CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP014878	Lactobacillus backii strain TMW 1.1989 plasmid pL11989-5, complete sequence	0 crisprs	NA	0	0
NZ_CP014875	Lactobacillus backii strain TMW 1.1989 plasmid pL11989-2, complete sequence	0 crisprs	NA	0	0
NZ_CP014876	Lactobacillus backii strain TMW 1.1989 plasmid pL11989-3, complete sequence	0 crisprs	NA	0	0
NZ_CP014873	Lactobacillus backii strain TMW 1.1989 chromosome, complete genome	0 crisprs	csa3,DinG,cas14j,cas3,DEDDh	0	11
NZ_CP014880	Lactobacillus backii strain TMW 1.1989 plasmid pL11989-7, complete sequence	0 crisprs	NA	0	0
NZ_CP014874	Lactobacillus backii strain TMW 1.1989 plasmid pL11989-1, complete sequence	1 crisprs	NA	1	0
NZ_CP014877	Lactobacillus backii strain TMW 1.1989 plasmid pL11989-4, complete sequence	0 crisprs	NA	0	0
NZ_CP014879	Lactobacillus backii strain TMW 1.1989 plasmid pL11989-6, complete sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP014874_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP014874_1

6817-6918

Orphan

Consensus_repeat	Method
TGTCCGATTTTCGGATTTTCGCTCGTAGCAAGGGTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP014874_1

>merge|NZ_CP014874|1|6817-6918|CRISPRCasFinder
TGTCCGATTTTCGGATTTTCGCTCGTAGCAAGGGTTTGCGGGGTGTTGTCAACGAACTTTCGCGAATGTCCGATTTTCGGATTTTCGCTCGTAGCAAGGGTT

>NZ_CP014874|1|1|6817-6918|CRISPRCasFinder
TGTCCGATTTTCGGATTTTCGCTCGTAGCAAGGGTT	TGCGGGGTGTTGTCAACGAACTTTCGCGAA
TGTCCGATTTTCGGATTTTCGCTCGTAGCAAGGGTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP014874.1\|WP_046870851.1\|5156_5891_-\|Fic-family-protein	unknown	unknown	gnl\|CDD\|376885
NZ_CP014874.1\|WP_050894606.1\|4572_4782_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014874.1\|WP_003649837.1\|8767_8983_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP014874.1\|WP_068281294.1\|415_1363_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133030
NZ_CP014874.1\|WP_046871958.1\|13946_14390_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133384
NZ_CP014874.1\|WP_014566845.1\|10337_10508_+\|transposase	unknown	unknown	gnl\|CDD\|376574
NZ_CP014874.1\|WP_017866972.1\|7975_8761_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|379293
NZ_CP014874.1\|WP_011178835.1\|3322_3727_+\|GtrA-family-protein	unknown	unknown	gnl\|CDD\|377229
NZ_CP014874.1\|WP_046871959.1\|14480_14804_-\|multidrug-efflux-SMR-transporter	unknown	unknown	gnl\|CDD\|224987
NZ_CP014874.1\|WP_017260570.1\|13146_13485_-\|carboxymuconolactone-decarboxylase-family-protein	unknown	unknown	gnl\|CDD\|223672
NZ_CP014874.1\|WP_057877478.1\|1372_3307_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274774
NZ_CP014874.1\|WP_056986391.1\|12730_13147_-\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380361
NZ_CP014874.1\|WP_068281289.1\|10738_12103_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|181958
NZ_CP014874.1\|WP_068281296.1\|9326_10310_+\|ISL3-family-transposase	unknown	unknown	gnl\|CDD\|225995
NZ_CP014874.1\|WP_056986393.1\|14962_15844_-\|DUF1003-domain-containing-protein	unknown	unknown	gnl\|CDD\|377629
NZ_CP014874.1\|WP_054712554.1\|5941_6139_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP014874.1\|WP_046870851.1\|5156_5891_-\|Fic-family-protein	gnl\|CDD\|376885	pfam02661, Fic, Fic/DOC family. This family consists of the Fic (filamentation induced by cAMP) protein and doc (death on curing). The Fic protein is involved in cell division and is suggested to be involved in the synthesis of PAB or folate, indicating that the Fic protein and cAMP are involved in a regulatory mechanism of cell division via folate metabolism. This family contains a central conserved motif HPFXXGNG in most members. The exact molecular function of these proteins is uncertain. P1 lysogens of Escherichia coli carry the prophage as a stable low copy number plasmid. The frequency with which viable cells cured of prophage are produced is about 10(-5) per cell per generation. A significant part of this remarkable stability can be attributed to a plasmid-encoded mechanism that causes death of cells that have lost P1. In other words, the lysogenic cells appear to be addicted to the presence of the prophage. The plasmid withdrawal response depends on a gene named doc (death on curing) that is represented by this family. Doc induces a reversible growth arrest of E. coli cells by targetting the protein synthesis machinery. Doc hosts the C-terminal domain of its antitoxin partner Phd (prevents host death) through fold complementation, a domain that is intrinsically disordered in solution but that folds into an alpha-helix on binding to Doc.This domain forms complexes with Phd antitoxins containing pfam02604.	0.000949229
NZ_CP014874.1\|WP_068281294.1\|415_1363_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	7.7636e-80
NZ_CP014874.1\|WP_056986391.1\|12730_13147_-\|cupin-domain-containing-protein	gnl\|CDD\|380361	cd02233, cupin_HNL-like, Granulicella tundricola hydroxynitrile lyase (GtHNL) and related proteins, cupin domain. This family includes archaeal, eukaryotic, and bacterial proteins homologous to hydroxynitrile lyase from Granulicella tundricola (GtHNL), a novel class of HNLs that does not show any sequence or structural similarity to any other HNL and does not contain conserved motifs typical of HNLs. HNLs comprise a diverse group of enzymes that vary in terms of their substrate specificity, enantioselectivity and the need for a co-factor. In plants, they catalyze the reversible cleavage of cyanohydrins, yielding HCN and aldehydes or ketones. Also included in this family is TM1010 from Thermotoga maritima, a protein of unknown function. Some but not all members of this family have N- or C-terminal carboxymuconolactone decarboxylase domains in addition to the cupin domain. Members of this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	1.27496e-52
NZ_CP014874.1\|WP_046871958.1\|13946_14390_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133384	cd01109, HTH_YyaN, Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB. Putative helix-turn-helix (HTH) MerR-like transcription regulators of Bacillus subtilis, YyaN and YraB, and related proteins; N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	5.1405e-47
NZ_CP014874.1\|WP_014566845.1\|10337_10508_+\|transposase	gnl\|CDD\|376574	pfam01610, DDE_Tnp_ISL3, Transposase. Transposase proteins are necessary for efficient DNA transposition. Contains transposases for IS204, IS1001, IS1096 and IS1165.	6.98966e-14
NZ_CP014874.1\|WP_017866972.1\|7975_8761_+\|AAA-family-ATPase	gnl\|CDD\|379293	pfam13614, AAA_31, AAA domain. This family includes a wide variety of AAA domains including some that have lost essential nucleotide binding residues in the P-loop.	2.22651e-36
NZ_CP014874.1\|WP_011178835.1\|3322_3727_+\|GtrA-family-protein	gnl\|CDD\|377229	pfam04138, GtrA, GtrA-like protein. Members of this family are predicted to be integral membrane proteins with three or four transmembrane spans. They are involved in the synthesis of cell surface polysaccharides. The GtrA family are a subset of this family. GtrA is predicted to be an integral membrane protein with 4 transmembrane spans. It is involved is in O antigen modification by Shigella flexneri bacteriophage X (SfX), but does not determine the specificity of glucosylation. Its function remains unknown, but it may play a role in translocation of undecaprenyl phosphate linked glucose (UndP-Glc) across the cytoplasmic membrane. Another member of this family is a DTDP-glucose-4-keto-6-deoxy-D-glucose reductase, which catalyzes the conversion of dTDP-4-keto-6-deoxy-D-glucose to dTDP-D-fucose, which is involved in the biosynthesis of the serotype-specific polysaccharide antigen of Actinobacillus actinomycetemcomitans Y4 (serotype b). This family also includes the teichoic acid glycosylation protein, GtcA, which is a serotype-specific protein in some Listeria innocua and monocytogenes strains. Its exact function is not known, but it is essential for decoration of cell wall teichoic acids with glucose and galactose.	7.55387e-15
NZ_CP014874.1\|WP_046871959.1\|14480_14804_-\|multidrug-efflux-SMR-transporter	gnl\|CDD\|224987	COG2076, EmrE, Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism].	2.0561e-24
NZ_CP014874.1\|WP_057877478.1\|1372_3307_+\|hypothetical-protein	gnl\|CDD\|274774	TIGR03766, hypothetical_protein_lp_2141, conserved hypothetical integral membrane protein. Models TIGR03110, TIGR03111, and TIGR03112 describe a three-gene system found in several Gram-positive bacteria, where TIGR03110 (XrtG) is distantly related to a putative transpeptidase, exosortase (TIGR02602). This model describes a small clade that correlates by both gene clustering and phyletic pattern, although imperfectly, to the three gene system. Both this narrow clade, and the larger set of full-length homologous integral membrane proteins, have an especially well-conserved region near the C-terminus with an invariant tyrosine. The function is unknown.	2.44223e-20
NZ_CP014874.1\|WP_017260570.1\|13146_13485_-\|carboxymuconolactone-decarboxylase-family-protein	gnl\|CDD\|223672	COG0599, COG0599, Uncharacterized homolog of gamma-carboxymuconolactone decarboxylase subunit [Function unknown].	1.67144e-28
NZ_CP014874.1\|WP_068281289.1\|10738_12103_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|181958	PRK09564, PRK09564, coenzyme A disulfide reductase; Reviewed.	1.66032e-92
NZ_CP014874.1\|WP_068281296.1\|9326_10310_+\|ISL3-family-transposase	gnl\|CDD\|225995	COG3464, COG3464, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	9.57568e-27
NZ_CP014874.1\|WP_056986393.1\|14962_15844_-\|DUF1003-domain-containing-protein	gnl\|CDD\|377629	pfam06210, DUF1003, Protein of unknown function (DUF1003). This family consists of several hypothetical bacterial proteins of unknown function.	1.33573e-51

>NZ_CP014874.1|WP_054712554.1|5941_6139_-|hypothetical-protein
MTKPSKEIETIDQLLADPWAVNIQDIWEQAAHNPDPDKRKLFDALHTYLLDKRQEQIINEKHFVI
>NZ_CP014874.1|WP_046870851.1|5156_5891_-|Fic-family-protein
MAKTRTYMDKYKFTAAENQRFARANFTKLVHTNARFEGVNTTLPQTQTIMDGMSVAGVPVEDVLTIVNLKRGWQYITAQNSPLTLTMEKQINKIVAAEDALVPGELRQGKGGVNLGSDDFFEQPLINEKQEQSFLQKILADPRTTITDKALTVMYHNMRQQIFWDGNKRTATLSANKIMIDGGAGLINVPLDKWDQWNELIANYYRTNDMAKIKRWTYDNGIQGLQIRANLALKSVKDKTSKRI
>NZ_CP014874.1|WP_050894606.1|4572_4782_+|hypothetical-protein
MSQSNLEKQEAKLKQLNQKIKAEKNKIEQNLGKQIIRSANLDYGTLTTPQIKMIAKKVAAFLNQAQNNQ
>NZ_CP014874.1|WP_011178835.1|3322_3727_+|GtrA-family-protein
MEKPITTLYSKYDTALRYLIVGGLTTGINVVLFFGLTHLAMPWFWANIIAWVLSVLFAFIANKKVVFNSADMTFRTVVKEGASFFTLRGASLLADTAILFIGLTLMHGSPLIVKLIDQVVVIVLNYGFSKLIFA
>NZ_CP014874.1|WP_057877478.1|1372_3307_+|hypothetical-protein
MKKIKPAFLPAILILCLLIGSIGNLTSVLGVPALLVVVLLGAGLYFGAPRLDHLSTRQLRWGIGLGLLAMLIAQVVVLHVMPNTVYHDPYRVLSQADQLAAGHMTWDITYFWRYANNVPLAYLLSLWLRLTQLVGLSTNLSVHLLSILVLDSFIALALHTIWQLSQRASLLVVAFGFFALSPFAYTYYLQVFYSDLPTMLVLLIIIRSLLNWSQKTSRQRWFAGSGLVVAVMLGAMLKPNLVVLLPALLIVGLILARQHLWRQAKLTLPILLIVLGFGLSLPATKVFDVAANYQPRTAFSFPATHWILMGYNQHSNGGYSGKDVGRAIKQPSQADRQRYNLKTIPKRIKTLGVVGVIRLWVVKLGIVLNVQGIQRWYNGGFRAAPSWYSNHAGFYQGLTVIGYVAATLLMWGALMLKLLRWRPDLTDPHQILALLAVTTALGYLAFHTLLWEVEPRYGQAILPLLWVALAAIPRQASQSRPRWANQASLLNGATASLVAFGAAGVLGAQLPQKQVIAAQRSQLSVQYHAKPKTVTPGTVLAEVVDVNAPANYFSVQIHAGSQVQVTLTNLATGQHYRLTMAGSVARLHHQLAAGQYRITVQNLTTRGQQVDVTHTYHYQLAAHPLTVNGQSQPTASLIYTCMQR
>NZ_CP014874.1|WP_068281294.1|415_1363_+|glycosyltransferase-family-2-protein
MATSKLTIVVPAYNEEEVLTSSVQKLLAVEDQIAAQTVLGQRADILIVDDGSMDHTWDIIEKLHAMTSRVRGLRFSRNFGHQSALIAGMSEAVKTADMIVTIDADLQDDPDKIGDMVDAYADGADIVYGVRNNRETDSWFKRTTAQGYYKTLKLLGVELVPNHADFRLMSKRAVETFLQYPERNIFIRGLIPKLGFKTAEVFYKRTPRMAGESKYPLKKMLAFAWDGITSLTIAPVRLILILGTLSCLLAVGMVVYAIVMKMLGLTVHGWSLLMVSLWFVGGIQMISLGVIGEYIGKLTTEVKHRPRYTVQTILD
>NZ_CP014874.1|WP_017866972.1|7975_8761_+|AAA-family-ATPase
MNGKTLLNFNFKGGVGKTTLTVMETYLLGQEGKKVLLIDFDPQGNATEIMKETYKADLKPELSLYEGLLGGNLSKSIVSVTNQIDMIPTDWTLSLWIGAVEKVSRVKRNILLPQMLSKLKQNYDYIFIDVPPTINVFTNNAIMASDFISIVLQTQKQSYTSSLKTATHLGELREQYNGSFQLVGAILYLMKPRAKVDTEISAQAKDFFGEGVFSNSIRTQERVKTFANEGIRNKDHWDKRAIQMYQMVLNEQILRIQQLEE
>NZ_CP014874.1|WP_003649837.1|8767_8983_+|hypothetical-protein
MAEDFLNKVSKKASEQLKNLKSPYQFETERTKTVQLRMSTYKEVKRIAFENDEKIVDVLEKIIREGLAKRK
>NZ_CP014874.1|WP_068281296.1|9326_10310_+|ISL3-family-transposase
MFGTREEFNGRGSGRKKYLVIQAELTYTLRRCPSCGYNTLHPNGHKLTHVHISGPMDRPVILELNKQRWRCSNCHSTCTATTPVVSTNHAIGHGLATHVLKLASKSLPAKTIASLTGISTNSVQRILTANIHPHASRRLPINLCFDEFRSTHGSMSFICIDADTHKSVKVLSDRLNRTIKQFFLSQYSTAERAAVQRVIMDMNASYQAFVHELFPNAELIIDRFHIIQLMGRTMDTIRTQCLKQLDKHSREYKVLKSLWRLFHKATPDAQKSRYLFGLNEYSTEQNAIDIGTDTFPAFKTAYETYIDLHDALMGRHADELKNIITNY
>NZ_CP014874.1|WP_014566845.1|10337_10508_+|transposase
MHTLRKNLNGVINAAKSSYSNGPIEGINRKIKELKRACYGFSNQANMFTRVYQLIA
>NZ_CP014874.1|WP_068281289.1|10738_12103_-|FAD-dependent-oxidoreductase
MDKRKIVIVGASHGGHESAIELLDKYNDVDVTVYEAGDFISFMSCGMQLYLENKVTAEDDVRNFAPEDVEKKGGHVYANHEVTAIHPEHKTVTVKDLTNNSEEEVQYDKLILSSGVTPKFLPVPGNDLKNIYLMRGRDWASKLMSAVNNPAIKNVAIVGAGYIGTEASEVFAKAGKHVTLMDMIDRPLGTYLNPELLDVLEPTFKKNMDLKMGVKIEGFNGNEKVESVKTDQGDIPADLVVVSAGVTPNTDWIKGTVDLDQRGWIKTDPYLRTNVKDVYAIGDAILPLSIPAGKPMPIALATTARREAQYVVDHIFEDKPDRAFKGVIGASALSVFDYHFATAGLNKFSAAKNKLDYQTSFYEDHMRPAYVPEADNPKVYVSLTFNPYTHQILGGAVLSKYDITAQGNVLALAISHKMRLEDLAEQDFFFQPGFDRQWSLLNLAAQHALGMARF
>NZ_CP014874.1|WP_056986391.1|12730_13147_-|cupin-domain-containing-protein
MANEKFETQNVFGQGNKNDAYAQYFIGQSYLKNLVSSDDNVNVNVGNVTFEPGCRNDWHIHHNGYQILLVTGGEGWYQEDGKPAQLLHPGDVVTIHDGVKHWHGATKDSWFSHVAITTGTSEWLEPVSDVAYDALSKD
>NZ_CP014874.1|WP_017260570.1|13146_13485_-|carboxymuconolactone-decarboxylase-family-protein
MAKKQTAGRKQLGDFAPQFAALNDDVLFGEVWSKEDALSAHDRSLITIASIISAGNTEQLEAHLRIGKQNGITKDEIVAEITHLAFYAGWPKAWSAFNRAKEIWSDEEETHK
>NZ_CP014874.1|WP_046871958.1|13946_14390_-|MerR-family-transcriptional-regulator
MATKTAVTEKRYRIGEFATKTGLSGPTLRYYEKEGLVKPHRSDNGLRYYTDADASWIKFLLHLKGTGMTIEQLKQYVAWRAEGDATITKRLQLLKNVRRGFLQEFEELQHSMTILNDKIDWYQGKVDGHISDNEGFANYLASLNHEE
>NZ_CP014874.1|WP_046871959.1|14480_14804_-|multidrug-efflux-SMR-transporter
MGYVYLALAIVGELIGTNLLKASSGFTLLWPSLGALIAYGTCFYFLAVCMKTVNLNIAYALWAGIGVVLSTLVAVLFWKEPVNLANVIGIGFILVGVVILNLFGANG
>NZ_CP014874.1|WP_056986393.1|14962_15844_-|DUF1003-domain-containing-protein
MQELNGTVYCLVDHKEYDLVDGVFLGDLDGPLRALIRLDFPKATNQDFICSEHLVHYRLLKMDQMIAKDYRQNHKLNQKLTRVLQKDTYQVVDVRQQLEHSLTVGQRVADAVAHFGGSWPFIISFVLIMLLWITVNSLHLFGVHFDPYPFILLNLFLSMVAAIQAPLIMMSQNRSAEYDRMESANDYHVNQKSEEEIRVLHSKVDHMIQQDQPNMLQIQKIQTEMLGSIESQVNELRRLQTYFDDHINDQESKQPKQQKSSQPARRQTDSPQSVSHNEQSHKQSDHGSLHVDK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP014874_1	1.1\|6853\|30\|NZ_CP014874\|CRISPRCasFinder	6853-6882	30	NZ_CP027191	Lactobacillus sp. CBA3605 plasmid pCBA3605-1, complete sequence	29360-29389	0	1.0
NZ_CP014874_1	1.1\|6853\|30\|NZ_CP014874\|CRISPRCasFinder	6853-6882	30	NZ_CP027195	Lactobacillus sp. CBA3606 plasmid pCBA3606-1, complete sequence	30410-30439	0	1.0
NZ_CP014874_1	1.1\|6853\|30\|NZ_CP014874\|CRISPRCasFinder	6853-6882	30	NZ_CP014874	Lactobacillus backii strain TMW 1.1989 plasmid pL11989-1, complete sequence	6853-6882	0	1.0
NZ_CP014874_1	1.1\|6853\|30\|NZ_CP014874\|CRISPRCasFinder	6853-6882	30	NZ_CP014900	Lactobacillus backii strain TMW 1.2002 plasmid pL12002-1, complete sequence	28834-28863	0	1.0
NZ_CP014874_1	1.1\|6853\|30\|NZ_CP014874\|CRISPRCasFinder	6853-6882	30	NZ_CP014920	Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-5, complete sequence	12633-12662	1	0.967
NZ_CP014874_1	1.1\|6853\|30\|NZ_CP014874\|CRISPRCasFinder	6853-6882	30	NZ_CP019982	Pediococcus inopinatus strain DSM 20285 plasmid pLDW-12, complete sequence	10406-10435	1	0.967
NZ_CP014874_1	1.1\|6853\|30\|NZ_CP014874\|CRISPRCasFinder	6853-6882	30	NZ_CP019982	Pediococcus inopinatus strain DSM 20285 plasmid pLDW-12, complete sequence	86925-86954	1	0.967
NZ_CP014874_1	1.1\|6853\|30\|NZ_CP014874\|CRISPRCasFinder	6853-6882	30	NC_017017	Pediococcus claussenii ATCC BAA-344 plasmid pPECL-6, complete sequence	5386-5415	1	0.967
NZ_CP014874_1	1.1\|6853\|30\|NZ_CP014874\|CRISPRCasFinder	6853-6882	30	NZ_CP014928	Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-4, complete sequence	6823-6852	1	0.967
NZ_CP014874_1	1.1\|6853\|30\|NZ_CP014874\|CRISPRCasFinder	6853-6882	30	NC_017468	Lactobacillus helveticus H10 plasmid pH10, complete sequence	15843-15872	1	0.967
NZ_CP014874_1	1.1\|6853\|30\|NZ_CP014874\|CRISPRCasFinder	6853-6882	30	NZ_CP047125	Lactobacillus hilgardii strain FLUB plasmid unnamed4	5236-5265	1	0.967
NZ_CP014874_1	1.1\|6853\|30\|NZ_CP014874\|CRISPRCasFinder	6853-6882	30	NZ_CP033891	Lactobacillus plantarum strain LMT1-48 plasmid p_3, complete sequence	3329-3358	1	0.967
NZ_CP014874_1	1.1\|6853\|30\|NZ_CP014874\|CRISPRCasFinder	6853-6882	30	NZ_CP031200	Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_B, complete sequence	39623-39652	1	0.967
NZ_CP014874_1	1.1\|6853\|30\|NZ_CP014874\|CRISPRCasFinder	6853-6882	30	NC_015421	Lactobacillus buchneri NRRL B-30929 plasmid pLBUC03, complete sequence	1006-1035	2	0.933
NZ_CP014874_1	1.1\|6853\|30\|NZ_CP014874\|CRISPRCasFinder	6853-6882	30	NC_006529	Lactobacillus salivarius UCC118 plasmid pSF118-20, complete sequence	4741-4770	2	0.933
NZ_CP014874_1	1.1\|6853\|30\|NZ_CP014874\|CRISPRCasFinder	6853-6882	30	NC_008498	Lactobacillus brevis ATCC 367 plasmid 1, complete sequence	8761-8790	2	0.933

1. spacer 1.1|6853|30|NZ_CP014874|CRISPRCasFinder matches to NZ_CP027191 (Lactobacillus sp. CBA3605 plasmid pCBA3605-1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcggggtgttgtcaacgaactttcgcgaa	Protospacer
******************************

2. spacer 1.1|6853|30|NZ_CP014874|CRISPRCasFinder matches to NZ_CP027195 (Lactobacillus sp. CBA3606 plasmid pCBA3606-1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcggggtgttgtcaacgaactttcgcgaa	Protospacer
******************************

3. spacer 1.1|6853|30|NZ_CP014874|CRISPRCasFinder matches to NZ_CP014874 (Lactobacillus backii strain TMW 1.1989 plasmid pL11989-1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcggggtgttgtcaacgaactttcgcgaa	Protospacer
******************************

4. spacer 1.1|6853|30|NZ_CP014874|CRISPRCasFinder matches to NZ_CP014900 (Lactobacillus backii strain TMW 1.2002 plasmid pL12002-1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcggggtgttgtcaacgaactttcgcgaa	Protospacer
******************************

5. spacer 1.1|6853|30|NZ_CP014874|CRISPRCasFinder matches to NZ_CP014920 (Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-5, complete sequence) position: , mismatch: 1, identity: 0.967

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcggggtgtcgtcaacgaactttcgcgaa	Protospacer
**********.*******************

6. spacer 1.1|6853|30|NZ_CP014874|CRISPRCasFinder matches to NZ_CP019982 (Pediococcus inopinatus strain DSM 20285 plasmid pLDW-12, complete sequence) position: , mismatch: 1, identity: 0.967

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcggagtgttgtcaacgaactttcgcgaa	Protospacer
*****.************************

7. spacer 1.1|6853|30|NZ_CP014874|CRISPRCasFinder matches to NZ_CP019982 (Pediococcus inopinatus strain DSM 20285 plasmid pLDW-12, complete sequence) position: , mismatch: 1, identity: 0.967

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcggagtgttgtcaacgaactttcgcgaa	Protospacer
*****.************************

8. spacer 1.1|6853|30|NZ_CP014874|CRISPRCasFinder matches to NC_017017 (Pediococcus claussenii ATCC BAA-344 plasmid pPECL-6, complete sequence) position: , mismatch: 1, identity: 0.967

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcggggtgtcgtcaacgaactttcgcgaa	Protospacer
**********.*******************

9. spacer 1.1|6853|30|NZ_CP014874|CRISPRCasFinder matches to NZ_CP014928 (Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-4, complete sequence) position: , mismatch: 1, identity: 0.967

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcggggtgtcgtcaacgaactttcgcgaa	Protospacer
**********.*******************

10. spacer 1.1|6853|30|NZ_CP014874|CRISPRCasFinder matches to NC_017468 (Lactobacillus helveticus H10 plasmid pH10, complete sequence) position: , mismatch: 1, identity: 0.967

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcggggtgtcgtcaacgaactttcgcgaa	Protospacer
**********.*******************

11. spacer 1.1|6853|30|NZ_CP014874|CRISPRCasFinder matches to NZ_CP047125 (Lactobacillus hilgardii strain FLUB plasmid unnamed4) position: , mismatch: 1, identity: 0.967

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcggggtgtcgtcaacgaactttcgcgaa	Protospacer
**********.*******************

12. spacer 1.1|6853|30|NZ_CP014874|CRISPRCasFinder matches to NZ_CP033891 (Lactobacillus plantarum strain LMT1-48 plasmid p_3, complete sequence) position: , mismatch: 1, identity: 0.967

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcggggtgtcgtcaacgaactttcgcgaa	Protospacer
**********.*******************

13. spacer 1.1|6853|30|NZ_CP014874|CRISPRCasFinder matches to NZ_CP031200 (Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_B, complete sequence) position: , mismatch: 1, identity: 0.967

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcggggtgtcgtcaacgaactttcgcgaa	Protospacer
**********.*******************

14. spacer 1.1|6853|30|NZ_CP014874|CRISPRCasFinder matches to NC_015421 (Lactobacillus buchneri NRRL B-30929 plasmid pLBUC03, complete sequence) position: , mismatch: 2, identity: 0.933

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcgggttgtcgtcaacgaactttcgcgaa	Protospacer
****** ***.*******************

15. spacer 1.1|6853|30|NZ_CP014874|CRISPRCasFinder matches to NC_006529 (Lactobacillus salivarius UCC118 plasmid pSF118-20, complete sequence) position: , mismatch: 2, identity: 0.933

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgcggggtgtcgtcaacggactttcgcgaa	Protospacer
**********.*******.***********

16. spacer 1.1|6853|30|NZ_CP014874|CRISPRCasFinder matches to NC_008498 (Lactobacillus brevis ATCC 367 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.933

tgcggggtgttgtcaacgaactttcgcgaa	CRISPR spacer
tgtggggtgtcgtcaacgaactttcgcgaa	Protospacer
**.*******.*******************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP014873

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

314197 : 379765

Acinetobacter_phage(25.0%)

tRNA,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_068223032.1\|314197_315076_+\|transposase	IS982-like element ISLpl4 family transposase	NA	NA	NA	NA
WP_068222195.1\|315226_316633_-	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	6.6e-16	28.9
WP_068222192.1\|316607_317318_-	response regulator transcription factor	W8CYM9	Bacillus_phage	6.9e-30	33.8
WP_082920477.1\|317633_318155_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_068222186.1\|318386_318731_-	hypothetical protein	NA	NA	NA	NA
WP_068222182.1\|318747_319401_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_068222179.1\|319786_320959_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_068222171.1\|321226_321691_+	hypothetical protein	NA	NA	NA	NA
WP_068222166.1\|321907_322234_-	hypothetical protein	NA	NA	NA	NA
WP_068222163.1\|322312_323434_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A0B5JD48	Pandoravirus	2.5e-13	24.3
WP_068222160.1\|323880_324405_+	hypothetical protein	NA	NA	NA	NA
WP_068279743.1\|324766_325360_+	TVP38/TMEM64 family protein	M1Q152	Streptococcus_phage	4.6e-27	33.7
WP_068222154.1\|325493_326279_-	tryptophan synthase subunit alpha	NA	NA	NA	NA
WP_068279742.1\|326271_327468_-	tryptophan synthase subunit beta	NA	NA	NA	NA
WP_068222150.1\|327485_328073_-	phosphoribosylanthranilate isomerase	NA	NA	NA	NA
WP_068222148.1\|328069_328858_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	1.0e-37	42.5
WP_068222145.1\|328854_329874_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	6.2e-64	38.6
WP_068222142.1\|330790_331375_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	4.7e-40	45.9
WP_068281257.1\|331358_332828_-	anthranilate synthase component I family protein	NA	NA	NA	NA
WP_068279740.1\|333880_335800_+	fructose-bisphosphatase class III	NA	NA	NA	NA
WP_068222134.1\|335943_337503_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_068222131.1\|337707_338517_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_082918467.1\|338518_338941_-	hypothetical protein	NA	NA	NA	NA
WP_068222124.1\|339011_339557_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_068222121.1\|340036_340300_+	hypothetical protein	NA	NA	NA	NA
WP_068222118.1\|340296_340770_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_068222115.1\|340990_341314_-	hypothetical protein	NA	NA	NA	NA
WP_068222111.1\|341599_344107_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	9.7e-135	32.6
WP_068376540.1\|344529_345459_-	AEC family transporter	NA	NA	NA	NA
WP_068279737.1\|345610_346408_-	hypothetical protein	NA	NA	NA	NA
WP_068279733.1\|346801_347902_+	DMT family transporter	NA	NA	NA	NA
WP_156519978.1\|347971_348124_-	hypothetical protein	NA	NA	NA	NA
WP_068279730.1\|348694_350107_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_082920478.1\|350331_350769_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_068279055.1\|350738_352010_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_156520059.1\|352022_352193_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_068279723.1\|352349_353366_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_068279721.1\|353389_354469_-	hypothetical protein	NA	NA	NA	NA
WP_068279719.1\|354627_355161_-	hypothetical protein	NA	NA	NA	NA
WP_075168937.1\|355324_356620_-	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_068222068.1\|356751_357564_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_068222065.1\|357897_358587_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_068279711.1\|358617_359358_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.8e-26	34.1
WP_068279055.1\|359641_360913_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_068222059.1\|361354_362314_-	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_068279709.1\|362313_364452_-	RNA degradosome polyphosphate kinase	NA	NA	NA	NA
WP_068279707.1\|364453_365983_-	exopolyphosphatase	NA	NA	NA	NA
WP_068226170.1\|367165_367774_-	cyclodeaminase/cyclohydrolase family protein	NA	NA	NA	NA
WP_068226169.1\|367816_368833_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_068226168.1\|369283_370618_-	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	1.6e-32	26.1
WP_068226301.1\|370635_371583_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.3e-27	34.9
WP_068226167.1\|371614_373150_-	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_068226165.1\|376057_376696_+	hypothetical protein	NA	NA	NA	NA
WP_082918562.1\|377029_377230_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_068279704.1\|377431_377668_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_068279055.1\|377850_379122_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_017866964.1\|379507_379765_+\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	1.0e-15	47.1

DBSCAN-SWA_2

515703 : 579172

Streptococcus_phage(42.86%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_057808145.1\|515703_516951_-\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	5.3e-09	24.7
WP_068226065.1\|517185_518130_+	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_068226064.1\|518143_519262_+	glycerate kinase	W6LM47	Streptococcus_phage	2.4e-32	40.5
WP_068226063.1\|519349_519808_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_068226062.1\|519922_520768_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_068226061.1\|521012_521504_+	hypothetical protein	NA	NA	NA	NA
WP_068279610.1\|521789_522086_-	hypothetical protein	NA	NA	NA	NA
WP_068226059.1\|522483_522708_-	hypothetical protein	NA	NA	NA	NA
WP_068226058.1\|522884_523229_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_068226057.1\|523244_523559_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_068279608.1\|523718_524213_+	N-acetyltransferase	NA	NA	NA	NA
WP_068279605.1\|524406_524883_+	universal stress protein	NA	NA	NA	NA
WP_068226053.1\|524990_525881_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_068279064.1\|526222_527533_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	2.7e-128	54.6
WP_068477231.1\|527611_528571_-	acyltransferase	NA	NA	NA	NA
WP_068279601.1\|529439_530750_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	7.8e-128	54.6
WP_068281254.1\|530938_531937_+	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_068226050.1\|532036_532798_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_068226049.1\|532833_533427_-	hypothetical protein	NA	NA	NA	NA
WP_068226048.1\|535001_535697_+	ATP-binding cassette domain-containing protein	A0A1V0SGN0	Hokovirus	2.6e-13	26.7
WP_068226047.1\|535689_536481_+	metal ABC transporter permease	NA	NA	NA	NA
WP_068279598.1\|536577_537768_+	multidrug effflux MFS transporter	S4TR35	Salmonella_phage	5.8e-29	25.7
WP_068226045.1\|537888_538269_-	YueI family protein	NA	NA	NA	NA
WP_068226044.1\|538439_542411_-	MMPL family transporter	NA	NA	NA	NA
WP_068226043.1\|542439_543024_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_068279596.1\|544024_545302_+	GTPase HflX	NA	NA	NA	NA
WP_068226041.1\|545814_546339_-	shikimate kinase	NA	NA	NA	NA
WP_068226040.1\|546354_547452_-	prephenate dehydrogenase	NA	NA	NA	NA
WP_100071607.1\|547934_550688_-	cation-transporting P-type ATPase	A0A1J0FA34	Only_Syngen_Nebraska_virus	1.4e-70	27.5
WP_068226038.1\|551243_551585_-	hypothetical protein	NA	NA	NA	NA
WP_068226037.1\|551802_552084_+	hypothetical protein	NA	NA	NA	NA
WP_100070519.1\|552230_553100_-	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_068279587.1\|553352_554387_-	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_068226034.1\|554666_556154_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	2.0e-95	40.4
WP_068226033.1\|556411_557041_-	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_068226032.1\|557190_557571_-	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_068279583.1\|557656_559177_-	glycosyltransferase	NA	NA	NA	NA
WP_068222268.1\|559531_560755_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.6e-74	44.4
WP_068279580.1\|560865_562422_-	glycosyltransferase	NA	NA	NA	NA
WP_068226029.1\|562878_563574_+	cobalamin biosynthesis protein CobQ	NA	NA	NA	NA
WP_068226028.1\|563769_564186_+	hypothetical protein	NA	NA	NA	NA
WP_068279578.1\|564507_565221_+	zinc metallopeptidase	NA	NA	NA	NA
WP_068226026.1\|565576_565993_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_068226290.1\|566374_567697_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	9.7e-94	44.3
WP_068226025.1\|567925_568945_-	putative sulfate exporter family transporter	NA	NA	NA	NA
WP_068226024.1\|569071_569944_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_068226023.1\|570115_570517_-	transcriptional regulator Spx	NA	NA	NA	NA
WP_068226022.1\|570956_571541_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_068279575.1\|571978_572857_+	LicD family protein	A0A1V0SD50	Indivirus	1.9e-05	30.8
WP_068226019.1\|572872_574303_+	polysaccharide biosynthesis C-terminal domain-containing protein	NA	NA	NA	NA
WP_068279064.1\|575190_576501_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	2.7e-128	54.6
WP_068226017.1\|577223_577727_-	methylated-DNA--[protein]-cysteine S-methyltransferase	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	1.9e-18	42.7
WP_068222268.1\|577948_579172_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	4.6e-74	44.4

DBSCAN-SWA_3

605582 : 614106

Cyanophage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_068279536.1\|605582_606170_-	phosphoribosylglycinamide formyltransferase	E3SNR5	Prochlorococcus_phage	5.0e-26	38.0
WP_068279533.1\|606170_607184_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SE90	Cyanophage	1.4e-60	41.6
WP_068281252.1\|607170_608631_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.6e-52	34.7
WP_068279530.1\|608615_610835_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	8.0e-141	39.7
WP_068279528.1\|610827_611511_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_068279526.1\|611507_611771_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_068279523.1\|611770_612502_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A1D7SLB8	Cyanophage	1.3e-39	40.4
WP_068279519.1\|612503_613637_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_068279516.1\|613617_614106_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	4.5e-20	43.9

DBSCAN-SWA_4

834511 : 906555

Acinetobacter_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_156520035.1\|834511_835890_-\|transposase	IS3 family transposase	A0A0C5AEA5	Paenibacillus_phage	2.0e-25	36.6
WP_068279366.1\|835992_836652_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_068279363.1\|837249_838617_+\|transposase	transposase	NA	NA	NA	NA
WP_056973869.1\|838826_840185_+\|transposase	transposase	NA	NA	NA	NA
WP_068225816.1\|840339_841470_+	glycosyltransferase	NA	NA	NA	NA
WP_068279360.1\|841955_843080_+	DegT/DnrJ/EryC1/StrS family aminotransferase	NA	NA	NA	NA
WP_068225818.1\|843092_844604_+	lipopolysaccharide biosynthesis protein	NA	NA	NA	NA
WP_068279356.1\|844587_845187_+	hypothetical protein	NA	NA	NA	NA
WP_082918546.1\|845232_845928_+	sugar transferase	NA	NA	NA	NA
WP_167574656.1\|845995_847060_+	glycosyltransferase	NA	NA	NA	NA
WP_068279353.1\|847081_848215_+	glycosyltransferase	NA	NA	NA	NA
WP_068225822.1\|848232_849198_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_068225823.1\|849190_850555_+	hypothetical protein	NA	NA	NA	NA
WP_068279350.1\|851228_852731_+	ABC-F type ribosomal protection protein	A0A1B0RXA0	Streptococcus_phage	4.6e-23	23.1
WP_068279347.1\|852881_853298_-	hypothetical protein	NA	NA	NA	NA
WP_068279345.1\|853379_854042_-	TrkA family potassium uptake protein	NA	NA	NA	NA
WP_068279342.1\|854154_855504_-	Trk family potassium uptake protein	NA	NA	NA	NA
WP_068279340.1\|856051_859618_+	hypothetical protein	NA	NA	NA	NA
WP_068279337.1\|859663_860122_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_068279335.1\|860696_862673_+	cell division protein FtsI	NA	NA	NA	NA
WP_068279332.1\|862952_863396_-	nucleoside 2-deoxyribosyltransferase	NA	NA	NA	NA
WP_068279329.1\|863809_865285_+	UbiD family decarboxylase	NA	NA	NA	NA
WP_068279326.1\|865410_865821_-	hypothetical protein	NA	NA	NA	NA
WP_068279323.1\|865860_866424_-	UbiX family flavin prenyltransferase	NA	NA	NA	NA
WP_068279320.1\|866542_867415_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_068279317.1\|867406_868318_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_068279314.1\|868515_870921_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	2.8e-54	58.1
WP_068223443.1\|871361_872537_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_068279311.1\|872679_873126_+	PTS fructose transporter subunit IIA	NA	NA	NA	NA
WP_082918544.1\|873144_874689_+	PTS fructose-like transporter subunit IIBC	NA	NA	NA	NA
WP_068279308.1\|874764_875928_+	putative C-S lyase	NA	NA	NA	NA
WP_068279305.1\|875945_877706_+	HTH domain-containing protein	NA	NA	NA	NA
WP_068279302.1\|877860_878742_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_068279299.1\|879247_880084_+	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_068279295.1\|880147_880987_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_068279292.1\|881122_882007_+	shikimate dehydrogenase	NA	NA	NA	NA
WP_068279289.1\|882043_882919_+	shikimate dehydrogenase	NA	NA	NA	NA
WP_068279285.1\|882924_884145_+	MFS transporter	NA	NA	NA	NA
WP_068279282.1\|884187_885381_+	MFS transporter	NA	NA	NA	NA
WP_068279279.1\|885664_886564_+	FAD:protein FMN transferase	NA	NA	NA	NA
WP_068279275.1\|888500_889151_-	hypothetical protein	NA	NA	NA	NA
WP_068279271.1\|889254_890184_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_068279268.1\|890358_891240_+	shikimate dehydrogenase	NA	NA	NA	NA
WP_068279265.1\|891384_892146_+	type I 3-dehydroquinate dehydratase	NA	NA	NA	NA
WP_068279055.1\|892529_893801_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_068279262.1\|893977_895420_-	C69 family dipeptidase	NA	NA	NA	NA
WP_068279259.1\|895499_896570_-	aminopeptidase P family protein	NA	NA	NA	NA
WP_068279256.1\|897245_898610_+	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	1.0e-21	24.1
WP_068281247.1\|898972_900286_+	proline reductase-associated electron transfer protein PrdC	NA	NA	NA	NA
WP_068279253.1\|900649_902110_+	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	3.5e-76	39.6
WP_068279249.1\|902593_903352_+	threonine/serine exporter family protein	NA	NA	NA	NA
WP_068279246.1\|903363_903825_+	threonine/serine exporter family protein	NA	NA	NA	NA
WP_068279243.1\|903894_904776_+	proline iminopeptidase-family hydrolase	NA	NA	NA	NA
WP_068279240.1\|905055_905283_+	hypothetical protein	NA	NA	NA	NA
WP_068279055.1\|905283_906555_-\|transposase	ISL3 family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

1451286 : 1506181

Bacillus_phage(33.33%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100071634.1\|1451286_1452057_+\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_068281099.1\|1452288_1453056_+	chain-length determining protein	NA	NA	NA	NA
WP_068222928.1\|1453064_1453811_+	CpsD/CapB family tyrosine-protein kinase	NA	NA	NA	NA
WP_178378352.1\|1453807_1454578_+	tyrosine protein phosphatase	NA	NA	NA	NA
WP_068279055.1\|1454653_1455925_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_068281097.1\|1456003_1456708_-	DUF3862 domain-containing protein	NA	NA	NA	NA
WP_068222934.1\|1457048_1457492_+	50S ribosomal protein L13	NA	NA	NA	NA
WP_068222939.1\|1457506_1457902_+	30S ribosomal protein S9	NA	NA	NA	NA
WP_068222941.1\|1458130_1458346_+	hypothetical protein	NA	NA	NA	NA
WP_068222947.1\|1458567_1459947_+	class II fumarate hydratase	NA	NA	NA	NA
WP_068222949.1\|1460336_1461761_+	amino acid permease	NA	NA	NA	NA
WP_068222952.1\|1461853_1463590_-	pyruvate oxidase	NA	NA	NA	NA
WP_068222955.1\|1465330_1466308_+	ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_167574653.1\|1466323_1466527_+	hypothetical protein	NA	NA	NA	NA
WP_156520062.1\|1466447_1466717_+	hypothetical protein	NA	NA	NA	NA
WP_068222961.1\|1466716_1468048_+	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_068222963.1\|1468044_1468839_+	acetyl-CoA carboxyl transferase	NA	NA	NA	NA
WP_068222969.1\|1468831_1469599_+	carboxyltransferase	NA	NA	NA	NA
WP_068281095.1\|1469654_1470725_-	LCP family protein	NA	NA	NA	NA
WP_068226182.1\|1470899_1471187_-	chromosome partitioning protein ParB	NA	NA	NA	NA
WP_068222982.1\|1471395_1472337_+	AEC family transporter	NA	NA	NA	NA
WP_068222985.1\|1472549_1473413_-	homoserine kinase	NA	NA	NA	NA
WP_068222988.1\|1473866_1474544_+	2,3-bisphosphoglycerate-dependent phosphoglycerate mutase	NA	NA	NA	NA
WP_068281091.1\|1474841_1476926_-	KUP/HAK/KT family potassium transporter	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	4.8e-63	35.7
WP_068222994.1\|1477211_1478549_-	C1 family peptidase	NA	NA	NA	NA
WP_068222997.1\|1478657_1478936_-	N-acetyltransferase	NA	NA	NA	NA
WP_178378338.1\|1479083_1479623_+	dUTP diphosphatase	J9PV85	Bacillus_phage	9.6e-40	51.9
WP_068223000.1\|1479915_1481286_+	DNA repair protein RadA	NA	NA	NA	NA
WP_068223002.1\|1481375_1482512_+	PIN/TRAM domain-containing protein	NA	NA	NA	NA
WP_068223005.1\|1482635_1484126_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_068281089.1\|1484692_1486102_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	9.2e-50	31.2
WP_068223014.1\|1486101_1486527_+	Mini-ribonuclease 3	NA	NA	NA	NA
WP_068223017.1\|1486504_1487305_+	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
WP_068223020.1\|1487301_1487835_+	NYN domain-containing protein	NA	NA	NA	NA
WP_068223023.1\|1488184_1488757_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_068279055.1\|1488922_1490194_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_068223025.1\|1490488_1491469_-	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_068223028.1\|1491455_1492076_-	Gx transporter family protein	NA	NA	NA	NA
WP_068226184.1\|1492089_1492494_-	NusG domain II-containing protein	NA	NA	NA	NA
WP_068223030.1\|1492638_1494609_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_100077720.1\|1495466_1496420_+	UbiA family prenyltransferase	NA	NA	NA	NA
WP_075168922.1\|1496641_1496791_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_068223036.1\|1496799_1496982_+	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_068223037.1\|1497218_1497770_+	transcription termination/antitermination protein NusG	NA	NA	NA	NA
WP_068223040.1\|1497910_1498873_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_068223043.1\|1499021_1499447_+	50S ribosomal protein L11	NA	NA	NA	NA
WP_068223045.1\|1499612_1500311_+	50S ribosomal protein L1	NA	NA	NA	NA
WP_068223048.1\|1500852_1501365_+	50S ribosomal protein L10	NA	NA	NA	NA
WP_068223052.1\|1501518_1501887_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_068223055.1\|1502230_1502917_-	hypothetical protein	NA	NA	NA	NA
WP_017866964.1\|1503370_1503628_+\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	1.0e-15	47.1
WP_167574658.1\|1503663_1503975_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_068279064.1\|1504121_1505432_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	2.7e-128	54.6
WP_068281284.1\|1505620_1506181_+\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	8.1e-50	57.4

DBSCAN-SWA_6

1517713 : 1564139

Streptococcus_phage(23.53%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_068279064.1\|1517713_1519024_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	2.7e-128	54.6
WP_068223079.1\|1519576_1520530_+	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_143452886.1\|1520606_1521548_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	3.0e-20	28.0
WP_057823861.1\|1521481_1522204_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_068223084.1\|1522922_1524650_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	2.2e-53	37.2
WP_178378335.1\|1524995_1525313_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_068281083.1\|1525467_1526064_+	recombination protein RecR	NA	NA	NA	NA
WP_068223093.1\|1526066_1526345_+	YaaL family protein	NA	NA	NA	NA
WP_068223095.1\|1526973_1530369_+	SNF2 helicase associated domain-containing protein	S5NA49	Choristoneura_rosaceana_nucleopolyhedrovirus	6.9e-43	27.9
WP_068223097.1\|1530668_1531313_+	dTMP kinase	M1PSC7	Streptococcus_phage	3.4e-52	51.9
WP_068223100.1\|1531836_1532169_+	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_068281081.1\|1532170_1533151_+	DNA polymerase III subunit delta'	E7DN81	Pneumococcus_phage	5.8e-11	28.2
WP_068223103.1\|1533247_1534036_+	stage 0 sporulation family protein	NA	NA	NA	NA
WP_068281079.1\|1534515_1534890_+	DNA replication initiation control protein YabA	NA	NA	NA	NA
WP_068281077.1\|1535348_1536215_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	3.7e-78	56.2
WP_068281075.1\|1536238_1536997_+	acyl-ACP thioesterase	NA	NA	NA	NA
WP_156520041.1\|1537171_1537684_-	hypothetical protein	NA	NA	NA	NA
WP_017866964.1\|1537872_1538130_+\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	1.0e-15	47.1
WP_105782191.1\|1538114_1538999_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.2e-65	48.3
WP_082920447.1\|1539030_1539387_-	hypothetical protein	NA	NA	NA	NA
WP_105782191.1\|1539955_1540840_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.2e-65	48.3
WP_017866964.1\|1540824_1541082_-\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	1.0e-15	47.1
WP_191980583.1\|1541303_1542236_+	NAD-dependent epimerase/dehydratase family protein	A0A2K9L4U8	Tupanvirus	1.3e-39	34.3
WP_068281070.1\|1542255_1542930_+	sugar transferase	NA	NA	NA	NA
WP_068281068.1\|1542916_1543756_+	glycosyltransferase	NA	NA	NA	NA
WP_068281067.1\|1543799_1544801_+	Stealth CR1 domain-containing protein	NA	NA	NA	NA
WP_068281066.1\|1545021_1546179_+	hypothetical protein	NA	NA	NA	NA
WP_068281063.1\|1546250_1547318_+	glycosyltransferase	NA	NA	NA	NA
WP_068477258.1\|1547367_1547952_+	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	7.0e-12	40.0
WP_068279064.1\|1548098_1549409_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	2.7e-128	54.6
WP_068281056.1\|1550045_1551077_+	sugar transferase	NA	NA	NA	NA
WP_068222411.1\|1551720_1551903_+	hypothetical protein	NA	NA	NA	NA
WP_068222408.1\|1551892_1552267_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_178378324.1\|1552275_1553829_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.9e-56	30.5
WP_068222411.1\|1554004_1554187_+	hypothetical protein	NA	NA	NA	NA
WP_068222408.1\|1554176_1554551_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_178378324.1\|1554559_1556113_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.9e-56	30.5
WP_068281054.1\|1556547_1556940_+	hypothetical protein	Q4ZCB9	Staphylococcus_virus	8.8e-11	38.8
WP_068281053.1\|1556929_1557748_+	DUF1828 domain-containing protein	NA	NA	NA	NA
WP_068281052.1\|1558024_1559215_+	cobalamin-independent methionine synthase II family protein	NA	NA	NA	NA
WP_068223113.1\|1559600_1560194_+	sulfurtransferase-like selenium metabolism protein YedF	NA	NA	NA	NA
WP_068223118.1\|1560860_1561106_-	DUF2922 domain-containing protein	NA	NA	NA	NA
WP_068281050.1\|1561434_1561650_-	hypothetical protein	NA	NA	NA	NA
WP_068281047.1\|1561891_1562452_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_068279055.1\|1562867_1564139_+\|transposase	ISL3 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

1601307 : 1645699

Bacillus_phage(35.71%)

protease,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017866964.1\|1601307_1601565_+\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	1.0e-15	47.1
WP_105782191.1\|1601549_1602434_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.2e-65	48.3
WP_068280953.1\|1603033_1603963_+	glycosyltransferase	V5USA4	Oenococcus_phage	6.4e-84	52.8
WP_068280951.1\|1604108_1605077_+	glycosyltransferase family 2 protein	S5FKN0	Shigella_phage	6.3e-50	37.7
WP_068280948.1\|1605097_1606594_+	hypothetical protein	NA	NA	NA	NA
WP_105782191.1\|1607120_1608005_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.2e-65	48.3
WP_017866964.1\|1607989_1608247_-\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	1.0e-15	47.1
WP_068477269.1\|1608681_1611219_+	KxYKxGKxW signal peptide domain-containing protein	U3PJ04	Lactobacillus_phage	1.5e-18	32.5
WP_035457977.1\|1611325_1612597_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_068279064.1\|1613681_1614992_+\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	2.7e-128	54.6
WP_156520042.1\|1615377_1617357_+	C40 family peptidase	A0A1J0GW44	Streptomyces_phage	9.0e-19	40.5
WP_068279055.1\|1617526_1618798_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_068280932.1\|1619125_1620004_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_082920485.1\|1620134_1621247_+	DUF1175 family protein	D2KRB9	Lactobacillus_phage	4.1e-13	38.2
WP_068280930.1\|1621276_1623340_+	glycoside hydrolase family protein	A0A1B1P9G1	Acinetobacter_phage	2.3e-25	51.4
WP_068222411.1\|1623438_1623621_+	hypothetical protein	NA	NA	NA	NA
WP_068222408.1\|1623610_1623985_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_178378324.1\|1623993_1625547_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.9e-56	30.5
WP_068280921.1\|1625982_1626411_-	GtrA family protein	NA	NA	NA	NA
WP_068280917.1\|1627057_1627522_-	hypothetical protein	NA	NA	NA	NA
WP_068280914.1\|1627633_1628242_-	hypothetical protein	NA	NA	NA	NA
WP_068280911.1\|1630190_1630898_-	hypothetical protein	NA	NA	NA	NA
WP_068280909.1\|1631423_1632257_-	metallophosphoesterase family protein	NA	NA	NA	NA
WP_068280906.1\|1632626_1632806_-	hypothetical protein	NA	NA	NA	NA
WP_068280902.1\|1632967_1633786_+	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_068223259.1\|1633967_1634207_+	hypothetical protein	NA	NA	NA	NA
WP_068223262.1\|1634606_1634849_+	hypothetical protein	NA	NA	NA	NA
WP_068223266.1\|1635184_1636084_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.2e-74	48.8
WP_156519986.1\|1636140_1636284_-	hypothetical protein	NA	NA	NA	NA
WP_068223268.1\|1636349_1637324_-	asparaginase	NA	NA	NA	NA
WP_068223273.1\|1638038_1638578_+	folate family ECF transporter S component	NA	NA	NA	NA
WP_068223276.1\|1638899_1639628_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_068223279.1\|1639611_1640160_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_158234209.1\|1640164_1640632_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_068280899.1\|1640643_1641687_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	NA	NA	NA	NA
WP_068223284.1\|1641833_1643792_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	6.1e-52	29.0
WP_068223287.1\|1644134_1644794_+	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_068223290.1\|1645060_1645699_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_8

1934682 : 2002046

Bacillus_phage(30.77%)

tRNA,integrase,transposase

attL 1957472:1957487|attR 1977180:1977195

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_068280758.1\|1934682_1935588_+\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
WP_068280755.1\|1935589_1937671_+\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_068280751.1\|1937910_1939764_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	1.4e-50	34.2
WP_068280748.1\|1939776_1940892_+	RNA polymerase sigma factor RpoD	F4YCU2	Synechococcus_phage	2.9e-38	38.6
WP_068280746.1\|1941234_1941933_+\|tRNA	tRNA (adenine(22)-N(1))-methyltransferase TrmK	NA	NA	NA	NA
WP_068280745.1\|1941929_1943057_+	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
WP_068280739.1\|1943356_1944592_+	peptidase T	NA	NA	NA	NA
WP_068280738.1\|1944751_1947364_+	ATP-dependent chaperone ClpB	K4FB40	Cronobacter_phage	3.8e-126	36.9
WP_068280737.1\|1947425_1947629_-	YjzD family protein	NA	NA	NA	NA
WP_068280736.1\|1947739_1951087_+	DNA polymerase III subunit alpha	A0A291AVG1	Streptomyces_phage	3.1e-144	32.0
WP_068280734.1\|1951216_1952176_+	6-phosphofructokinase	NA	NA	NA	NA
WP_068280731.1\|1952377_1954138_+	pyruvate kinase	NA	NA	NA	NA
WP_068224441.1\|1954401_1954866_+	DUF441 domain-containing protein	NA	NA	NA	NA
WP_068224437.1\|1954877_1955768_+	DNA-binding protein	NA	NA	NA	NA
WP_068280727.1\|1955967_1956441_+	transcriptional repressor	NA	NA	NA	NA
WP_068280726.1\|1956532_1957420_+	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	7.1e-40	34.5
1957472:1957487	attL	NA	NA	NA	NA
WP_068224424.1\|1957501_1957855_+	RibT protein	NA	NA	NA	NA
WP_068281279.1\|1957867_1958608_+	segregation/condensation protein A	NA	NA	NA	NA
WP_068224421.1\|1958604_1959201_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	9.0e-15	31.2
WP_068224417.1\|1959200_1959932_+	rRNA pseudouridine synthase	NA	NA	NA	NA
WP_068224414.1\|1960258_1960495_-	ferredoxin	A0A127AYY7	Bacillus_phage	8.8e-06	27.8
WP_068280717.1\|1960522_1961584_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_068280713.1\|1961549_1963004_+	ATP-dependent DNA helicase RecQ	L7RCS0	Acanthamoeba_polyphaga_moumouvirus	1.0e-59	32.9
WP_068280711.1\|1963122_1963764_+	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_068224408.1\|1963834_1964521_+	(d)CMP kinase	NA	NA	NA	NA
WP_068224406.1\|1964600_1965842_+	30S ribosomal protein S1	NA	NA	NA	NA
WP_068280704.1\|1965931_1967242_+	ribosome biogenesis GTPase Der	NA	NA	NA	NA
WP_068224403.1\|1967483_1967759_+	HU family DNA-binding protein	A7KV42	Bacillus_phage	1.8e-26	71.9
WP_068280701.1\|1967879_1969142_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_068280698.1\|1969208_1970024_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_068280696.1\|1970363_1971452_+	Ldh family oxidoreductase	NA	NA	NA	NA
WP_082920455.1\|1971686_1972988_-	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_017866964.1\|1973089_1973347_+\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	1.0e-15	47.1
WP_105782191.1\|1973331_1974216_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.2e-65	48.3
WP_068280691.1\|1974848_1975640_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_158234248.1\|1976041_1976902_-	Rgg/GadR/MutR family transcriptional regulator	NA	NA	NA	NA
WP_068280690.1\|1976995_1977547_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
1977180:1977195	attR	NA	NA	NA	NA
WP_082920457.1\|1977539_1978718_+	MFS transporter	NA	NA	NA	NA
WP_068280689.1\|1978729_1979965_+	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_068280685.1\|1980133_1980688_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_068224372.1\|1980705_1981659_+	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_068224366.1\|1981878_1982607_-	hypothetical protein	NA	NA	NA	NA
WP_068280681.1\|1982980_1983850_-	hypothetical protein	NA	NA	NA	NA
WP_068224360.1\|1984396_1984801_+	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_068280680.1\|1985016_1985652_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_068224357.1\|1986069_1986381_+	DUF2316 family protein	NA	NA	NA	NA
WP_068280676.1\|1986827_1988309_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_068280673.1\|1988884_1990396_+	hypothetical protein	NA	NA	NA	NA
WP_068280670.1\|1990412_1990784_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_068280666.1\|1990799_1991522_+	WxL domain-containing protein	NA	NA	NA	NA
WP_068281277.1\|1991738_1992794_+	DUF916 and DUF3324 domain-containing protein	NA	NA	NA	NA
WP_068224347.1\|1993445_1994024_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_068279055.1\|1994589_1995861_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_068280663.1\|1996057_1996549_+	thioredoxin domain-containing protein	NA	NA	NA	NA
WP_068280662.1\|1996697_1997933_+	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_068280661.1\|1997991_1998567_+	hypothetical protein	NA	NA	NA	NA
WP_068279064.1\|1998744_2000055_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	2.7e-128	54.6
WP_156520049.1\|2000445_2000613_+	hypothetical protein	NA	NA	NA	NA
WP_068224565.1\|2000762_2002046_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	5.2e-44	32.1

DBSCAN-SWA_9

2075525 : 2118961

Staphylococcus_phage(23.53%)

protease,tRNA,integrase,transposase

attL 2087194:2087208|attR 2123595:2123609

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_068280601.1\|2075525_2076941_-\|protease	ATP-dependent protease ATPase subunit HslU	A0A1B2IBU3	Erwinia_phage	3.0e-32	25.8
WP_068280598.1\|2076956_2077502_-	HslU--HslV peptidase proteolytic subunit	NA	NA	NA	NA
WP_068224171.1\|2077525_2078431_-	tyrosine recombinase XerC	A0A0K2CP59	Brevibacillus_phage	1.2e-31	28.2
WP_068224168.1\|2078497_2079808_-\|tRNA	FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO	NA	NA	NA	NA
WP_068224165.1\|2079823_2081902_-	type I DNA topoisomerase	A0A1V0SCS0	Indivirus	6.8e-102	36.8
WP_068224160.1\|2082012_2082885_-	DNA-protecting protein DprA	NA	NA	NA	NA
WP_068280595.1\|2082944_2083703_-	ribonuclease HII	E3T5H8	Cafeteria_roenbergensis_virus	1.8e-23	40.4
WP_068224154.1\|2083695_2084550_-	ribosome biogenesis GTPase YlqF	NA	NA	NA	NA
WP_068280589.1\|2085377_2086247_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_068280585.1\|2086388_2086946_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
2087194:2087208	attL	NA	NA	NA	NA
WP_068280582.1\|2087205_2089602_-	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	5.4e-119	30.4
WP_068280579.1\|2090011_2091448_-	S41 family peptidase	A0A0R6PIZ1	Moraxella_phage	2.8e-22	29.7
WP_068224139.1\|2091464_2091692_-	YozE family protein	NA	NA	NA	NA
WP_068224137.1\|2091691_2092324_-	YpmS family protein	NA	NA	NA	NA
WP_082920489.1\|2092323_2093145_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_068224134.1\|2093268_2094114_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	1.5e-18	41.8
WP_068280576.1\|2094267_2094915_+	hemolysin III family protein	NA	NA	NA	NA
WP_068280573.1\|2095519_2096014_-	dihydrofolate reductase	A0A0N9S8H6	Staphylococcus_phage	9.4e-26	37.7
WP_191980582.1\|2096026_2096980_-	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	1.1e-120	65.3
WP_068280570.1\|2096989_2098873_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2H4UUX5	Bodo_saltans_virus	9.1e-45	27.1
WP_068280566.1\|2099265_2100474_-\|tRNA	CCA tRNA nucleotidyltransferase	H7BUW3	unidentified_phage	5.5e-43	51.7
WP_068280563.1\|2100470_2101259_-	4-hydroxy-tetrahydrodipicolinate reductase	NA	NA	NA	NA
WP_068280559.1\|2101377_2102247_+	YitT family protein	M1Q1P6	Streptococcus_phage	4.6e-52	38.7
WP_068280556.1\|2102791_2103655_-	hypothetical protein	NA	NA	NA	NA
WP_068280553.1\|2103892_2104276_-	hypothetical protein	NA	NA	NA	NA
WP_068280550.1\|2105038_2105359_-	nucleotide pyrophosphohydrolase	NA	NA	NA	NA
WP_068280547.1\|2105380_2105866_-	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_167574666.1\|2106536_2107124_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_068280541.1\|2107205_2107823_+\|integrase	phage integrase SAM-like domain-containing protein	A8ATM2	Listeria_phage	6.2e-51	50.5
WP_017866964.1\|2107874_2108132_+\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	1.0e-15	47.1
WP_105782191.1\|2108116_2109001_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.2e-65	48.3
WP_082920460.1\|2109040_2109358_+\|integrase	tyrosine-type recombinase/integrase	A8ATM2	Listeria_phage	1.2e-18	42.7
WP_068280538.1\|2110587_2112240_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	3.6e-122	47.4
WP_068281274.1\|2112258_2115345_-	HsdR family type I site-specific deoxyribonuclease	NA	NA	NA	NA
WP_082920461.1\|2115520_2117665_-	AAA family ATPase	NA	NA	NA	NA
WP_068222179.1\|2117788_2118961_+\|transposase	IS256 family transposase	NA	NA	NA	NA
2123595:2123609	attR	NA	NA	NA	NA

DBSCAN-SWA_10

2202364 : 2252819

Bacillus_phage(23.08%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_068223806.1\|2202364_2202697_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_068223803.1\|2202714_2203023_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_068280414.1\|2203312_2203552_-	cytochrome B5	NA	NA	NA	NA
WP_068223798.1\|2203710_2203977_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_068226204.1\|2204203_2204620_+	PAS domain-containing protein	NA	NA	NA	NA
WP_156520051.1\|2204696_2205338_+	hypothetical protein	NA	NA	NA	NA
WP_068223792.1\|2205512_2205767_+	hypothetical protein	NA	NA	NA	NA
WP_068223115.1\|2206001_2207351_-\|transposase	transposase	NA	NA	NA	NA
WP_068226203.1\|2207856_2208036_-	hypothetical protein	NA	NA	NA	NA
WP_082920249.1\|2208078_2208387_-	hypothetical protein	NA	NA	NA	NA
WP_068223789.1\|2208792_2210202_-	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_068223786.1\|2210655_2211090_+	universal stress protein	NA	NA	NA	NA
WP_156519987.1\|2211094_2211247_+	hypothetical protein	NA	NA	NA	NA
WP_068223783.1\|2211413_2213825_+	Xaa-Pro dipeptidyl-peptidase	NA	NA	NA	NA
WP_068224565.1\|2214105_2215389_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	5.2e-44	32.1
WP_068224688.1\|2215537_2216056_-	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	2.4e-24	38.7
WP_082918574.1\|2216068_2218375_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	1.5e-73	30.5
WP_068224693.1\|2218489_2218906_-	DUF1049 domain-containing protein	NA	NA	NA	NA
WP_068224696.1\|2218947_2219745_-	SDR family oxidoreductase	W8CYX9	Bacillus_phage	9.3e-07	39.5
WP_068280410.1\|2219756_2220686_-	ribonuclease Z	NA	NA	NA	NA
WP_068224702.1\|2220876_2222790_-	acetyltransferase	A0A1R3Y5Q6	Salmonella_virus	3.9e-27	27.5
WP_068224704.1\|2223003_2224299_-	GTPase ObgE	NA	NA	NA	NA
WP_068280407.1\|2224488_2225244_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.2e-24	35.9
WP_068224708.1\|2225240_2226155_+	1-phosphofructokinase	NA	NA	NA	NA
WP_068280404.1\|2226270_2228208_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_156520052.1\|2228284_2228929_-	hypothetical protein	NA	NA	NA	NA
WP_068224714.1\|2229059_2230832_-	excinuclease ABC subunit UvrC	NA	NA	NA	NA
WP_156520063.1\|2231059_2231791_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	6.0e-29	36.4
WP_068224719.1\|2231792_2233250_-	ABC transporter substrate-binding protein/permease	NA	NA	NA	NA
WP_164505765.1\|2233448_2233586_+	hypothetical protein	NA	NA	NA	NA
WP_068224722.1\|2233713_2233938_+	DUF2829 domain-containing protein	G3MBC9	Bacillus_virus	1.8e-08	35.2
WP_068224724.1\|2233934_2234693_+	3-oxoacyl-ACP reductase	NA	NA	NA	NA
WP_068224727.1\|2234974_2235259_-	nucleoside triphosphate pyrophosphohydrolase family protein	A0A1Q1PVZ6	Staphylococcus_phage	2.6e-20	52.1
WP_068224730.1\|2235258_2235855_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_068224733.1\|2236107_2237358_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.4e-137	57.4
WP_068224736.1\|2237592_2238918_-	trigger factor	NA	NA	NA	NA
WP_068224739.1\|2239099_2240287_-	elongation factor Tu	A0A076FFS6	Aureococcus_anophage	5.6e-32	27.6
WP_068224740.1\|2240511_2241474_-	hypothetical protein	NA	NA	NA	NA
WP_068281269.1\|2241624_2243286_-	ribonuclease J	NA	NA	NA	NA
WP_068224742.1\|2243325_2244204_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_068224744.1\|2244411_2244681_-	30S ribosomal protein S15	NA	NA	NA	NA
WP_068224746.1\|2244962_2245220_+	30S ribosomal protein S20	NA	NA	NA	NA
WP_035457977.1\|2245270_2246542_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_068224752.1\|2246776_2247808_-	DNA polymerase III subunit delta	NA	NA	NA	NA
WP_068280398.1\|2247812_2250038_-	DNA internalization-related competence protein ComEC/Rec2	Q332C0	Clostridium_botulinum_C_phage	7.2e-25	27.8
WP_068224757.1\|2250050_2250548_-	ComE operon protein 2	A7KUY9	Bacillus_phage	8.5e-35	56.9
WP_156520064.1\|2250611_2251292_-	helix-hairpin-helix domain-containing protein	NA	NA	NA	NA
WP_068279055.1\|2251547_2252819_+\|transposase	ISL3 family transposase	NA	NA	NA	NA

DBSCAN-SWA_11

2491400 : 2586173

109

Lactobacillus_phage(52.17%)

tRNA,tail,portal,plate,terminase,capsid,protease,holin,integrase,transposase,head

attL 2538968:2538986|attR 2591289:2591307

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_068224565.1\|2491400_2492684_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	5.2e-44	32.1
WP_068225302.1\|2492790_2495661_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	9.2e-307	55.3
WP_068280270.1\|2495754_2497761_-	excinuclease ABC subunit UvrB	NA	NA	NA	NA
WP_068225304.1\|2498153_2498789_-	HD domain-containing protein	NA	NA	NA	NA
WP_068225305.1\|2498931_2500659_-	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	2.8e-186	56.1
WP_068225306.1\|2501055_2502003_-	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	1.2e-82	49.7
WP_068225307.1\|2502078_2502486_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_068225308.1\|2502700_2503717_-	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_068225309.1\|2503744_2504569_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_082918513.1\|2504568_2505609_-	HPr kinase/phosphorylase	NA	NA	NA	NA
WP_068225310.1\|2505891_2506242_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_082918514.1\|2506241_2506535_-	hypothetical protein	NA	NA	NA	NA
WP_068225311.1\|2506534_2506780_-	PspC domain-containing protein	NA	NA	NA	NA
WP_068225312.1\|2506805_2508284_-	daptomycin-sensing surface protein LiaX	NA	NA	NA	NA
WP_068280269.1\|2508470_2509145_-	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_068225314.1\|2509245_2510001_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.4e-19	30.8
WP_068280265.1\|2510044_2510854_-	phosphate ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.4e-12	31.8
WP_068225316.1\|2510856_2511744_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_068280263.1\|2511740_2512664_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_068225318.1\|2512665_2513526_-	phosphate ABC transporter substrate-binding protein PstS family protein	NA	NA	NA	NA
WP_068225319.1\|2513858_2515526_-	sensor histidine kinase	W8CYF6	Bacillus_phage	7.8e-32	35.3
WP_068225320.1\|2515512_2516211_-	response regulator transcription factor	W8CYM9	Bacillus_phage	3.4e-37	35.4
WP_068225321.1\|2516212_2517322_-	hypothetical protein	NA	NA	NA	NA
WP_178378318.1\|2517583_2518700_-	peptide chain release factor 2	NA	NA	NA	NA
WP_068225323.1\|2518848_2521212_-	preprotein translocase subunit SecA	NA	NA	NA	NA
WP_068280260.1\|2521391_2521955_-	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_068225325.1\|2522132_2522819_-	ComF family protein	NA	NA	NA	NA
WP_068225326.1\|2522818_2524138_-	DEAD/DEAH box helicase family protein	A0A1X9I5S6	Streptococcus_phage	7.7e-75	39.2
WP_068225327.1\|2524185_2524824_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	2.2e-43	44.7
WP_068225328.1\|2524929_2526003_-	undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase	NA	NA	NA	NA
WP_068225329.1\|2526404_2527967_-	ribonuclease Y	NA	NA	NA	NA
WP_068225330.1\|2528266_2529436_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	5.7e-122	65.6
WP_068225331.1\|2529540_2530788_-	competence/damage-inducible protein A	NA	NA	NA	NA
WP_068225332.1\|2531117_2531705_-	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_068225333.1\|2531873_2532878_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_068225334.1\|2532963_2533692_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_068225335.1\|2533695_2534994_-	insulinase family protein	A0A2H4UVM3	Bodo_saltans_virus	8.0e-08	27.3
WP_068225336.1\|2534993_2536265_-	insulinase family protein	NA	NA	NA	NA
WP_068225337.1\|2536346_2538740_-	DNA translocase FtsK	Q853W3	Mycobacterium_phage	9.1e-82	45.9
2538968:2538986	attL	NA	NA	NA	NA
WP_068225338.1\|2539057_2539459_-	DUF1149 family protein	NA	NA	NA	NA
WP_068225339.1\|2539476_2541540_-	DNA topoisomerase 3	NA	NA	NA	NA
WP_068225340.1\|2541562_2542072_-\|tRNA	tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL	NA	NA	NA	NA
WP_068280257.1\|2542315_2542762_-	hypothetical protein	NA	NA	NA	NA
WP_068280255.1\|2542763_2543072_-	hypothetical protein	NA	NA	NA	NA
WP_068280252.1\|2543236_2544688_-	LysM peptidoglycan-binding domain-containing protein	Q6EVN0	Oenoccocus_phage	7.6e-124	60.2
WP_082920469.1\|2544671_2545163_-	hypothetical protein	NA	NA	NA	NA
WP_068280248.1\|2545168_2545531_-	hypothetical protein	NA	NA	NA	NA
WP_068280245.1\|2545523_2545940_-	hypothetical protein	D6PSR9	Lactobacillus_phage	7.9e-26	45.7
WP_068280242.1\|2545977_2546187_-	XkdX family protein	NA	NA	NA	NA
WP_068280239.1\|2546246_2546564_-	hypothetical protein	NA	NA	NA	NA
WP_068280237.1\|2546577_2547555_-\|plate	BppU family phage baseplate upper protein	NA	NA	NA	NA
WP_068280234.1\|2547586_2549203_-	hypothetical protein	NA	NA	NA	NA
WP_068280230.1\|2549195_2549561_-	hypothetical protein	NA	NA	NA	NA
WP_068280227.1\|2549571_2550174_-	collagen-like protein	NA	NA	NA	NA
WP_167574659.1\|2550825_2551977_-\|tail	phage tail protein	A0A0M7RDS2	Lactobacillus_phage	1.4e-83	47.9
WP_068280219.1\|2551936_2552776_-\|tail	phage tail family protein	A0A0M7RF73	Lactobacillus_phage	8.4e-43	35.3
WP_068280216.1\|2552789_2557718_-\|tail	phage tail tape measure protein	E9LUR1	Lactobacillus_phage	1.4e-100	40.7
WP_068280213.1\|2557921_2558320_-	hypothetical protein	NA	NA	NA	NA
WP_068280210.1\|2558488_2559130_-\|tail	phage tail protein	E9LUQ8	Lactobacillus_phage	2.6e-84	75.0
WP_068280207.1\|2559130_2559511_-	DUF806 family protein	E9LUQ7	Lactobacillus_phage	1.9e-34	55.1
WP_068280204.1\|2559510_2559945_-\|tail	phage tail protein	E9LUQ6	Lactobacillus_phage	2.6e-35	55.9
WP_068280201.1\|2559937_2560297_-\|head	phage head closure protein	E9LUQ5	Lactobacillus_phage	5.6e-36	56.3
WP_068280198.1\|2560280_2560637_-\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	1.3e-24	59.5
WP_068280195.1\|2560649_2560844_-	hypothetical protein	NA	NA	NA	NA
WP_068280192.1\|2560888_2562121_-\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	1.4e-142	66.7
WP_068280189.1\|2562120_2562900_-\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	1.5e-57	54.6
WP_068280185.1\|2562865_2564071_-\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	2.6e-130	58.8
WP_082920239.1\|2564070_2564295_-	DUF1056 family protein	NA	NA	NA	NA
WP_068280182.1\|2564266_2566174_-\|terminase	terminase large subunit	E9LUP9	Lactobacillus_phage	8.3e-280	72.8
WP_068280179.1\|2566163_2566625_-\|terminase	phage terminase small subunit P27 family	E9LUP8	Lactobacillus_phage	8.4e-53	67.1
WP_082920490.1\|2566811_2567276_-	HNH endonuclease	E9LUP7	Lactobacillus_phage	5.1e-66	77.2
WP_068280173.1\|2567651_2568062_-	hypothetical protein	NA	NA	NA	NA
WP_156520053.1\|2568330_2568588_-	hypothetical protein	NA	NA	NA	NA
WP_068280166.1\|2568603_2568798_-	hypothetical protein	NA	NA	NA	NA
WP_156520054.1\|2568810_2569254_-	DUF1064 domain-containing protein	A0A1I9KKZ1	Lactobacillus_phage	1.1e-30	45.7
WP_068280160.1\|2569244_2569469_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_068280158.1\|2569483_2569768_-	hypothetical protein	NA	NA	NA	NA
WP_068280156.1\|2569782_2569986_-	hypothetical protein	NA	NA	NA	NA
WP_156520055.1\|2570319_2570463_-	hypothetical protein	NA	NA	NA	NA
WP_156520056.1\|2570711_2570930_-	hypothetical protein	NA	NA	NA	NA
WP_068280148.1\|2570998_2571253_-	hypothetical protein	NA	NA	NA	NA
WP_167574660.1\|2571242_2571407_-	hypothetical protein	A0A2D1GPI6	Lactobacillus_phage	2.3e-21	88.5
WP_068280145.1\|2571423_2571735_-	hypothetical protein	A0A1S5SA91	Streptococcus_phage	2.9e-09	37.8
WP_191980585.1\|2571764_2572010_-	hypothetical protein	Q5ULS7	Lactobacillus_virus	4.3e-24	74.2
WP_068280142.1\|2572071_2572341_-	hypothetical protein	NA	NA	NA	NA
WP_068280139.1\|2572360_2572606_-	hypothetical protein	NA	NA	NA	NA
WP_156520057.1\|2572868_2573021_-	hypothetical protein	NA	NA	NA	NA
WP_082920472.1\|2573060_2573804_-	site-specific DNA-methyltransferase	B4XYT3	Lactobacillus_phage	2.2e-103	71.4
WP_068280133.1\|2573823_2574174_-	DUF1642 domain-containing protein	B4XYT7	Lactobacillus_phage	1.7e-13	39.5
WP_068280130.1\|2574163_2574667_-	DUF1642 domain-containing protein	Q8LTB6	Lactobacillus_phage	1.5e-39	57.1
WP_068280128.1\|2574667_2574904_-	hypothetical protein	NA	NA	NA	NA
WP_068280126.1\|2575006_2575576_-	hypothetical protein	NA	NA	NA	NA
WP_082920473.1\|2575594_2575957_-	single-stranded DNA-binding protein	A0A1S5SAA1	Streptococcus_phage	1.2e-38	63.1
WP_068280124.1\|2575949_2576195_-	hypothetical protein	NA	NA	NA	NA
WP_068280122.1\|2576196_2576523_-	VRR-NUC domain-containing protein	A8ATF4	Listeria_phage	3.9e-12	40.6
WP_068280118.1\|2576509_2576887_-	hypothetical protein	NA	NA	NA	NA
WP_068280115.1\|2576900_2578178_-	AAA family ATPase	A0A1P8VVQ6	Streptococcus_phage	3.0e-23	33.1
WP_068280112.1\|2578174_2579053_-	helix-turn-helix domain-containing protein	A0A2P1CD59	Lactobacillus_phage	3.9e-30	65.7
WP_068280108.1\|2579039_2579711_-	hypothetical protein	U5U4M2	Lactobacillus_phage	7.1e-85	67.3
WP_068280103.1\|2579710_2580406_-	ERF family protein	A0A2H4J7J4	uncultured_Caudovirales_phage	8.6e-25	42.6
WP_068280100.1\|2580398_2580710_-	hypothetical protein	NA	NA	NA	NA
WP_068225060.1\|2580721_2581264_-	host-nuclease inhibitor Gam family protein	NA	NA	NA	NA
WP_068225381.1\|2581666_2581948_-	hypothetical protein	NA	NA	NA	NA
WP_068225382.1\|2581962_2582718_-	phage antirepressor KilAC domain-containing protein	A0A0A7DN31	Lactobacillus_phage	8.6e-71	62.6
WP_068280097.1\|2582763_2582988_-	helix-turn-helix transcriptional regulator	A0A2K9VBT6	Staphylococcus_phage	1.9e-10	47.8
WP_068225384.1\|2583160_2583820_+	LexA family transcriptional regulator	B4XYR6	Lactobacillus_phage	8.6e-59	52.2
WP_068280095.1\|2583904_2584168_+	hypothetical protein	NA	NA	NA	NA
WP_068280093.1\|2584190_2584826_+	zinc-ribbon domain-containing protein	NA	NA	NA	NA
WP_068225387.1\|2584982_2586173_+\|integrase	site-specific integrase	A0A0M5M609	Bacillus_phage	6.0e-18	29.1
2591289:2591307	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP014874

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP014873

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection