050_+	hypothetical protein	NA	NA	NA	NA
WP_003270772.1\|268117_268408_+	membrane protein	K4I011	Acidithiobacillus_phage	3.1e-13	47.6
WP_020832987.1\|268404_268881_+	hypothetical protein	K4ICR8	Acidithiobacillus_phage	1.4e-71	85.9
WP_043897848.1\|268877_269339_+	lysozyme	K4I410	Acidithiobacillus_phage	7.8e-67	83.0
WP_020832985.1\|269406_269706_+	hypothetical protein	NA	NA	NA	NA
WP_043885536.1\|269768_270107_-	DUF1484 domain-containing protein	NA	NA	NA	NA
WP_021156218.1\|270559_271507_-	hypothetical protein	NA	NA	NA	NA
WP_064820679.1\|271884_282228_+	hemagglutinin repeat-containing protein	A0A0R6PJK4	Moraxella_phage	5.4e-30	32.0
WP_080624812.1\|282233_282854_+	hypothetical protein	NA	NA	NA	NA
WP_020832979.1\|283091_284786_+	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_043885817.1\|284817_285900_+	hypothetical protein	A0A1V0SHS2	Klosneuvirus	1.2e-20	22.3
WP_020832977.1\|286072_286414_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_020832976.1\|286424_286700_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_043897847.1\|287240_287741_+	hypothetical protein	NA	NA	NA	NA
WP_020830181.1\|288204_289512_-\|transposase	IS4 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

348777 : 436208

Ralstonia_virus(58.0%)

head,tail,holin,integrase,transposase,portal,capsid,plate,terminase

attL 391338:391383|attR 430312:430357

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086005428.1\|348777_350143_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.1e-75	53.8
WP_020832940.1\|350350_353914_-	indolepyruvate ferredoxin oxidoreductase family protein	NA	NA	NA	NA
WP_020832939.1\|354199_354430_-	hypothetical protein	NA	NA	NA	NA
WP_020832938.1\|354549_355233_-	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_020832937.1\|355329_356796_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_020371584.1\|356956_358243_-	hypothetical protein	NA	NA	NA	NA
WP_020832936.1\|358318_359602_-	hypothetical protein	NA	NA	NA	NA
WP_011003007.1\|359909_361121_-	type II secretion system inner membrane protein GspF	NA	NA	NA	NA
WP_043897948.1\|361122_362679_-	type II secretion system ATPase GspE	NA	NA	NA	NA
WP_020832934.1\|362713_365131_-	type II secretion system secretin GspD	NA	NA	NA	NA
WP_020832933.1\|365164_366022_-	type II secretion system protein N	NA	NA	NA	NA
WP_011003003.1\|366025_366604_-	type II secretion system protein M	NA	NA	NA	NA
WP_020832932.1\|366615_368046_-	type II secretion system protein GspL	NA	NA	NA	NA
WP_043897839.1\|368187_369237_-	type II secretion system minor pseudopilin GspK	NA	NA	NA	NA
WP_019718951.1\|369238_369961_-	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
WP_011002999.1\|369941_370349_-	type II secretion system minor pseudopilin GspI	NA	NA	NA	NA
WP_011002998.1\|370345_370843_-	GspH/FimT family pseudopilin	NA	NA	NA	NA
WP_162903504.1\|370879_371347_-	type II secretion system major pseudopilin GspG	NA	NA	NA	NA
WP_020832927.1\|371522_372209_+	general secretion pathway protein GspC	NA	NA	NA	NA
WP_011002995.1\|372341_372926_+	EF-hand domain-containing protein	NA	NA	NA	NA
WP_020371910.1\|373016_374120_-	4-hydroxyphenylpyruvate dioxygenase	NA	NA	NA	NA
WP_011002993.1\|374280_374769_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_020832924.1\|377148_377544_-	SgcJ/EcaC family oxidoreductase	NA	NA	NA	NA
WP_011002990.1\|377673_378162_-	cupin domain-containing protein	NA	NA	NA	NA
WP_011002989.1\|378380_379076_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_020425264.1\|379476_380025_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_020832923.1\|380058_381957_+	glutathione-regulated potassium-efflux system protein KefC	NA	NA	NA	NA
WP_155738994.1\|381978_382767_-	cellulose 1,4-beta-cellobiosidase	NA	NA	NA	NA
WP_020832921.1\|382949_383744_-	DUF1835 domain-containing protein	NA	NA	NA	NA
WP_011002984.1\|383941_385252_+	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_011002983.1\|385424_385703_-	hypothetical protein	NA	NA	NA	NA
WP_011002982.1\|386192_387323_+	porin	NA	NA	NA	NA
WP_043897838.1\|387453_388485_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_011002980.1\|388488_389193_-	two-component system response regulator KdpE	NA	NA	NA	NA
WP_011002979.1\|389275_389587_-	high-potential iron-sulfur protein	NA	NA	NA	NA
WP_011002978.1\|390357_390696_+	DUF1484 domain-containing protein	NA	NA	NA	NA
391338:391383	attL	NA	NA	NA	NA
WP_016725467.1\|391790_392654_+	sensor histidine kinase	NA	NA	NA	NA
WP_080606484.1\|392634_392943_+	STAS-like domain-containing protein	NA	NA	NA	NA
WP_020832917.1\|393472_393883_+	PAAR domain-containing protein	A4PE23	Ralstonia_virus	2.0e-66	99.2
WP_015985084.1\|393884_394388_+	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	5.3e-93	100.0
WP_139274289.1\|394397_395330_+	hypothetical protein	A4PE25	Ralstonia_virus	1.9e-160	96.1
WP_016727328.1\|395326_396055_+	immunity 52 family protein	A4PE26	Ralstonia_virus	2.6e-141	100.0
WP_020832912.1\|396039_397146_-\|portal	phage portal protein	A4PE27	Ralstonia_virus	1.7e-213	98.1
WP_020832911.1\|397142_398924_-\|terminase	terminase ATPase subunit family protein	A0A077K8Q7	Ralstonia_phage	0.0e+00	97.3
WP_043897836.1\|399065_399911_+\|capsid	GPO family capsid scaffolding protein	A4PE29	Ralstonia_virus	1.3e-147	95.7
WP_011001874.1\|399964_400981_+\|capsid	phage major capsid protein, P2 family	A0A077KEQ8	Ralstonia_phage	4.7e-189	100.0
WP_020832909.1\|400977_401700_+\|terminase	terminase endonuclease subunit	A0A077K804	Ralstonia_phage	3.6e-127	100.0
WP_043897946.1\|401796_402276_+\|head	head completion/stabilization protein	A4PE32	Ralstonia_virus	4.3e-84	98.1
WP_011001871.1\|402275_402482_+\|tail	tail protein X	A0A077K8R0	Ralstonia_phage	1.8e-31	100.0
WP_015985092.1\|402497_402902_+\|holin	phage holin family protein	A0A077K9X1	Ralstonia_phage	2.8e-28	100.0
WP_020832906.1\|402898_403210_+\|holin	phage holin family protein	A0A077KER0	Ralstonia_phage	5.9e-50	100.0
WP_016727332.1\|403206_404013_+	DUF3380 domain-containing protein	A4PE36	Ralstonia_virus	4.2e-148	99.6
WP_016727333.1\|404009_404510_+	hypothetical protein	A4PE37	Ralstonia_virus	4.2e-82	99.4
WP_020832903.1\|404506_404941_+\|tail	phage tail protein	A0A077K8R3	Ralstonia_phage	4.9e-79	99.3
WP_016727335.1\|404937_405384_+	phage virion morphogenesis protein	A0A077K9X5	Ralstonia_phage	5.8e-67	90.5
WP_016723619.1\|405535_406501_-\|transposase	IS5-like element IS1405 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0
WP_080624834.1\|406567_406873_-	DUF3892 domain-containing protein	NA	NA	NA	NA
WP_016727336.1\|407118_407736_+\|plate	phage baseplate assembly protein V	A4PE41	Ralstonia_virus	1.2e-107	93.7
WP_016727337.1\|407732_408080_+	GPW/gp25 family protein	A4PE42	Ralstonia_virus	2.9e-58	98.3
WP_020832898.1\|408082_408991_+\|plate	baseplate assembly protein	A0A077K9X9	Ralstonia_phage	3.2e-157	96.4
WP_020832897.1\|408983_409601_+\|tail	phage tail protein I	A0A077KER5	Ralstonia_phage	4.2e-100	95.1
WP_020832896.1\|409607_411272_+\|tail	phage tail protein	A0A077K818	Ralstonia_phage	1.3e-308	96.2
WP_020832895.1\|411284_412037_+	hypothetical protein	A0A077K9S5	Ralstonia_phage	4.9e-127	94.4
WP_043897835.1\|412033_412498_+	hypothetical protein	A0A077K8R9	Ralstonia_phage	2.6e-78	90.3
WP_016727343.1\|412596_413772_+\|tail	phage tail sheath protein	A0A077K9Y4	Ralstonia_phage	9.5e-218	95.4
WP_016727344.1\|413803_414313_+\|tail	phage major tail tube protein	A0A077KER7	Ralstonia_phage	5.4e-93	99.4
WP_020371913.1\|414358_414715_+\|tail	phage tail assembly protein	A4PE51	Ralstonia_virus	9.1e-55	98.3
WP_003267618.1\|414711_414813_+\|tail	GpE family phage tail protein	A0A077K821	Ralstonia_phage	2.7e-09	93.9
WP_020832890.1\|414809_417473_+\|tail	phage tail length tape measure protein	A4PE52	Ralstonia_virus	0.0e+00	94.7
WP_016727346.1\|417475_417898_+\|tail	phage tail protein	A4PE53	Ralstonia_virus	1.5e-72	97.1
WP_020832888.1\|417894_419019_+	phage late control D family protein	A4PE54	Ralstonia_virus	9.8e-204	96.8
WP_071615623.1\|419331_419541_+	Com family DNA-binding transcriptional regulator	A0A1S5NPS9	Burkholderia_phage	2.4e-15	70.4
WP_020832887.1\|419491_420274_+	site-specific DNA-methyltransferase	A0A1S5NPU0	Burkholderia_phage	7.0e-92	65.6
WP_038938419.1\|420189_420936_-	hypothetical protein	A4PE55	Ralstonia_virus	1.2e-120	92.3
WP_016727351.1\|421094_421517_-	helix-turn-helix domain-containing protein	A4PE57	Ralstonia_virus	6.7e-73	100.0
WP_071615658.1\|421592_421793_+	hypothetical protein	NA	NA	NA	NA
WP_016727352.1\|421812_422004_+	hypothetical protein	E5E3U0	Burkholderia_phage	3.4e-08	50.9
WP_015985115.1\|422032_422227_+	hypothetical protein	A4PE59	Ralstonia_virus	1.8e-25	100.0
WP_015985116.1\|422223_422472_+	ogr/Delta-like zinc finger family protein	A4PE60	Ralstonia_virus	1.0e-41	100.0
WP_015985117.1\|422586_423141_+	Bro-N domain-containing protein	A4PE61	Ralstonia_virus	1.2e-98	100.0
WP_015985118.1\|423150_423384_+	hypothetical protein	A4PE62	Ralstonia_virus	1.5e-34	100.0
WP_015985119.1\|423380_423545_+	hypothetical protein	A4PE63	Ralstonia_virus	7.9e-22	100.0
WP_015985120.1\|423541_423748_+	hypothetical protein	A4PE64	Ralstonia_virus	6.4e-29	100.0
WP_015985121.1\|423747_423984_+	hypothetical protein	A4PE65	Ralstonia_virus	2.1e-39	100.0
WP_015985122.1\|423976_424189_+	hypothetical protein	A4PE66	Ralstonia_virus	6.4e-32	100.0
WP_100243795.1\|424263_424740_+	hypothetical protein	A4PE67	Ralstonia_virus	1.7e-56	77.2
WP_016727356.1\|424736_425009_+	hypothetical protein	NA	NA	NA	NA
WP_016727357.1\|425005_425296_+	hypothetical protein	A4PE68	Ralstonia_virus	2.1e-49	94.8
WP_015985125.1\|425295_428100_+	toprim domain-containing protein	A4PE69	Ralstonia_virus	0.0e+00	100.0
WP_020832872.1\|428086_428260_+	hypothetical protein	NA	NA	NA	NA
WP_015985128.1\|429190_430273_+\|integrase	site-specific integrase	A4PE72	Ralstonia_virus	2.7e-211	100.0
WP_011002977.1\|430737_431622_+	cytochrome c5 family protein	NA	NA	NA	NA
430312:430357	attR	NA	NA	NA	NA
WP_011002976.1\|431796_432210_+	hypothetical protein	NA	NA	NA	NA
WP_020832869.1\|433393_434215_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_086004752.1\|434269_435071_+\|transposase	IS5-like element IS1421 family transposase	NA	NA	NA	NA
WP_020829879.1\|435206_436208_+\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

583477 : 642792

Ralstonia_phage(30.0%)

transposase,integrase,protease

attL 601318:601359|attR 642988:643029

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020831502.1\|583477_584806_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_011002844.1\|584938_586015_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.2e-29	37.1
WP_011002843.1\|586007_587819_-	iron ABC transporter permease	NA	NA	NA	NA
WP_011002842.1\|587903_589001_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_020832803.1\|589118_590621_-	sensor histidine kinase	NA	NA	NA	NA
WP_011002840.1\|590617_591325_-	response regulator	NA	NA	NA	NA
WP_043897942.1\|591419_592562_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011002838.1\|592897_594037_+	porin	NA	NA	NA	NA
WP_011002837.1\|594495_595707_-	Do family serine endopeptidase	A0A1B1IRD3	uncultured_Mediterranean_phage	1.2e-10	33.6
WP_011002836.1\|595726_596473_+	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
WP_003263430.1\|596486_596912_-	large conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
WP_011002835.1\|597157_597766_+	ubiquinol-cytochrome c reductase iron-sulfur subunit	NA	NA	NA	NA
WP_020832800.1\|597768_599172_+	cytochrome bc complex cytochrome b subunit	NA	NA	NA	NA
WP_011002833.1\|599198_599945_+	cytochrome c1	NA	NA	NA	NA
WP_011002832.1\|600092_600704_+	glutathione S-transferase N-terminal domain-containing protein	NA	NA	NA	NA
WP_011002831.1\|600762_601260_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	8.6e-19	47.6
601318:601359	attL	NA	NA	NA	NA
WP_043897832.1\|601518_602466_+	hypothetical protein	NA	NA	NA	NA
WP_020832799.1\|602636_603017_+	hypothetical protein	NA	NA	NA	NA
WP_020832798.1\|603013_603484_+	hypothetical protein	NA	NA	NA	NA
WP_144061906.1\|603493_603931_+	hypothetical protein	NA	NA	NA	NA
WP_144061905.1\|603945_604260_+	hypothetical protein	NA	NA	NA	NA
WP_144061920.1\|604295_605639_+	DUF3987 domain-containing protein	NA	NA	NA	NA
WP_144061904.1\|605737_606997_+	inovirus Gp2 family protein	NA	NA	NA	NA
WP_020832793.1\|608321_609938_+	hypothetical protein	NA	NA	NA	NA
WP_081282082.1\|610082_610370_+	H-NS histone family protein	NA	NA	NA	NA
WP_043897828.1\|610409_610784_+	hypothetical protein	NA	NA	NA	NA
WP_020832791.1\|610904_611192_-	H-NS histone family protein	NA	NA	NA	NA
WP_185762074.1\|611268_612138_-	hypothetical protein	NA	NA	NA	NA
WP_020832790.1\|612134_613838_-	ATP-binding protein	NA	NA	NA	NA
WP_086005436.1\|614359_614692_+	hypothetical protein	NA	NA	NA	NA
WP_016721735.1\|615075_616041_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.6e-178	98.1
WP_155738951.1\|616037_616187_+	hypothetical protein	NA	NA	NA	NA
WP_043897827.1\|617002_618001_+	YqaJ viral recombinase family protein	A6XMH8	Bacillus_virus	3.7e-53	40.1
WP_043897826.1\|618013_618931_+	hypothetical protein	NA	NA	NA	NA
WP_081282084.1\|618927_619914_+	hypothetical protein	NA	NA	NA	NA
WP_144061919.1\|620021_620255_+	hypothetical protein	A0A1X9SH96	Bradyrhizobium_phage	1.7e-06	44.3
WP_043897652.1\|620314_621520_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_081282085.1\|622005_622656_+	hypothetical protein	NA	NA	NA	NA
WP_144061903.1\|622795_624193_+	ATP-binding protein	Q8W6N3	Burkholderia_virus	5.4e-119	47.1
WP_043897824.1\|625078_625381_+	hypothetical protein	NA	NA	NA	NA
WP_020832781.1\|625384_625642_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_043897823.1\|625708_626086_+	hypothetical protein	NA	NA	NA	NA
WP_144061902.1\|626189_628010_+	hypothetical protein	A0A1L7N0M1	Ralstonia_phage	2.0e-28	26.3
WP_020832778.1\|628181_629231_+	toxin-antitoxin system YwqK family antitoxin	NA	NA	NA	NA
WP_043897822.1\|629631_630033_+	hypothetical protein	NA	NA	NA	NA
WP_016721870.1\|630076_631063_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_043897820.1\|631496_632144_+	hypothetical protein	NA	NA	NA	NA
WP_043897819.1\|634422_637182_+	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_081282086.1\|637270_637714_+	hypothetical protein	NA	NA	NA	NA
WP_043897818.1\|637985_638804_+	DcrB-related protein	NA	NA	NA	NA
WP_081282087.1\|640051_640447_+	hypothetical protein	NA	NA	NA	NA
WP_020832774.1\|640433_640682_+	hypothetical protein	NA	NA	NA	NA
WP_043897817.1\|640695_641262_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	NA	NA	NA	NA
WP_020832773.1\|641388_642792_-\|integrase	tyrosine-type recombinase/integrase	A0A221SAN4	Ralstonia_phage	1.0e-08	22.3
642988:643029	attR	NA	NA	NA	NA

DBSCAN-SWA_4

872564 : 914944

uncultured_Mediterranean_phage(42.86%)

tRNA,transposase,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011002630.1\|872564_873677_+\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_028853617.1\|873765_875364_+	FMN-binding glutamate synthase family protein	NA	NA	NA	NA
WP_016723723.1\|875389_875998_-	glutathione S-transferase	NA	NA	NA	NA
WP_011002627.1\|876231_877605_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	3.8e-109	47.0
WP_020832660.1\|877851_878436_+	cytochrome b	NA	NA	NA	NA
WP_016723720.1\|878536_879103_+	polyisoprenoid-binding protein	NA	NA	NA	NA
WP_019718267.1\|879160_879757_+	polyisoprenoid-binding protein	NA	NA	NA	NA
WP_020831502.1\|879890_881219_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_016723719.1\|881278_882247_-	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	8.8e-44	37.7
WP_011002622.1\|882324_884205_-	protein translocase subunit SecD	NA	NA	NA	NA
WP_063612207.1\|884326_884659_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	4.0e-12	40.2
WP_016723717.1\|884767_885919_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	9.4e-77	42.1
WP_177220763.1\|885912_886983_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_020832656.1\|887077_889270_+	ATP-dependent DNA helicase RecG	NA	NA	NA	NA
WP_016723714.1\|889288_889492_-	hypothetical protein	NA	NA	NA	NA
WP_011002617.1\|889503_889944_-	hypothetical protein	NA	NA	NA	NA
WP_081263796.1\|890167_890347_-	hypothetical protein	NA	NA	NA	NA
WP_020832653.1\|890490_891621_-	DSD1 family PLP-dependent enzyme	NA	NA	NA	NA
WP_043897937.1\|891763_892705_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_020832651.1\|892895_894119_-	diaminopropionate ammonia-lyase	NA	NA	NA	NA
WP_020832650.1\|894163_895450_-	Zn-dependent hydrolase	NA	NA	NA	NA
WP_020832649.1\|895815_896277_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_020832648.1\|896487_897684_-	amidohydrolase	NA	NA	NA	NA
WP_016721870.1\|898154_899141_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_016723702.1\|899397_899715_-	hypothetical protein	NA	NA	NA	NA
WP_173940760.1\|899765_899975_+	hypothetical protein	NA	NA	NA	NA
WP_028853600.1\|900506_900761_-	hypothetical protein	NA	NA	NA	NA
WP_081263795.1\|901530_901695_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	3.2e-07	57.1
WP_011002610.1\|902137_902464_+	hypothetical protein	NA	NA	NA	NA
WP_020832643.1\|902557_902842_+	hypothetical protein	NA	NA	NA	NA
WP_020832642.1\|903925_904063_+	hypothetical protein	NA	NA	NA	NA
WP_011002608.1\|904181_904499_+	hypothetical protein	NA	NA	NA	NA
WP_011002607.1\|904649_904946_+	hypothetical protein	NA	NA	NA	NA
WP_028853597.1\|905042_905903_+	transglutaminase family protein	NA	NA	NA	NA
WP_016723696.1\|905919_906180_-	hypothetical protein	NA	NA	NA	NA
WP_011002605.1\|907525_908029_+\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_011002604.1\|908078_908582_+\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_020832639.1\|908700_909420_+	molecular chaperone	NA	NA	NA	NA
WP_020832638.1\|909469_911734_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_172833515.1\|911751_912240_+\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_043897800.1\|912309_912852_+	hypothetical protein	NA	NA	NA	NA
WP_016721870.1\|913957_914944_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7

DBSCAN-SWA_5

986482 : 996621

Hokovirus(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021155204.1\|986482_988444_+	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	1.4e-149	50.8
WP_011002544.1\|988578_989721_+	molecular chaperone DnaJ	A0A0P0YMJ9	Yellowstone_lake_phycodnavirus	2.9e-22	32.7
WP_020832589.1\|989756_991637_+	bifunctional anthranilate synthase component I family protein/class IV aminotransferase	A0A0B5J984	Pandoravirus	2.7e-57	37.4
WP_011002542.1\|991592_992279_-	energy-coupling factor ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	1.5e-13	27.2
WP_020832588.1\|992286_992994_-	ABC transporter permease	NA	NA	NA	NA
WP_016724069.1\|993005_993830_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	2.4e-34	31.3
WP_016724070.1\|993886_994531_-	deoxynucleoside kinase	M1IA15	Paramecium_bursaria_Chlorella_virus	8.3e-06	27.3
WP_003271964.1\|994564_995074_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_020832586.1\|995073_996621_-	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	3.6e-23	33.6

DBSCAN-SWA_6

1086790 : 1096074

Phage_21(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016725925.1\|1086790_1088041_+	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	7.4e-11	61.1
WP_016724132.1\|1088267_1088480_+	hypothetical protein	NA	NA	NA	NA
WP_011002384.1\|1088668_1089289_-	DUF4126 domain-containing protein	NA	NA	NA	NA
WP_011002383.1\|1089938_1090142_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.7e-21	75.8
WP_011002382.1\|1090695_1091022_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	7.9e-13	37.4
WP_011002381.1\|1091018_1093307_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	7.1e-169	42.3
WP_011002380.1\|1093376_1093823_-	dUTP diphosphatase	Q2NP83	Xanthomonas_phage	5.1e-47	63.7
WP_020832525.1\|1093819_1094872_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_020832524.1\|1094868_1096074_-	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	3.4e-37	33.6

DBSCAN-SWA_7

1700346 : 1752537

Bacillus_phage(16.67%)

transposase,integrase,protease

attL 1703087:1703103|attR 1751672:1751688

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011001473.1\|1700346_1702233_+\|protease	ATP-dependent zinc metalloprotease FtsH	E5ESM9	Bathycoccus_sp._RCC1105_virus	1.8e-109	47.7
WP_028860554.1\|1702363_1703227_+	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	4.1e-24	34.3
1703087:1703103	attL	NA	NA	NA	NA
WP_019718670.1\|1703333_1704677_+	phosphoglucosamine mutase	NA	NA	NA	NA
WP_016727392.1\|1704862_1705894_+	phosphate ABC transporter substrate-binding protein PstS	H6WG65	Cyanophage	6.1e-51	39.7
WP_020832190.1\|1705975_1706941_+	phosphate ABC transporter permease PstC	NA	NA	NA	NA
WP_011001478.1\|1706979_1707864_+	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_028853071.1\|1707866_1708652_+	phosphate ABC transporter ATP-binding protein PstB	G9BWD6	Planktothrix_phage	3.9e-18	30.6
WP_011001480.1\|1708692_1709400_+	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_011001481.1\|1709423_1710137_+	phosphate regulon transcriptional regulator PhoB	W8CYM9	Bacillus_phage	1.8e-33	39.0
WP_011001482.1\|1710223_1711555_+	phosphate regulon sensor histidine kinase PhoR	W8CYF6	Bacillus_phage	1.2e-35	36.8
WP_019718671.1\|1711633_1713808_-	polyphosphate kinase 1	NA	NA	NA	NA
WP_016721725.1\|1713965_1715504_+	exopolyphosphatase	NA	NA	NA	NA
WP_011001485.1\|1715585_1716422_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_011001486.1\|1716556_1717030_-	phosphohistidine phosphatase SixA	NA	NA	NA	NA
WP_020832186.1\|1717586_1718759_-	acyltransferase	A0A141GEY8	Brucella_phage	1.0e-17	27.7
WP_020832184.1\|1718999_1719821_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_043897752.1\|1719824_1721090_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_016721730.1\|1721212_1721578_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011001491.1\|1721669_1722530_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_020832183.1\|1722535_1724866_-	EAL domain-containing protein	G3MA91	Bacillus_virus	5.8e-17	35.4
WP_043897750.1\|1727521_1731577_+	Dyp-type peroxidase	NA	NA	NA	NA
WP_064820697.1\|1731665_1732394_+	YukJ family protein	NA	NA	NA	NA
WP_020830182.1\|1732902_1733727_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_173940775.1\|1733807_1734776_+	hypothetical protein	NA	NA	NA	NA
WP_020832175.1\|1734772_1735777_+	DUF1911 domain-containing protein	NA	NA	NA	NA
WP_020832174.1\|1735870_1737454_+	hypothetical protein	NA	NA	NA	NA
WP_081282089.1\|1737674_1738766_+	DUF262 domain-containing protein	A0A1V0SDN5	Indivirus	2.0e-07	30.4
WP_052328807.1\|1738768_1739275_+	hypothetical protein	NA	NA	NA	NA
WP_043897749.1\|1739583_1739817_+	hypothetical protein	NA	NA	NA	NA
WP_020832173.1\|1740094_1741651_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	7.0e-75	36.6
WP_020829705.1\|1741683_1742037_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.2e-19	46.7
WP_043885814.1\|1742033_1742516_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_144061896.1\|1742553_1743450_-	hypothetical protein	NA	NA	NA	NA
WP_020832172.1\|1744178_1745198_+\|integrase	site-specific integrase	A0A0A1I5U0	Burkholderia_phage	2.7e-51	36.0
WP_144061895.1\|1745231_1746278_-	hypothetical protein	NA	NA	NA	NA
WP_043897746.1\|1747903_1748365_+	hypothetical protein	NA	NA	NA	NA
WP_043897652.1\|1748601_1749807_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_081282090.1\|1749980_1751039_+	trypsin-like peptidase domain-containing protein	NA	NA	NA	NA
WP_020830181.1\|1751229_1752537_+\|transposase	IS4 family transposase	NA	NA	NA	NA
1751672:1751688	attR	NA	NA	NA	NA

DBSCAN-SWA_8

2080243 : 2086926

Ralstonia_phage(100.0%)

coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010889950.1\|2080243_2080675_-	DUF29 domain-containing protein	A0JC30	Ralstonia_phage	7.1e-78	100.0
WP_010889951.1\|2080716_2081343_-	hypothetical protein	A0JC29	Ralstonia_phage	6.2e-107	100.0
WP_064820707.1\|2081420_2082515_-	zonular occludens toxin	A0JC28	Ralstonia_phage	1.7e-205	99.5
WP_015984160.1\|2082511_2082787_-	DUF2523 domain-containing protein	A0JC27	Ralstonia_phage	4.3e-36	100.0
WP_015984159.1\|2082783_2084064_-	hypothetical protein	A0JC26	Ralstonia_phage	8.5e-220	100.0
WP_010889942.1\|2084143_2084479_-	hypothetical protein	A0JC24	Ralstonia_phage	1.6e-56	100.0
WP_015984157.1\|2084478_2084748_-\|coat	phage coat protein	A0JC23	Ralstonia_phage	4.9e-37	100.0
WP_010889944.1\|2084747_2085059_-	hypothetical protein	A0JC22	Ralstonia_phage	8.2e-52	100.0
WP_015984156.1\|2085063_2086191_-	replication initiation factor domain-containing protein	A0JC21	Ralstonia_phage	1.3e-219	100.0
WP_015984155.1\|2086190_2086397_-	hypothetical protein	A0JC20	Ralstonia_phage	2.8e-32	100.0
WP_064820708.1\|2086533_2086926_+	helix-turn-helix domain-containing protein	H9CWD2	Ralstonia_phage	4.3e-66	100.0

DBSCAN-SWA_9

2778426 : 2975447

165

Acidithiobacillus_phage(30.88%)

head,tail,transposase,portal,capsid,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020831502.1\|2778426_2779755_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_011000869.1\|2779889_2780792_-	cysteine synthase CysM	A0A1X9I5K7	Streptococcus_phage	8.2e-52	40.8
WP_011000868.1\|2780895_2781213_-	ComEA family DNA-binding protein	NA	NA	NA	NA
WP_020831501.1\|2781342_2782338_-	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	7.0e-28	32.3
WP_052328804.1\|2782334_2783282_-	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	9.0e-17	27.6
WP_016723343.1\|2783308_2784682_-	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	1.9e-76	38.9
WP_011000864.1\|2784741_2786019_-	lipopolysaccharide assembly protein LapB	NA	NA	NA	NA
WP_043897668.1\|2786022_2786352_-	DUF1049 domain-containing protein	NA	NA	NA	NA
WP_016723345.1\|2786537_2786960_-	integration host factor subunit beta	A7KV42	Bacillus_phage	4.7e-10	38.9
WP_011000861.1\|2786996_2788685_-	30S ribosomal protein S1	NA	NA	NA	NA
WP_011000860.1\|2788824_2789517_-	(d)CMP kinase	NA	NA	NA	NA
WP_020831497.1\|2789540_2790851_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_029240256.1\|2790872_2791769_-	prephenate dehydrogenase	NA	NA	NA	NA
WP_016723348.1\|2791865_2792990_-	histidinol-phosphate transaminase	A0A142C026	Faustovirus	1.2e-15	27.7
WP_011000856.1\|2793048_2794164_-	prephenate dehydratase	NA	NA	NA	NA
WP_011000855.1\|2794252_2795389_-	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	4.4e-87	46.6
WP_016723349.1\|2795503_2796064_-	DUF2059 domain-containing protein	NA	NA	NA	NA
WP_011000853.1\|2796190_2798848_-	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	3.0e-102	33.5
WP_011000852.1\|2799256_2799913_+	OmpA family protein	NA	NA	NA	NA
WP_020831496.1\|2800070_2800562_-	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
WP_019717804.1\|2800723_2801440_+	bifunctional 3-demethylubiquinone 3-O-methyltransferase/2-octaprenyl-6-hydroxy phenol methylase	NA	NA	NA	NA
WP_011000849.1\|2801436_2802126_+	HAD-IA family hydrolase	NA	NA	NA	NA
WP_020831495.1\|2802234_2806020_+	DUF748 domain-containing protein	NA	NA	NA	NA
WP_080624828.1\|2807835_2808150_+	hypothetical protein	NA	NA	NA	NA
WP_081282099.1\|2808615_2809056_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_064820716.1\|2809088_2810471_-	recombinase family protein	K4ICM1	Acidithiobacillus_phage	1.5e-134	59.9
WP_038938302.1\|2810467_2810965_-	DUF2924 domain-containing protein	K4I3X1	Acidithiobacillus_phage	9.2e-21	38.8
WP_020831490.1\|2811544_2812978_-	DUF746 domain-containing protein	NA	NA	NA	NA
WP_029240249.1\|2813471_2813765_+	hypothetical protein	NA	NA	NA	NA
WP_064820717.1\|2814013_2815786_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_185762069.1\|2816034_2816325_-	hypothetical protein	NA	NA	NA	NA
WP_064820719.1\|2826756_2827095_+	DUF1484 family protein	NA	NA	NA	NA
WP_081282108.1\|2827446_2827650_-	hypothetical protein	NA	NA	NA	NA
WP_064820720.1\|2828101_2828470_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_064820721.1\|2828935_2829274_+	DUF1484 domain-containing protein	NA	NA	NA	NA
WP_064820775.1\|2829336_2829636_-	hypothetical protein	NA	NA	NA	NA
WP_064820722.1\|2829703_2830165_-	lysozyme	K4I410	Acidithiobacillus_phage	8.7e-66	81.0
WP_020832987.1\|2830161_2830638_-	hypothetical protein	K4ICR8	Acidithiobacillus_phage	1.4e-71	85.9
WP_064820723.1\|2830634_2830925_-	hypothetical protein	K4I011	Acidithiobacillus_phage	4.1e-13	46.4
WP_064820724.1\|2830993_2831218_-	hypothetical protein	A0A088C533	Shewanella_sp._phage	8.3e-06	45.5
WP_064820725.1\|2831227_2833072_-	hypothetical protein	A0A0M4UKC5	Ralstonia_phage	5.3e-106	46.1
WP_064820726.1\|2833076_2833475_-	hypothetical protein	NA	NA	NA	NA
WP_043885695.1\|2833471_2833954_-	hypothetical protein	A0A0M4TU90	Ralstonia_phage	1.5e-12	42.7
WP_064820727.1\|2833957_2835124_-	hypothetical protein	A0A0M5TJJ3	Ralstonia_phage	4.6e-47	33.3
WP_064820728.1\|2835135_2838726_-	hypothetical protein	A0A0M4U447	Ralstonia_phage	0.0e+00	53.2
WP_064820729.1\|2838726_2839122_-	hypothetical protein	A0A0M4UTA7	Ralstonia_phage	1.6e-31	52.3
WP_064820730.1\|2839127_2843231_-\|tail	phage tail tape measure protein	A0A0P0ZCJ4	Stx2-converting_phage	6.0e-25	27.8
WP_081282109.1\|2843296_2844424_-	DNA cytosine methyltransferase	Q6J1P4	Burkholderia_virus	7.0e-101	54.6
WP_016721870.1\|2845274_2846261_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_043897652.1\|2847116_2848322_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_043885690.1\|2850002_2850647_-	hypothetical protein	NA	NA	NA	NA
WP_020833043.1\|2850621_2850843_-	hypothetical protein	NA	NA	NA	NA
WP_043897859.1\|2850839_2851229_-	hypothetical protein	NA	NA	NA	NA
WP_064820732.1\|2851237_2852011_-	hypothetical protein	A0A2D2W2E0	Stenotrophomonas_phage	8.9e-47	43.6
WP_064820733.1\|2852111_2852558_-	hypothetical protein	F4YCS3	Synechococcus_phage	1.5e-06	32.4
WP_021154690.1\|2852563_2852866_-	hypothetical protein	NA	NA	NA	NA
WP_064820734.1\|2852868_2853873_-\|capsid	major capsid protein	A0A1B2LRS0	Wolbachia_phage	1.9e-110	67.2
WP_020833049.1\|2853879_2854257_-\|head	head decoration protein	A0A1B2LRT0	Wolbachia_phage	2.7e-25	52.0
WP_064820735.1\|2854266_2855508_-	S49 family peptidase	K4HZZ6	Acidithiobacillus_phage	1.1e-59	40.3
WP_043897861.1\|2855519_2857088_-\|portal	phage portal protein	A0A1B2LRR5	Wolbachia_phage	4.3e-149	57.1
WP_020833052.1\|2857087_2857309_-	hypothetical protein	A0A2H4JCJ9	uncultured_Caudovirales_phage	3.8e-11	56.2
WP_064820675.1\|2857309_2857702_-	hypothetical protein	NA	NA	NA	NA
WP_020833054.1\|2857712_2858222_-	hypothetical protein	A0A0F6WCR7	Sinorhizobium_phage	1.3e-25	45.0
WP_064820736.1\|2858265_2860248_-\|terminase	phage terminase large subunit family protein	A0A2H4JIC6	uncultured_Caudovirales_phage	0.0e+00	85.6
WP_043897862.1\|2860247_2860784_-	hypothetical protein	A0A2H4JCL4	uncultured_Caudovirales_phage	2.0e-74	82.0
WP_064820737.1\|2860880_2861375_+	DUF3489 domain-containing protein	A0A2H4JE21	uncultured_Caudovirales_phage	3.1e-21	57.3
WP_064820776.1\|2861502_2861853_+	hypothetical protein	NA	NA	NA	NA
WP_013211002.1\|2861949_2862138_+	hypothetical protein	K4HZY7	Acidithiobacillus_phage	4.5e-13	64.2
WP_064820738.1\|2862362_2862728_+	hypothetical protein	A0A2H4JI44	uncultured_Caudovirales_phage	3.4e-33	58.8
WP_155738951.1\|2863077_2863227_-	hypothetical protein	NA	NA	NA	NA
WP_016726146.1\|2863223_2864189_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	5.5e-179	98.4
WP_064820739.1\|2864823_2866092_-	site-specific DNA-methyltransferase	A0A2H4JGF1	uncultured_Caudovirales_phage	2.4e-198	80.5
WP_064820740.1\|2866088_2867477_-	site-specific DNA-methyltransferase	K4I3Y2	Acidithiobacillus_phage	3.0e-162	61.9
WP_064820741.1\|2867974_2868382_-	hypothetical protein	NA	NA	NA	NA
WP_011000793.1\|2868371_2868584_-	hypothetical protein	NA	NA	NA	NA
WP_064820742.1\|2868815_2871113_-	hypothetical protein	K4HZY1	Acidithiobacillus_phage	5.5e-294	64.9
WP_064820743.1\|2871096_2871495_-	hypothetical protein	NA	NA	NA	NA
WP_064820744.1\|2871500_2871968_-	hypothetical protein	K4I3X7	Acidithiobacillus_phage	5.0e-37	52.3
WP_064820745.1\|2871977_2872610_-	hypothetical protein	K4ICM8	Acidithiobacillus_phage	1.6e-62	60.5
WP_064820746.1\|2872627_2873500_-	ATP-binding protein	K4HZX9	Acidithiobacillus_phage	7.5e-103	66.8
WP_064820747.1\|2873496_2873994_-	hypothetical protein	NA	NA	NA	NA
WP_064820748.1\|2873990_2874281_-	hypothetical protein	NA	NA	NA	NA
WP_064820749.1\|2875018_2875675_-	hypothetical protein	NA	NA	NA	NA
WP_019717717.1\|2875807_2876461_-	hypothetical protein	NA	NA	NA	NA
WP_064820750.1\|2876768_2876975_+	hypothetical protein	NA	NA	NA	NA
WP_064820777.1\|2877163_2878444_+	hypothetical protein	NA	NA	NA	NA
WP_016723835.1\|2878705_2880151_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_064820751.1\|2880340_2881315_-	hypothetical protein	NA	NA	NA	NA
WP_064820778.1\|2881311_2882535_-	hypothetical protein	NA	NA	NA	NA
WP_051048318.1\|2882932_2884039_-	type III secretion system YopJ family effector PopP1	NA	NA	NA	NA
WP_081282101.1\|2884698_2885139_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_064820753.1\|2885171_2886554_-	recombinase family protein	K4ICM1	Acidithiobacillus_phage	4.2e-132	57.2
WP_038938302.1\|2886550_2887048_-	DUF2924 domain-containing protein	K4I3X1	Acidithiobacillus_phage	9.2e-21	38.8
WP_081282102.1\|2887048_2887288_-	hypothetical protein	NA	NA	NA	NA
WP_081282103.1\|2888061_2889153_-	DUF746 domain-containing protein	NA	NA	NA	NA
WP_064820754.1\|2889350_2890196_-	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_064820755.1\|2890208_2891960_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_064820756.1\|2891971_2894509_-	filamentous hemagglutinin N-terminal domain-containing protein	A0A0R6PJK4	Moraxella_phage	3.1e-16	30.8
WP_072633614.1\|2895018_2895474_-	hypothetical protein	NA	NA	NA	NA
WP_072633615.1\|2895921_2896413_-	hypothetical protein	NA	NA	NA	NA
WP_020830964.1\|2896774_2897794_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	2.1e-43	33.9
WP_185762070.1\|2897839_2898118_-	hypothetical protein	NA	NA	NA	NA
WP_185762071.1\|2898182_2898548_-	hypothetical protein	NA	NA	NA	NA
WP_185762072.1\|2902258_2902657_-	hypothetical protein	NA	NA	NA	NA
WP_011003078.1\|2912289_2912622_+	DUF1484 domain-containing protein	NA	NA	NA	NA
WP_064820779.1\|2912673_2912970_-	hypothetical protein	NA	NA	NA	NA
WP_064820780.1\|2913037_2913499_-	lysozyme	K4I410	Acidithiobacillus_phage	8.7e-66	80.3
WP_071895569.1\|2913495_2913978_-	HNH endonuclease	A0A076YKQ7	Mycobacterium_phage	4.7e-22	48.3
WP_011003082.1\|2913964_2914447_-	hypothetical protein	K4ICR8	Acidithiobacillus_phage	4.8e-59	71.6
WP_064820758.1\|2914443_2914734_-	hypothetical protein	K4I011	Acidithiobacillus_phage	2.7e-12	46.4
WP_011003084.1\|2914800_2915025_-	hypothetical protein	NA	NA	NA	NA
WP_155738951.1\|2915217_2915367_-	hypothetical protein	NA	NA	NA	NA
WP_016721735.1\|2915363_2916329_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.6e-178	98.1
WP_063612226.1\|2916583_2916985_-	hypothetical protein	NA	NA	NA	NA
WP_011003086.1\|2917318_2917855_-	hypothetical protein	A0A0M4UKC5	Ralstonia_phage	1.8e-46	50.3
WP_020831479.1\|2917912_2918737_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_020831478.1\|2918985_2919723_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_020829879.1\|2920143_2921145_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_086004752.1\|2921279_2922082_-\|transposase	IS5-like element IS1421 family transposase	NA	NA	NA	NA
WP_071615479.1\|2922405_2923092_-	TolC family protein	NA	NA	NA	NA
WP_016725028.1\|2923144_2923504_-	hypothetical protein	NA	NA	NA	NA
WP_011003093.1\|2924288_2927411_-	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_011003094.1\|2927407_2928523_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_020371869.1\|2928610_2929225_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_020831475.1\|2929311_2930772_+	TolC family protein	NA	NA	NA	NA
WP_016726931.1\|2930864_2931671_+	oxidoreductase	NA	NA	NA	NA
WP_043897660.1\|2931720_2933184_+	MFS transporter	NA	NA	NA	NA
WP_064820781.1\|2933394_2934144_+	NAD(P)-binding domain-containing protein	NA	NA	NA	NA
WP_016725020.1\|2934618_2934828_-	hypothetical protein	A0A2H4JCL4	uncultured_Caudovirales_phage	1.2e-17	82.1
WP_020832173.1\|2934899_2936456_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	7.0e-75	36.6
WP_020829705.1\|2936488_2936842_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.2e-19	46.7
WP_043885814.1\|2936838_2937321_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_019717172.1\|2937430_2937625_-	hypothetical protein	A0A2H4JCL4	uncultured_Caudovirales_phage	2.8e-18	70.0
WP_020833025.1\|2939025_2939547_+	DUF3489 domain-containing protein	A0A2H4JE21	uncultured_Caudovirales_phage	1.0e-22	61.0
WP_043897852.1\|2939630_2939966_+	hypothetical protein	NA	NA	NA	NA
WP_016724179.1\|2940023_2940362_-	DUF1484 domain-containing protein	NA	NA	NA	NA
WP_043897853.1\|2940815_2942483_-	hypothetical protein	NA	NA	NA	NA
WP_028861135.1\|2942486_2942750_-	PAAR domain-containing protein	NA	NA	NA	NA
WP_020833028.1\|2942758_2944228_-	hypothetical protein	NA	NA	NA	NA
WP_020833029.1\|2944236_2946450_-	hypothetical protein	A0A077K801	Ralstonia_phage	1.5e-38	32.3
WP_064820782.1\|2946466_2949139_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	7.2e-88	32.3
WP_020833031.1\|2949921_2950329_-	hypothetical protein	NA	NA	NA	NA
WP_016725004.1\|2950318_2950528_-	hypothetical protein	NA	NA	NA	NA
WP_043897856.1\|2950737_2953044_-	hypothetical protein	K4HZY1	Acidithiobacillus_phage	6.8e-268	59.3
WP_064820759.1\|2953027_2953426_-	hypothetical protein	NA	NA	NA	NA
WP_064820744.1\|2953431_2953899_-	hypothetical protein	K4I3X7	Acidithiobacillus_phage	5.0e-37	52.3
WP_064820745.1\|2953908_2954541_-	hypothetical protein	K4ICM8	Acidithiobacillus_phage	1.6e-62	60.5
WP_064820760.1\|2954559_2955432_-	ATP-binding protein	K4HZX9	Acidithiobacillus_phage	9.2e-101	65.7
WP_020833038.1\|2955428_2955926_-	hypothetical protein	NA	NA	NA	NA
WP_020833039.1\|2955922_2956207_-	hypothetical protein	NA	NA	NA	NA
WP_020829879.1\|2956860_2957862_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_086004752.1\|2958045_2958847_+\|transposase	IS5-like element IS1421 family transposase	NA	NA	NA	NA
WP_016724993.1\|2958907_2959513_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003274149.1\|2959667_2960480_+	oxidoreductase	NA	NA	NA	NA
WP_016724992.1\|2960689_2961691_+	NADP-dependent oxidoreductase	NA	NA	NA	NA
WP_058908754.1\|2962119_2963094_-	hypothetical protein	NA	NA	NA	NA
WP_043885812.1\|2963090_2964314_-	hypothetical protein	NA	NA	NA	NA
WP_016721870.1\|2965304_2966291_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_144061886.1\|2966425_2966656_-	hypothetical protein	NA	NA	NA	NA
WP_016721870.1\|2966853_2967840_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
WP_064820761.1\|2968178_2968565_-	hypothetical protein	NA	NA	NA	NA
WP_043897658.1\|2968901_2969123_-	hypothetical protein	NA	NA	NA	NA
WP_043897897.1\|2969460_2969886_-	PH domain-containing protein	A0A249Y2R5	Serratia_phage	4.9e-15	37.5
WP_020830964.1\|2972462_2973482_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	2.1e-43	33.9
WP_016721735.1\|2974481_2975447_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.6e-178	98.1

DBSCAN-SWA_10

3671178 : 3706691

Microbacterium_phage(28.57%)

tRNA,tail,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011000142.1\|3671178_3672117_+\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	1.5e-101	70.1
WP_173361999.1\|3672201_3673185_-	hypothetical protein	NA	NA	NA	NA
WP_016722521.1\|3673356_3674724_+	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A0N7G7I9	Chrysochromulina_ericina_virus	1.8e-34	37.7
WP_011000145.1\|3674837_3676676_+	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	2.1e-150	46.3
WP_011000146.1\|3677510_3677966_-	universal stress protein	NA	NA	NA	NA
WP_020829879.1\|3679403_3680405_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_086004752.1\|3680539_3681342_-\|transposase	IS5-like element IS1421 family transposase	NA	NA	NA	NA
WP_011000107.1\|3681757_3682543_-	exodeoxyribonuclease III	NA	NA	NA	NA
WP_016722549.1\|3682574_3683255_+	orotate phosphoribosyltransferase	NA	NA	NA	NA
WP_011000105.1\|3683374_3684202_-	polyphosphate kinase 2 family protein	NA	NA	NA	NA
WP_043885954.1\|3684256_3685135_-	diaminopimelate epimerase	NA	NA	NA	NA
WP_016726804.1\|3685213_3686107_-	lauroyl acyltransferase	NA	NA	NA	NA
WP_016726803.1\|3686124_3686973_-	lysophospholipid acyltransferase family protein	NA	NA	NA	NA
WP_011000101.1\|3687213_3688404_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.7e-121	59.9
WP_020830892.1\|3688476_3688770_-	GYD domain-containing protein	NA	NA	NA	NA
WP_043897884.1\|3689078_3689960_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_020830890.1\|3689980_3691954_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_011000097.1\|3692207_3693344_+	HPP family protein	NA	NA	NA	NA
WP_020830889.1\|3693357_3693966_-	glutathione S-transferase	NA	NA	NA	NA
WP_011000095.1\|3694107_3694566_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_144061914.1\|3694934_3696326_+	YncE family protein	NA	NA	NA	NA
WP_020830886.1\|3696552_3696774_+	hypothetical protein	NA	NA	NA	NA
WP_019719041.1\|3697408_3698428_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_020830884.1\|3698571_3698937_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_020830883.1\|3699394_3701119_+	GMC family oxidoreductase N-terminal domain-containing protein	A0A1V0SI18	Klosneuvirus	5.4e-60	31.9
WP_016722564.1\|3701136_3702036_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011000088.1\|3702411_3704085_-	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_011000087.1\|3704171_3704666_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_016722567.1\|3704686_3704989_-	hypothetical protein	NA	NA	NA	NA
WP_011000085.1\|3705063_3705585_-\|tail	phage tail protein	A0A2R4A082	Microbacterium_phage	1.6e-15	36.0
WP_016722568.1\|3705599_3706133_-\|tail	phage tail protein	A0A2R3ZZT3	Microbacterium_phage	2.6e-13	32.7
WP_016722569.1\|3706142_3706691_-\|tail	phage tail protein	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP015851

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP015850

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection